Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
CAGL0B01705g8.255ON67267236260.0
YDR108W (TRS85)8.255ON69867322990.0
Suva_2.2688.255ON69567022920.0
Smik_4.3548.255ON69867322640.0
Skud_4.3698.255ON69867322580.0
Kpol_392.118.255ON67567421280.0
NCAS0B038808.255ON70669321110.0
ZYRO0C01826g8.255ON69969820570.0
NDAI0J014108.255ON71669520580.0
TDEL0F038208.255ON68766620060.0
KAFR0B055708.255ON66968119490.0
TPHA0B032608.255ON71471419450.0
Kwal_56.235838.255ON70071518800.0
KLTH0G13860g8.255ON70871417820.0
SAKL0H17226g8.255ON71974317230.0
KNAG0H032708.255ON64870216000.0
TBLA0E043808.255ON88963314220.0
Ecym_43168.255ON62366912861e-169
AGR096C8.255ON62368312321e-161
KLLA0F18953g8.255ON64768411571e-149
ZYRO0D05258g7.76ON75082820.28
Kpol_1060.561.209ON43088800.51
CAGL0J08734g7.76ON74268780.86
KLTH0C08250g3.238ON32469761.4
Ecym_21136.306ON87988733.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0B01705g
         (672 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0B01705g Chr2 (157245..159263) [2019 bp, 672 aa] {ON} highly...  1401   0.0  
YDR108W Chr4 (671269..673365) [2097 bp, 698 aa] {ON}  TRS85Subun...   890   0.0  
Suva_2.268 Chr2 (465716..467803) [2088 bp, 695 aa] {ON} YDR108W ...   887   0.0  
Smik_4.354 Chr4 (632598..634694) [2097 bp, 698 aa] {ON} YDR108W ...   876   0.0  
Skud_4.369 Chr4 (642869..644965) [2097 bp, 698 aa] {ON} YDR108W ...   874   0.0  
Kpol_392.11 s392 complement(30871..32898) [2028 bp, 675 aa] {ON}...   824   0.0  
NCAS0B03880 Chr2 complement(691369..693489) [2121 bp, 706 aa] {O...   817   0.0  
ZYRO0C01826g Chr3 complement(143874..145973) [2100 bp, 699 aa] {...   796   0.0  
NDAI0J01410 Chr10 complement(323873..326023) [2151 bp, 716 aa] {...   797   0.0  
TDEL0F03820 Chr6 (699240..701303) [2064 bp, 687 aa] {ON} Anc_8.2...   777   0.0  
KAFR0B05570 Chr2 complement(1140432..1142441) [2010 bp, 669 aa] ...   755   0.0  
TPHA0B03260 Chr2 complement(749568..751712) [2145 bp, 714 aa] {O...   753   0.0  
Kwal_56.23583 s56 (607721..609823) [2103 bp, 700 aa] {ON} YDR108...   728   0.0  
KLTH0G13860g Chr7 complement(1201656..1203782) [2127 bp, 708 aa]...   691   0.0  
SAKL0H17226g Chr8 complement(1526848..1529007) [2160 bp, 719 aa]...   668   0.0  
KNAG0H03270 Chr8 complement(609643..611589) [1947 bp, 648 aa] {O...   620   0.0  
TBLA0E04380 Chr5 (1112393..1115062) [2670 bp, 889 aa] {ON} Anc_8...   552   0.0  
Ecym_4316 Chr4 complement(683492..685363) [1872 bp, 623 aa] {ON}...   499   e-169
AGR096C Chr7 complement(917898..919769) [1872 bp, 623 aa] {ON} S...   479   e-161
KLLA0F18953g Chr6 (1737522..1739465) [1944 bp, 647 aa] {ON} simi...   450   e-149
ZYRO0D05258g Chr4 complement(448819..451071) [2253 bp, 750 aa] {...    36   0.28 
Kpol_1060.56 s1060 complement(132691..133983) [1293 bp, 430 aa] ...    35   0.51 
CAGL0J08734g Chr10 (862513..864741) [2229 bp, 742 aa] {ON} highl...    35   0.86 
KLTH0C08250g Chr3 complement(701335..702309) [975 bp, 324 aa] {O...    34   1.4  
Ecym_2113 Chr2 (210298..212937) [2640 bp, 879 aa] {ON} similar t...    33   3.6  

>CAGL0B01705g Chr2 (157245..159263) [2019 bp, 672 aa] {ON} highly
           similar to uniprot|P46944 Saccharomyces cerevisiae
           YDR108w GSG1
          Length = 672

 Score = 1401 bits (3626), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 672/672 (100%), Positives = 672/672 (100%)

Query: 1   MVFSYEHYMNLIYHLDDANETVPSDIAKRVVSNAMAPVITVTSTVLLDRHIEETYGIDSL 60
           MVFSYEHYMNLIYHLDDANETVPSDIAKRVVSNAMAPVITVTSTVLLDRHIEETYGIDSL
Sbjct: 1   MVFSYEHYMNLIYHLDDANETVPSDIAKRVVSNAMAPVITVTSTVLLDRHIEETYGIDSL 60

Query: 61  YMLLRFFGGCVSDRDQANEVKLGTDGLKVTEEGVENEKDGTNGLTVPRQTRVRSNSNSLY 120
           YMLLRFFGGCVSDRDQANEVKLGTDGLKVTEEGVENEKDGTNGLTVPRQTRVRSNSNSLY
Sbjct: 61  YMLLRFFGGCVSDRDQANEVKLGTDGLKVTEEGVENEKDGTNGLTVPRQTRVRSNSNSLY 120

Query: 121 QRDATQSQYVRFTKPLADLINTQDANDMLFDYHSLEVYLQEYLSVVDKKFSPHIPHHLLK 180
           QRDATQSQYVRFTKPLADLINTQDANDMLFDYHSLEVYLQEYLSVVDKKFSPHIPHHLLK
Sbjct: 121 QRDATQSQYVRFTKPLADLINTQDANDMLFDYHSLEVYLQEYLSVVDKKFSPHIPHHLLK 180

Query: 181 TSIYHSFFALAISSTSKLSPFECFNHPIVSLLAIDITRNEDYETAAEQLKEFKSMNNNIP 240
           TSIYHSFFALAISSTSKLSPFECFNHPIVSLLAIDITRNEDYETAAEQLKEFKSMNNNIP
Sbjct: 181 TSIYHSFFALAISSTSKLSPFECFNHPIVSLLAIDITRNEDYETAAEQLKEFKSMNNNIP 240

Query: 241 SFPSFINTNDILPVFLLCYNKDNETEFEECQTLAGKLKKQLFVESIILPLWSTEFTDNLV 300
           SFPSFINTNDILPVFLLCYNKDNETEFEECQTLAGKLKKQLFVESIILPLWSTEFTDNLV
Sbjct: 241 SFPSFINTNDILPVFLLCYNKDNETEFEECQTLAGKLKKQLFVESIILPLWSTEFTDNLV 300

Query: 301 VSLHQPVMSSIEEIMFFLQNPVDHKLPLKLVNCIYDQIDMIVYDLMKPFMKRKMTFWEET 360
           VSLHQPVMSSIEEIMFFLQNPVDHKLPLKLVNCIYDQIDMIVYDLMKPFMKRKMTFWEET
Sbjct: 301 VSLHQPVMSSIEEIMFFLQNPVDHKLPLKLVNCIYDQIDMIVYDLMKPFMKRKMTFWEET 360

Query: 361 ILTPRKSLFHGAKFFKKFMNKSTQALSQPNSLLKENHGSNYLSSTSPEFLMRKLADWSMM 420
           ILTPRKSLFHGAKFFKKFMNKSTQALSQPNSLLKENHGSNYLSSTSPEFLMRKLADWSMM
Sbjct: 361 ILTPRKSLFHGAKFFKKFMNKSTQALSQPNSLLKENHGSNYLSSTSPEFLMRKLADWSMM 420

Query: 421 VSDFKTAYTTYESLCQDFERMPKYLASCSEWCAVSLLMGAQNIVTAKMLKNEINPAIERA 480
           VSDFKTAYTTYESLCQDFERMPKYLASCSEWCAVSLLMGAQNIVTAKMLKNEINPAIERA
Sbjct: 421 VSDFKTAYTTYESLCQDFERMPKYLASCSEWCAVSLLMGAQNIVTAKMLKNEINPAIERA 480

Query: 481 LGAYELCATESNAHRKFGDSDDLSAPVRSYETRCMFLASELFLSLSDTWTSTPFAIAYLE 540
           LGAYELCATESNAHRKFGDSDDLSAPVRSYETRCMFLASELFLSLSDTWTSTPFAIAYLE
Sbjct: 481 LGAYELCATESNAHRKFGDSDDLSAPVRSYETRCMFLASELFLSLSDTWTSTPFAIAYLE 540

Query: 541 TILNECKLGPLSEIMIWERLSDCYGMRIDPRIKHRIGNLELLQKKEENMDDPKNADVFTT 600
           TILNECKLGPLSEIMIWERLSDCYGMRIDPRIKHRIGNLELLQKKEENMDDPKNADVFTT
Sbjct: 541 TILNECKLGPLSEIMIWERLSDCYGMRIDPRIKHRIGNLELLQKKEENMDDPKNADVFTT 600

Query: 601 EDILSKGLTRNRKAALFKLIAARKWCEQKQWRELSWCLDDLESTYSDLKCFNKENLLYTR 660
           EDILSKGLTRNRKAALFKLIAARKWCEQKQWRELSWCLDDLESTYSDLKCFNKENLLYTR
Sbjct: 601 EDILSKGLTRNRKAALFKLIAARKWCEQKQWRELSWCLDDLESTYSDLKCFNKENLLYTR 660

Query: 661 LRNELIAARQDM 672
           LRNELIAARQDM
Sbjct: 661 LRNELIAARQDM 672

>YDR108W Chr4 (671269..673365) [2097 bp, 698 aa] {ON}  TRS85Subunit
           of TRAPPIII (transport protein particle), a multimeric
           guanine nucleotide-exchange factor for Ypt1p, required
           for membrane expansion during autophagy and the CVT
           pathway; directs Ypt1p to the PAS; late post-replication
           meiotic role
          Length = 698

 Score =  890 bits (2299), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 430/673 (63%), Positives = 531/673 (78%), Gaps = 8/673 (1%)

Query: 1   MVFSYEHYMNLIYHLDDANETVPSDIAKRVVSNAMAPVITVTSTVLLDRHIEETYGIDSL 60
           MVFSYEHYMNL++HLD++ ETVP +IAKR++SNA+APVITVTST L D+HI+ETY +DSL
Sbjct: 1   MVFSYEHYMNLLFHLDNSKETVPPEIAKRIISNAIAPVITVTSTPLFDKHIQETYKVDSL 60

Query: 61  YMLLRFFGGCVSDRDQANEVKLGTDGLKVTEEGVENEKDGTN-GLTVPRQTR--VRSNSN 117
           YMLLRFFGGCVSDRDQANE K+G    +V +     +    N  L VP  ++   RS SN
Sbjct: 61  YMLLRFFGGCVSDRDQANEAKVGQHEHEVCDASDSTDSIPKNKNLEVPNLSKKGSRSRSN 120

Query: 118 SLYQRDATQSQYVRFTKPLADLINTQDANDMLFDYHSLEVYLQEYLSVVDKKFSPHIPHH 177
           SL+QRD+TQSQY+RFT+PL DLI T+DANDMLF+YHSLEV+L  YL +V       +PH+
Sbjct: 121 SLFQRDSTQSQYIRFTRPLGDLIETRDANDMLFNYHSLEVFLDNYLKLVAANTDEMVPHN 180

Query: 178 LLKTSIYHSFFALAISSTSKLSPFECFNHPIVSLLAIDITRNEDYETAAEQLKEFKSMNN 237
           LLK SIYHSFF+LAISST+ LSP+E FNHPI+SL+A+DI+  E YE A + L  FK++N+
Sbjct: 181 LLKKSIYHSFFSLAISSTNNLSPYETFNHPILSLIALDISNGEVYEDARDLLVNFKNLNH 240

Query: 238 NIPSFPSFINTNDILPVFLLCYNKDNETEFEECQTLAGKLKKQLFVESIILPLWSTEFT- 296
           N  +FP F+NTN++LPVFLLCYN D++ EFE+CQ LA KLKKQLFVESI+L LW   F  
Sbjct: 241 NTENFPIFMNTNEMLPVFLLCYNDDSQEEFEKCQALAKKLKKQLFVESILLALWKDSFIY 300

Query: 297 -DNLVVSLHQPVMSSIEEIMFFLQNPVDHKLPLKLVNCIYDQIDMIVYDLMKPFMKRKMT 355
            +N V+ LHQPVMSS+EEI+FFLQ P    L L L+N IYD +D +VYDLM PFMKRK++
Sbjct: 301 DENSVIQLHQPVMSSLEEILFFLQAPTQTTLSLALINSIYDMLDYLVYDLMIPFMKRKVS 360

Query: 356 FWEETILTPRKSLFHGAKFFKKFMNKS-TQALSQPNSLLKENHGSNYLSSTSPEFLMRKL 414
           FWEETIL PRKSLF+GAKFFKKFMNK+      Q NSL +++ G+ Y +S+S EFLMRKL
Sbjct: 361 FWEETILQPRKSLFNGAKFFKKFMNKNPVNGNHQHNSLTRDSQGNEYFASSSSEFLMRKL 420

Query: 415 ADWSMMVSDFKTAYTTYESLCQDFERMPKYLASCSEWCAVSLLMGAQNIVTAKMLKNEIN 474
           ADWSMM+SDFKTAY+TYESL  D +  PKYLASC EWCAVSLLMGAQ+IVT KM+KN+IN
Sbjct: 421 ADWSMMLSDFKTAYSTYESLMDDLDAFPKYLASCIEWCAVSLLMGAQSIVTVKMIKNDIN 480

Query: 475 PAIERALGAYELCATESNAHRKFGDSDDLSAPVRSYETRCMFLASELFLSLSDTWTSTPF 534
           P IERAL  YE C+       K  +S D++ PVRSYETRCM LASELFLSLS+TWTSTP+
Sbjct: 481 PLIERALATYENCSRIQRGKGKESNSLDVTEPVRSYETRCMILASELFLSLSNTWTSTPY 540

Query: 535 AIAYLETILNECKLGPLSEIMIWERLSDCYGMRIDPRIKHRIGNLELLQKKEENM--DDP 592
           AI YLETIL+ECKLGP S+IM+WERLSDCY +R+DPRIKHR+G ++   K  E++  +  
Sbjct: 541 AIQYLETILDECKLGPCSQIMVWERLSDCYNLRVDPRIKHRVGAMKKDAKDTEDLRGEHK 600

Query: 593 KNADVFTTEDILSKGLTRNRKAALFKLIAARKWCEQKQWRELSWCLDDLESTYSDLKCFN 652
            + D FT EDILS+GLTR RKAA F+LIAA+KW EQKQWR++SWCL D+ESTYS++K  +
Sbjct: 601 YSTDHFTDEDILSEGLTRRRKAAFFRLIAAKKWAEQKQWRQVSWCLKDIESTYSEIKFLH 660

Query: 653 KENLLYTRLRNEL 665
              L+ ++L+N+L
Sbjct: 661 GNGLILSKLKNQL 673

>Suva_2.268 Chr2 (465716..467803) [2088 bp, 695 aa] {ON} YDR108W
           (REAL)
          Length = 695

 Score =  887 bits (2292), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 428/670 (63%), Positives = 521/670 (77%), Gaps = 5/670 (0%)

Query: 1   MVFSYEHYMNLIYHLDDANETVPSDIAKRVVSNAMAPVITVTSTVLLDRHIEETYGIDSL 60
           MVFSYEHYMNL++HLD + ETVP +IAKR+VSNA+APVITVTST L D+HI+E Y +DSL
Sbjct: 1   MVFSYEHYMNLLFHLDHSRETVPPEIAKRIVSNAIAPVITVTSTPLFDKHIQEAYSVDSL 60

Query: 61  YMLLRFFGGCVSDRDQANEVKLGTDGLKVTEEGVENEKDGTNGLTVPRQTRVRSNSNSLY 120
           YMLLRFFGGCVSDRDQANE K   D    +     + K+   G+    +   RS SNSL+
Sbjct: 61  YMLLRFFGGCVSDRDQANEGKFEQDEQNASPSIESSSKNQNLGVPSALKRGSRSRSNSLF 120

Query: 121 QRDATQSQYVRFTKPLADLINTQDANDMLFDYHSLEVYLQEYLSVVDKKFSPHIPHHLLK 180
           QRD+TQSQYVRFT+PL DLI T+D NDMLF+YHSLEV+L  YL +V       +PH LLK
Sbjct: 121 QRDSTQSQYVRFTRPLGDLIETRDTNDMLFNYHSLEVFLDNYLKLVAGNTDEKVPHDLLK 180

Query: 181 TSIYHSFFALAISSTSKLSPFECFNHPIVSLLAIDITRNEDYETAAEQLKEFKSMNNNIP 240
            SIYHSFF+LAISST+ LSP+E FNHPI+SL+A+DI+  E YE A + L  FK++N+N  
Sbjct: 181 KSIYHSFFSLAISSTNNLSPYETFNHPILSLIALDISYGEVYEDARDLLVNFKNLNHNTE 240

Query: 241 SFPSFINTNDILPVFLLCYNKDNETEFEECQTLAGKLKKQLFVESIILPLWSTEFTD--N 298
           SFP F+NTN++LPVFLLCYN +++ EFE+CQ LA KLKKQLFVESI+LPLW   F D  N
Sbjct: 241 SFPIFMNTNEMLPVFLLCYNDESQEEFEKCQALAKKLKKQLFVESILLPLWKDSFVDVEN 300

Query: 299 LVVSLHQPVMSSIEEIMFFLQNPVDHKLPLKLVNCIYDQIDMIVYDLMKPFMKRKMTFWE 358
             + LHQPVMSS+EEI+FFL+ P   KL L L+N IYD +D +VYDLM PFMKRK++FWE
Sbjct: 301 SNIQLHQPVMSSLEEILFFLRAPTQTKLSLPLINSIYDMLDYLVYDLMIPFMKRKISFWE 360

Query: 359 ETILTPRKSLFHGAKFFKKFMNKS-TQALSQPNSLLKENHGSNYLSSTSPEFLMRKLADW 417
           ETIL PRKSLF+GAKFFKKFMNK+      Q NSL K+N G+ Y +S+S EFLMRKLADW
Sbjct: 361 ETILQPRKSLFNGAKFFKKFMNKAPVNGNHQHNSLTKDNQGNEYFASSSSEFLMRKLADW 420

Query: 418 SMMVSDFKTAYTTYESLCQDFERMPKYLASCSEWCAVSLLMGAQNIVTAKMLKNEINPAI 477
           SMM+SDFKTAY+TYESL  D +  PKYLASC EWCAVSLLMGAQ+IVT KM+KN+INP I
Sbjct: 421 SMMLSDFKTAYSTYESLMDDLDAFPKYLASCIEWCAVSLLMGAQSIVTVKMIKNDINPLI 480

Query: 478 ERALGAYELCATESNAHRKFGDSDDLSAPVRSYETRCMFLASELFLSLSDTWTSTPFAIA 537
           ERAL  YE C+     + K   S  +  PVRSYETRCM LASELFLSLSDTWTSTP+AI 
Sbjct: 481 ERALATYENCSRMQRRNSKELTSSGVLEPVRSYETRCMILASELFLSLSDTWTSTPYAIQ 540

Query: 538 YLETILNECKLGPLSEIMIWERLSDCYGMRIDPRIKHRIGNLELLQKKEENM--DDPKNA 595
           YLETIL+ECKLGP S+IM+WERLSDCY +R+DPR+KH++G ++   K  E++  DD  + 
Sbjct: 541 YLETILDECKLGPCSQIMVWERLSDCYNLRVDPRVKHKVGGMKKSVKNTEDLRNDDEYDT 600

Query: 596 DVFTTEDILSKGLTRNRKAALFKLIAARKWCEQKQWRELSWCLDDLESTYSDLKCFNKEN 655
           D FT EDILS+GLTR RKAA F+L+AA+KW EQKQWR++SWCL D+E+TYSD+   +   
Sbjct: 601 DHFTEEDILSEGLTRRRKAAFFRLMAAKKWAEQKQWRQVSWCLKDIENTYSDIDFLHGNG 660

Query: 656 LLYTRLRNEL 665
           L+ + L+N+L
Sbjct: 661 LILSNLKNQL 670

>Smik_4.354 Chr4 (632598..634694) [2097 bp, 698 aa] {ON} YDR108W
           (REAL)
          Length = 698

 Score =  876 bits (2264), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 426/673 (63%), Positives = 521/673 (77%), Gaps = 8/673 (1%)

Query: 1   MVFSYEHYMNLIYHLDDANETVPSDIAKRVVSNAMAPVITVTSTVLLDRHIEETYGIDSL 60
           MVFSYEHYMNL++HLD++ ETVP +IAKR+VSNA+APVITVTST L D+HI+E Y +DSL
Sbjct: 1   MVFSYEHYMNLLFHLDNSKETVPPEIAKRIVSNAIAPVITVTSTPLFDKHIQEAYKVDSL 60

Query: 61  YMLLRFFGGCVSDRDQANEVKLGTDGLKVTEEGVENEK-DGTNGLTVPR--QTRVRSNSN 117
           YMLLRFFGGCVSDRDQANEVK+G D  +V +     E    +  L VP   +   RS SN
Sbjct: 61  YMLLRFFGGCVSDRDQANEVKVGQDEHQVGDTNASMESFSKSKNLEVPNLPKKGSRSRSN 120

Query: 118 SLYQRDATQSQYVRFTKPLADLINTQDANDMLFDYHSLEVYLQEYLSVVDKKFSPHIPHH 177
           SL+QRD+TQSQY+RFT+PL DLI T+D NDMLF+YHSLEV+L  YL +V       +PH 
Sbjct: 121 SLFQRDSTQSQYIRFTRPLDDLIETRDTNDMLFNYHSLEVFLDNYLKLVADNTDEMVPHD 180

Query: 178 LLKTSIYHSFFALAISSTSKLSPFECFNHPIVSLLAIDITRNEDYETAAEQLKEFKSMNN 237
           LLK SIYHSFF+LAISST+ LSP+E FNHPI+SL+A+DI+  E YE A + L  FK++N+
Sbjct: 181 LLKKSIYHSFFSLAISSTNNLSPYETFNHPILSLIALDISNGEVYEDARDLLVNFKNLNH 240

Query: 238 NIPSFPSFINTNDILPVFLLCYNKDNETEFEECQTLAGKLKKQLFVESIILPLWSTEF-- 295
           N  +FP F+NTN++LPVFLLCYN +++ EFE+CQ LA KLKKQLFVES++L LW   F  
Sbjct: 241 NTENFPLFMNTNEMLPVFLLCYNDESQEEFEKCQALAKKLKKQLFVESVLLSLWKDSFIE 300

Query: 296 TDNLVVSLHQPVMSSIEEIMFFLQNPVDHKLPLKLVNCIYDQIDMIVYDLMKPFMKRKMT 355
            +N  + LHQPVMSS+EEI+FFLQ P    L L L+N IYD +D +VYDLM PFMKRK++
Sbjct: 301 ANNSAIQLHQPVMSSLEEILFFLQAPTQTSLSLPLINSIYDMLDYLVYDLMIPFMKRKVS 360

Query: 356 FWEETILTPRKSLFHGAKFFKKFMNKS-TQALSQPNSLLKENHGSNYLSSTSPEFLMRKL 414
           FWEETIL PRKSLF+GAKFFKKFMNK+ +      NSL  +N G+ Y +S+S EFLMRKL
Sbjct: 361 FWEETILQPRKSLFNGAKFFKKFMNKNPSNGNHHHNSLTSDNQGNEYFASSSSEFLMRKL 420

Query: 415 ADWSMMVSDFKTAYTTYESLCQDFERMPKYLASCSEWCAVSLLMGAQNIVTAKMLKNEIN 474
           ADWSMM+SDFKTAY+TYESL  D +  PKYLASC EWCAVSLLMGAQ IVT KM+KN+IN
Sbjct: 421 ADWSMMLSDFKTAYSTYESLMDDLDAFPKYLASCIEWCAVSLLMGAQRIVTVKMIKNDIN 480

Query: 475 PAIERALGAYELCATESNAHRKFGDSDDLSAPVRSYETRCMFLASELFLSLSDTWTSTPF 534
           P IE+AL  YE C+    +  +   S +   PVRSYETRCM LASELFLSLSD WTSTP+
Sbjct: 481 PLIEKALATYENCSKIQRSKSEKSSSSNTVEPVRSYETRCMILASELFLSLSDKWTSTPY 540

Query: 535 AIAYLETILNECKLGPLSEIMIWERLSDCYGMRIDPRIKHRIGNLELLQKKEENM--DDP 592
           AI YLETIL+ECKLGP  +IMIWERLSDCY +R+DPRIKHR+G ++   +  E++   D 
Sbjct: 541 AIQYLETILDECKLGPCCQIMIWERLSDCYSLRVDPRIKHRVGAMKKGIRDTEDLRGGDG 600

Query: 593 KNADVFTTEDILSKGLTRNRKAALFKLIAARKWCEQKQWRELSWCLDDLESTYSDLKCFN 652
            + D FT +DILS+GLTR RKAA F+LIAARKW EQKQWR++SWCL D+ES YSD+K  N
Sbjct: 601 NSTDHFTDDDILSEGLTRKRKAAFFRLIAARKWAEQKQWRQVSWCLKDIESIYSDIKFLN 660

Query: 653 KENLLYTRLRNEL 665
            + L+ ++L N+L
Sbjct: 661 GDGLILSKLHNQL 673

>Skud_4.369 Chr4 (642869..644965) [2097 bp, 698 aa] {ON} YDR108W
           (REAL)
          Length = 698

 Score =  874 bits (2258), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 430/673 (63%), Positives = 525/673 (78%), Gaps = 8/673 (1%)

Query: 1   MVFSYEHYMNLIYHLDDANETVPSDIAKRVVSNAMAPVITVTSTVLLDRHIEETYGIDSL 60
           MVFSYEHYMNL++HLD++ E VP +IAKR+VSNA+APVITVTST L D+HI+ETY +DSL
Sbjct: 1   MVFSYEHYMNLLFHLDNSEEIVPPEIAKRIVSNAIAPVITVTSTPLFDKHIQETYNVDSL 60

Query: 61  YMLLRFFGGCVSDRDQANEVKLGTDGLKVTEEGVENEKDGTN-GLTVPRQTR--VRSNSN 117
           YMLLRFFGGCVSDRDQANE K+G +  +V++  V  E    N  L VP   +   RS SN
Sbjct: 61  YMLLRFFGGCVSDRDQANEGKVGPNEHEVSDTSVSMESLSKNQNLGVPNALKKGSRSRSN 120

Query: 118 SLYQRDATQSQYVRFTKPLADLINTQDANDMLFDYHSLEVYLQEYLSVVDKKFSPHIPHH 177
           SL+QRD+TQSQY+RFT+PL DLI T+D NDMLF+YHSLEVYL  YL +V +  +   PH 
Sbjct: 121 SLFQRDSTQSQYIRFTRPLGDLIETRDTNDMLFNYHSLEVYLDNYLKLVTENTNETAPHD 180

Query: 178 LLKTSIYHSFFALAISSTSKLSPFECFNHPIVSLLAIDITRNEDYETAAEQLKEFKSMNN 237
           LLK SIYHSFF+LAISST+ LSP+E FNHPI+SL+A+DI+  E YE A + L  FK++N+
Sbjct: 181 LLKKSIYHSFFSLAISSTNNLSPYETFNHPILSLIALDISNGEVYEDARDLLVNFKNLNH 240

Query: 238 NIPSFPSFINTNDILPVFLLCYNKDNETEFEECQTLAGKLKKQLFVESIILPLWSTEFTD 297
           N  +FP F+NTN++LPVFL+CYN +++ EFE+CQ LA KLKKQLFVESI LPLW   F D
Sbjct: 241 NTENFPIFMNTNEMLPVFLICYNDESQEEFEKCQALAKKLKKQLFVESIFLPLWKESFID 300

Query: 298 --NLVVSLHQPVMSSIEEIMFFLQNPVDHKLPLKLVNCIYDQIDMIVYDLMKPFMKRKMT 355
             N  + LHQPVMSS+EEI+FFLQ P    L L L+N IYD +D +VYDLM PFMKRK++
Sbjct: 301 DENSSIKLHQPVMSSLEEILFFLQAPTQTTLSLPLINSIYDILDYLVYDLMIPFMKRKVS 360

Query: 356 FWEETILTPRKSLFHGAKFFKKFMNKS-TQALSQPNSLLKENHGSNYLSSTSPEFLMRKL 414
           FWEETIL PRKSLF+GAKFFKKFMNK+      Q NSL ++  G+ Y SS+S EFLMRKL
Sbjct: 361 FWEETILQPRKSLFNGAKFFKKFMNKNPANGSHQHNSLTRDRQGNEYFSSSSSEFLMRKL 420

Query: 415 ADWSMMVSDFKTAYTTYESLCQDFERMPKYLASCSEWCAVSLLMGAQNIVTAKMLKNEIN 474
           ADWSMM+SDFKTAY+TYESL  D +  PKYLASC EWCAVSLLMGAQ+IVT KM+KN+IN
Sbjct: 421 ADWSMMLSDFKTAYSTYESLMDDLDAFPKYLASCIEWCAVSLLMGAQSIVTVKMIKNDIN 480

Query: 475 PAIERALGAYELCATESNAHRKFGDSDDLSAPVRSYETRCMFLASELFLSLSDTWTSTPF 534
           P IERAL  YE C+       K   S  ++ PVRSYETRCM LASELFLSLSDTWTSTP+
Sbjct: 481 PLIERALATYEKCSQIQRHKGKELSSSSVTEPVRSYETRCMILASELFLSLSDTWTSTPY 540

Query: 535 AIAYLETILNECKLGPLSEIMIWERLSDCYGMRIDPRIKHRIGNLELLQKKEENM--DDP 592
           AI YLETIL+ECKLGP S+IMIWERLSDCY +R+DPRIKHR+G ++   K+ E++   D 
Sbjct: 541 AIQYLETILDECKLGPCSQIMIWERLSDCYNLRVDPRIKHRVGVMKKSFKETEDLRNGDE 600

Query: 593 KNADVFTTEDILSKGLTRNRKAALFKLIAARKWCEQKQWRELSWCLDDLESTYSDLKCFN 652
              D F  EDILS+GLTR RKAA F+LIAA+KW EQK WR++SWCL D+ESTYS++K  +
Sbjct: 601 HYTDHFIEEDILSEGLTRRRKAAFFRLIAAKKWAEQKHWRQVSWCLKDIESTYSEIKFLH 660

Query: 653 KENLLYTRLRNEL 665
             + + ++L+++L
Sbjct: 661 CNDSILSKLKSQL 673

>Kpol_392.11 s392 complement(30871..32898) [2028 bp, 675 aa] {ON}
           complement(30871..32898) [2028 nt, 676 aa]
          Length = 675

 Score =  824 bits (2128), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 391/674 (58%), Positives = 516/674 (76%), Gaps = 15/674 (2%)

Query: 3   FSYEHYMNLIYHLDDANETVPSDIAKRVVSNAMAPVITVTSTVLLDRHIEETYGIDSLYM 62
           FSYE+YMNL+YHLD  NE VP DI+KR+VSNA+APVITV ST  LD+H++++Y IDSLY+
Sbjct: 6   FSYENYMNLVYHLDRVNEPVPQDISKRIVSNAIAPVITVMSTSELDQHVQDSYNIDSLYL 65

Query: 63  LLRFFGGCVSDRDQANEVKLGTDGLKVTEEGVEN----EKDGTNGLTVPRQTRV-RSNSN 117
           L+R+FGGC+SDRDQANE     +     +EGV +    E+  +N L +P+  R  RS SN
Sbjct: 66  LMRYFGGCISDRDQANEYVKKANVENTAQEGVNDQIIEEQRNSNTLELPKSERYSRSRSN 125

Query: 118 SLYQRDATQSQYVRFTKPLADLINTQDANDMLFDYHSLEVYLQEYLSVVDKKFSPHIPHH 177
           SL+QRD+TQS Y+RFTKP+ DLIN++D++DMLFDYHSLEVYL++ LS++DK  +    H 
Sbjct: 126 SLFQRDSTQSHYIRFTKPIEDLINSRDSHDMLFDYHSLEVYLEKCLSLIDKNTNDETDHK 185

Query: 178 LLKTSIYHSFFALAISSTSKLSPFECFNHPIVSLLAIDITRNEDYETAAEQLKEFKSMNN 237
            LK S++H FF+ AISST+ LSP+E FNHP++SL+A+DI++ ++YE A + L +FK+ NN
Sbjct: 186 ALKMSLFHRFFSSAISSTTYLSPYESFNHPLISLVALDISKGQNYEDARDLLIKFKNQNN 245

Query: 238 NIPSFPSFINTNDILPVFLLCYNKDNETEFEECQTLAGKLKKQLFVESIILPLWSTEFTD 297
            +  FP F++TNDIL VFLLCY+ D+E + E CQ +  KLKKQLF ES++LPLW+   ++
Sbjct: 246 AVEEFPPFMSTNDILLVFLLCYDGDSEEQKEICQDVVKKLKKQLFAESLMLPLWNKSHSE 305

Query: 298 NLVVSLHQPVMSSIEEIMFFLQNPVDHKLPLKLVNCIYDQIDMIVYDLMKPFMKRKMTFW 357
           ++ V LHQP MSS++E+++F + P  H+LPL L+N IYD ++ +V DLM PFM+RK++FW
Sbjct: 306 DVQVELHQPAMSSLDEMLYFFERPSVHELPLNLINTIYDLMEKLVVDLMIPFMQRKISFW 365

Query: 358 EETILTPRKSLFHGAKFFKKFMNK-STQALSQPNSLLKENHGSNYLSSTSPEFLMRKLAD 416
           EETIL PRKSLFHG K F+KFMN+ S+Q  +Q N+++K++ G+ Y +S+SPEFL+RKLAD
Sbjct: 366 EETILQPRKSLFHGNKLFRKFMNRSSSQTANQYNNIVKDSRGNEYFTSSSPEFLLRKLAD 425

Query: 417 WSMMVSDFKTAYTTYESLCQDFERMPKYLASCSEWCAVSLLMGAQNIVTAKMLKNEINPA 476
           WSMM+SDFKTAY+TYE+L  D E  PKYLASC EWCA+S+LMGAQNIVTAKM+KN++NP 
Sbjct: 426 WSMMISDFKTAYSTYETLISDLEAHPKYLASCLEWCAISILMGAQNIVTAKMIKNDVNPL 485

Query: 477 IERALGAYELCATESNAHRKFGDSDDLSAPVRSYETRCMFLASELFLSLSDTWTSTPFAI 536
           IER+L  YE C+    A     + + LS PVRSYETRCM L SELFLSL+DTWTSTP+A+
Sbjct: 486 IERSLDTYEQCSIL--AQNSLENDELLSEPVRSYETRCMLLTSELFLSLNDTWTSTPYAL 543

Query: 537 AYLETILNECKLGPLSEIMIWERLSDCYGMRIDPRIKHRIGNLELLQKKEENMDDPKNAD 596
           + LETIL ECKLG  S+IMIWERLSDCY MR DPRI+HR+   E + K E N    +   
Sbjct: 544 SNLETILAECKLGICSQIMIWERLSDCYNMRTDPRIRHRV---ETVTKIENN----EGGQ 596

Query: 597 VFTTEDILSKGLTRNRKAALFKLIAARKWCEQKQWRELSWCLDDLESTYSDLKCFNKENL 656
              T+DI+SKGL R RKAA F+L+AA+KW EQKQWR++SWCL D+E  Y DL    +  L
Sbjct: 597 QLQTDDIVSKGLARKRKAAFFRLLAAKKWAEQKQWRQVSWCLRDVEYIYDDLSFSKRPEL 656

Query: 657 LYTRLRNELIAARQ 670
           +Y +L++EL   RQ
Sbjct: 657 IYQKLKDELNEERQ 670

>NCAS0B03880 Chr2 complement(691369..693489) [2121 bp, 706 aa] {ON}
           Anc_8.255 YDR108W
          Length = 706

 Score =  817 bits (2111), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 406/693 (58%), Positives = 505/693 (72%), Gaps = 36/693 (5%)

Query: 1   MVFSYEHYMNLIYHLDDANETVPSDIAKRVVSNAMAPVITVTSTVLLDRHIEETYGIDSL 60
           M FSYEHYMNL++HLD   ETVPS+IAKR+VSNA++PVI VTST  LD HI ETY IDSL
Sbjct: 1   MNFSYEHYMNLLFHLDYGKETVPSEIAKRIVSNAISPVIAVTSTSELDHHILETYNIDSL 60

Query: 61  YMLLRFFGGCVSDRDQANEVKLGTDGLKVTEEGVENEKDGTNGLTVPR-------QTRVR 113
           YMLLRFF GCVSDRDQANE+          E+  +++    N LT+P        +TR R
Sbjct: 61  YMLLRFFSGCVSDRDQANEL----------EKSQKDKISSNNTLTLPTTSPLPKVRTRGR 110

Query: 114 SNSNSLYQRDATQSQYVRFTKPLADLINTQDANDMLFDYHSLEVYLQEYLSVVDKKFSPH 173
           S SNSL+QRD+TQSQY+RFTKPL D+I T++ANDMLFDYHSLE+YLQ YL ++ K    +
Sbjct: 111 SRSNSLFQRDSTQSQYIRFTKPLGDVIATKNANDMLFDYHSLEIYLQNYLDLIQKNTDDN 170

Query: 174 IPHHLLKTSIYHSFFALAISSTSKLSPFECFNHPIVSLLAIDITRNEDYETAAEQLKEFK 233
            P+ LLK SIYHSFF+LAISST+ LSP+ECFNHP+VSL+A+DI+  ++Y+   + L +FK
Sbjct: 171 TPYELLKKSIYHSFFSLAISSTTILSPYECFNHPVVSLIAVDISLGQNYDDVRDLLVDFK 230

Query: 234 SMNNNIPSFPSFINTNDILPVFLLCYNKDNETEFEECQTLAGKLKKQLFVESIILPLWST 293
           ++N++  +FP F+NTND+LPV LLCY+     +FE CQ L  K+KKQLFVE I LPLW  
Sbjct: 231 NLNSSTHNFPIFMNTNDMLPVVLLCYDDQFIEQFETCQALTKKIKKQLFVECISLPLWKD 290

Query: 294 EFTDNLVVSLHQPVMSSIEEIMFFLQNPVDHKLPLKLVNCIYDQIDMIVYDLMKPFMKRK 353
            +  +  V LHQPVMSS+EE+++FL  P +  LP +L+  IY+ +D +VY+LM PFMKRK
Sbjct: 291 SYPSDPQVHLHQPVMSSLEEMIYFLNQPKEVTLPYELIQSIYNILDSLVYNLMIPFMKRK 350

Query: 354 MTFWEETILTPRKSLFHGAKFFKKFMNKSTQALSQPNSLLKENHGSNYLSSTSPEFLMRK 413
           + FW+ETIL PRKSLFHGAKF KKFM K T    Q N L K+  G+ Y +S S EFLMRK
Sbjct: 351 IAFWDETILQPRKSLFHGAKFLKKFMTK-TALTHQENLLTKDAQGNEYFTSASSEFLMRK 409

Query: 414 LADWSMMVSDFKTAYTTYESLCQDFERMPKYLASCSEWCAVSLLMGAQNIVTAKMLKNEI 473
           LADWSMM+SDFKTAY TYESL  D E  PKY ASC EWCAVSLLMGAQNIVT KMLKN+I
Sbjct: 410 LADWSMMLSDFKTAYATYESLTHDLESFPKYSASCLEWCAVSLLMGAQNIVTVKMLKNDI 469

Query: 474 NPAIERALGAYELCATESNAHRKFGDSDDLSAPVRSYETRCMFLASELFLSLSDTWTSTP 533
           NP IE+AL  YE CAT      K    + +  PVRSYETRCM LASELFLSLSDTWTSTP
Sbjct: 470 NPLIEKALSTYENCATVLPETDKRNTDELIVVPVRSYETRCMILASELFLSLSDTWTSTP 529

Query: 534 FAIAYLETILNECKLGPLSEIMIWERLSDCYGMRIDPRIKHR----IGNLELLQKKEEN- 588
           +AI+YLETIL ECKLG  S+IMIWERLSDCY +R+DPRIKH+    I N    +K  E+ 
Sbjct: 530 YAISYLETILVECKLGACSQIMIWERLSDCYELRVDPRIKHKAAGTIANTSSPKKSSESD 589

Query: 589 -------------MDDPKNADVFTTEDILSKGLTRNRKAALFKLIAARKWCEQKQWRELS 635
                         D   +A+  T +DI+SKG TR RKAA F+L+AA+KW EQK+WR++S
Sbjct: 590 MQGHVMTPSPLTKEDVSNDANNDTDQDIVSKGFTRKRKAAFFRLMAAKKWAEQKRWRQVS 649

Query: 636 WCLDDLESTYSDLKCFNKENLLYTRLRNELIAA 668
           WCL  ++ TYS +   ++++L+  +++N+L  A
Sbjct: 650 WCLQSIDDTYSKIGLADRDDLILKKIQNKLKTA 682

>ZYRO0C01826g Chr3 complement(143874..145973) [2100 bp, 699 aa] {ON}
           similar to uniprot|P46944 Saccharomyces cerevisiae
           YDR108W GSG1 Subunit of TRAPP (transport protein
           particle) a multi-subunit complex involved in targeting
           and/or fusion of ER-to-Golgi transport vesicles with
           their acceptor compartment protein has late meiotic role
           following DNA replication
          Length = 699

 Score =  796 bits (2057), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 392/698 (56%), Positives = 508/698 (72%), Gaps = 38/698 (5%)

Query: 1   MVFSYEHYMNLIYHLDDANETVPSDIAKRVVSNAMAPVITVTSTVLLDRHIEETYGIDSL 60
           M  SYE+YMNL++HLD   ETVP DIA+R+VSNA++PVITV+ST  LDRHI +TY +DSL
Sbjct: 1   MKLSYENYMNLLFHLDHGQETVPPDIARRIVSNAVSPVITVSSTPELDRHIRDTYHLDSL 60

Query: 61  YMLLRFFGGCVSDRDQANEVK---------LGTDGLKVTEEGVENEKDGTNGLTVPRQTR 111
           YM LRFFG CVSDRDQANE +         L  +     +  +EN +  +  L VP  + 
Sbjct: 61  YMFLRFFGDCVSDRDQANEYQPLRSKEEPELVAEPPSKADNLIENSRKSS--LKVPSTSS 118

Query: 112 V---------------RSNSNSLYQRDATQSQYVRFTKPLADLINTQDANDMLFDYHSLE 156
                           R  SNSL+QRD TQSQYVRFT+P+ DLI + D+NDMLFDYHSLE
Sbjct: 119 DTKNTTTSTSGTTGGTRKRSNSLFQRDQTQSQYVRFTRPIDDLIESSDSNDMLFDYHSLE 178

Query: 157 VYLQEYLSVVDKKFSPHIPHHLLKTSIYHSFFALAISSTSKLSPFECFNHPIVSLLAIDI 216
           V+L+  L +V++    + P  LLK S+YH FF+LAISST+ LSP+E FNHP+VSL+AIDI
Sbjct: 179 VFLENTLRLVEEYTDDNTPFELLKKSLYHKFFSLAISSTTYLSPYETFNHPVVSLIAIDI 238

Query: 217 TRNEDYETAAEQLKEFKSMNNNIPSFPSFINTNDILPVFLLCYNKDNETEFEECQTLAGK 276
           +  + YE A + L +FK++N+ + +FP F++T DILPVFLLCYN ++E E   CQ LA +
Sbjct: 239 SAGQGYEEARDLLIKFKNLNHTVENFPIFMSTGDILPVFLLCYNDESEDEQNACQQLANQ 298

Query: 277 LKKQLFVESIILPLWSTEFTDNLVVSLHQPVMSSIEEIMFFLQNPVDHKLPLKLVNCIYD 336
           LKKQLFVES++LPLW   ++D+  V LHQP+MSS+EE+++FLQ+P   +LPL+L+N  Y+
Sbjct: 299 LKKQLFVESLLLPLWKRSYSDHGEVELHQPIMSSLEEMLYFLQSPTPTRLPLQLINVTYN 358

Query: 337 QIDMIVYDLMKPFMKRKMTFWEETILTPRKSLFHGAKFFKKFMNKSTQALS--QPNSLLK 394
            ++ +V DLM PFMKRK++FWEETIL PRKSLFHGA FFKK M+K++   +  QP SL K
Sbjct: 359 ILEKLVKDLMVPFMKRKISFWEETILQPRKSLFHGANFFKKLMSKNSNGSNNHQPISLGK 418

Query: 395 ENHGSNYLSSTSPEFLMRKLADWSMMVSDFKTAYTTYESLCQDFERMPKYLASCSEWCAV 454
           + +G+ Y  ++S EFLMRKLADWSMM+SDFKTAY+TYESL  D E  PKYLASC EWCAV
Sbjct: 419 DKNGNEYFVASSTEFLMRKLADWSMMLSDFKTAYSTYESLVHDLENFPKYLASCFEWCAV 478

Query: 455 SLLMGAQNIVTAKMLKNEINPAIERALGAYELCATESNAHRKFGDSDDLSAPVRSYETRC 514
           S+LMGAQNIVT KM+KN+I+P I+RAL  YE CA + ++       ++L  PVRSYETRC
Sbjct: 479 SVLMGAQNIVTVKMIKNDIDPLIQRALETYENCAADEDS-----TGEELYVPVRSYETRC 533

Query: 515 MFLASELFLSLSDTWTSTPFAIAYLETILNECKLGPLSEIMIWERLSDCYGMRIDPRIKH 574
           MFLASELFLSLSDTWTSTP+A+  LETIL EC+LGP SEIMIWERLSDCY  RIDPRI+H
Sbjct: 534 MFLASELFLSLSDTWTSTPYALNSLETILTECRLGPCSEIMIWERLSDCYYQRIDPRIRH 593

Query: 575 RIGNLELLQKKEENMDDPKNADVFTTEDILSKGLTRNRKAALFKLIAARKWCEQKQWREL 634
           +        +  + M D    D  + E+I+++GLTR RKAA F+LIAA KW EQKQW++ 
Sbjct: 594 KTS-----AQGAKAMTDELAPDEESNEEIVTRGLTRKRKAAFFRLIAANKWVEQKQWKQA 648

Query: 635 SWCLDDLESTYSDLKCFNKENLLYTRLRNELIAARQDM 672
            WCL ++E  Y+ L   N+E+L+  RL+ ++  A+ ++
Sbjct: 649 FWCLKEIEEAYAGLDFVNREDLILARLKRQMNEAQNNV 686

>NDAI0J01410 Chr10 complement(323873..326023) [2151 bp, 716 aa] {ON}
           Anc_8.255 YDR108W
          Length = 716

 Score =  797 bits (2058), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 397/695 (57%), Positives = 510/695 (73%), Gaps = 36/695 (5%)

Query: 1   MVFSYEHYMNLIYHLDDANETVPSDIAKRVVSNAMAPVITVTSTVLLDRHIEETYGIDSL 60
           MVFSYEHYMNL++HLD A E+VP +IAKR+VSNA+APVITVTST  LD HI+ETY IDSL
Sbjct: 1   MVFSYEHYMNLLFHLDHAKESVPPEIAKRIVSNAIAPVITVTSTPQLDNHIQETYNIDSL 60

Query: 61  YMLLRFFGGCVSDRDQANEVKLGTDGLKVTEEGVENEKDGTNGLTVP--------RQTRV 112
           YMLLR+FGGCVSDRDQANE+ +G   L VT     N  +  + L VP        +  R 
Sbjct: 61  YMLLRYFGGCVSDRDQANEL-VGKQELDVTHPT--NPSNPVSSLIVPSGQQQPPLKARRG 117

Query: 113 RSNSNSLYQRDATQSQYVRFTKPLADLINTQDANDMLFDYHSLEVYLQEYLSVVDKKFSP 172
           RS SNSL+QRD+TQSQY+RFTKP+ D++  + +NDMLFDYHSLE+YL++YL ++    + 
Sbjct: 118 RSRSNSLFQRDSTQSQYIRFTKPIDDIVAIKSSNDMLFDYHSLEIYLEQYLQLIATNTNN 177

Query: 173 HIPHHLLKTSIYHSFFALAISSTSKLSPFECFNHPIVSLLAIDITRNEDYETAAEQLKEF 232
             P+ LLK SIYH+FF+LAISST++LSP+E FNHPIVSL+A+DI+  + Y+   + L EF
Sbjct: 178 STPYELLKNSIYHNFFSLAISSTTQLSPYETFNHPIVSLIAVDISMGQTYDDIRDLLVEF 237

Query: 233 KSMNNNIPSFPSFINTNDILPVFLLCYNKDNETEFEECQTLAGKLKKQLFVESIILPLWS 292
           K++N   P+FP F+NTND+LP+FLLCY+ + + +FE CQ+L  +LKKQLFVES+ILPLW+
Sbjct: 238 KNLNTTTPNFPIFMNTNDMLPIFLLCYDANYQEQFEICQSLTKRLKKQLFVESLILPLWN 297

Query: 293 TEFTDNLVVSLHQPVMSSIEEIMFFLQNPVDHKLPLKLVNCIYDQIDMIVYDLMKPFMKR 352
            ++  ++ V LHQP+MSS+EE+++FLQ P   KL + L+N IY+ +D ++YDLM PFMKR
Sbjct: 298 EQYEIDIKVDLHQPIMSSLEEMIYFLQTPFSAKLSISLINSIYNILDSLIYDLMLPFMKR 357

Query: 353 KMTFWEETILTPRKSLFHGAKFFKKFMNKSTQALSQPNSLLKENHGSNYLSSTSPEFLMR 412
           K+ FWEETIL PR+SLFHGAKF KKFM K+     Q N L K++ G+ Y + +S E LMR
Sbjct: 358 KLLFWEETILQPRRSLFHGAKFLKKFMTKNNNG-PQENILTKDSEGNEYFAFSSTELLMR 416

Query: 413 KLADWSMMVSDFKTAYTTYESLCQDFERMPKYLASCSEWCAVSLLMGAQNIVTAKMLKNE 472
           KLADWSMM+SDFKTAY+TYESL +D +  PKYLASC EWCA SLLMGAQ+IVT KM+KN+
Sbjct: 417 KLADWSMMISDFKTAYSTYESLSRDLDTFPKYLASCLEWCATSLLMGAQSIVTVKMIKND 476

Query: 473 INPAIERALGAYELCA---TESNAHRKFGDSDDLSAPVRSYETRCMFLASELFLSLSDTW 529
           INP IERAL  YE CA    +   ++ F +      P+RSYETRCM L SELFLSLSDTW
Sbjct: 477 INPLIERALQTYENCAITLIQDTTNKVFAEQS--VEPLRSYETRCMILLSELFLSLSDTW 534

Query: 530 TSTPFAIAYLETILNECKLGPLSEIMIWERLSDCYGMRIDPRIKHRIGNLELLQKKEE-- 587
           TSTP+AI YLETIL ECKLGP S+I IWERLSDCY +RIDPRI+++I +           
Sbjct: 535 TSTPYAITYLETILTECKLGPCSQIQIWERLSDCYKLRIDPRIRYKINDTATTTTTVTTT 594

Query: 588 ---------NMDDPKN--------ADVFTTEDILSKGLTRNRKAALFKLIAARKWCEQKQ 630
                    + D PK         + + + ++ILSKG TR RK+A F+LIAA+KW EQKQ
Sbjct: 595 TADKVVATPSTDKPKTIQWESDLESKLGSGKNILSKGFTRRRKSAFFRLIAAKKWAEQKQ 654

Query: 631 WRELSWCLDDLESTYSDLKCFNKENLLYTRLRNEL 665
           WR+++WCL D+ES Y       +++L+  +LRN L
Sbjct: 655 WRQVAWCLKDMESIYDATDLGKRDDLIVAKLRNLL 689

>TDEL0F03820 Chr6 (699240..701303) [2064 bp, 687 aa] {ON} Anc_8.255
           YDR108W
          Length = 687

 Score =  777 bits (2006), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 378/666 (56%), Positives = 496/666 (74%), Gaps = 11/666 (1%)

Query: 3   FSYEHYMNLIYHLDDANETVPSDIAKRVVSNAMAPVITVTSTVLLDRHIEETYGIDSLYM 62
            SYE+YMNL+ HLD  ++ VP+DIAKR+VSNA++PVI VTST  LDRHI+ET+ +DSLYM
Sbjct: 4   LSYENYMNLLLHLDHGDDRVPADIAKRIVSNAISPVICVTSTPELDRHIQETHHLDSLYM 63

Query: 63  LLRFFGGCVSDRDQANEVKLGTDGLKVTEEGVENEKDGTNGLTVPRQTRVRSNSNSLYQR 122
           LLRFFG CV DRDQA+E    + G    ++  E  K  ++ L V      R  SNSL+QR
Sbjct: 64  LLRFFGDCVGDRDQAHECT--SAGSPSGDDRAE--KSSSSTLAVASGPS-RKRSNSLFQR 118

Query: 123 DATQSQYVRFTKPLADLINTQDANDMLFDYHSLEVYLQEYLSVVDKKFSPHIPHHLLKTS 182
           DATQSQY+RFT+PL DL+ + D NDMLFDYH+LE +L+  L +++K  +   PH LLK S
Sbjct: 119 DATQSQYIRFTRPLRDLVESADTNDMLFDYHTLESFLENILLLIEKSTNDKTPHKLLKKS 178

Query: 183 IYHSFFALAISSTSKLSPFECFNHPIVSLLAIDITRNEDYETAAEQLKEFKSMNNNIPSF 242
           +YH FF+LAISST+ LSP+E FNHP+VSL+A+DI   + YE A + L +FK++N+   +F
Sbjct: 179 LYHRFFSLAISSTAYLSPYETFNHPVVSLIALDIPIGQGYEEARDLLTKFKNLNHTTKNF 238

Query: 243 PSFINTNDILPVFLLCYNKDNETEFEECQTLAGKLKKQLFVESIILPLWSTEFTDNLVVS 302
           P F+NTND+LPVFLLCYN D+E ++E CQ+L  KLKKQLFVE I+LPLW   +     V 
Sbjct: 239 PVFLNTNDVLPVFLLCYNGDSEEQYEICQSLTKKLKKQLFVEGILLPLWKDNYKTATQVI 298

Query: 303 LHQPVMSSIEEIMFFLQNPVDHKLPLKLVNCIYDQIDMIVYDLMKPFMKRKMTFWEETIL 362
           LHQP+M+S++E+++FL+ P   +L L+L+N IYD +++++  LM PFM+RK++FWEETIL
Sbjct: 299 LHQPIMTSLDEVLYFLREPSRIELSLELINSIYDVLEILINGLMIPFMQRKISFWEETIL 358

Query: 363 TPRKSLFHGAKFFKKFMNKSTQA--LSQPNSLLKENHGSNYLSSTSPEFLMRKLADWSMM 420
            PR+SLFHG+KF K+FM+K+T    + Q  S+ K+ +G  Y  S+S EFLMRKLADWSMM
Sbjct: 359 QPRRSLFHGSKFLKRFMSKTTSGTNIHQQASIAKDANGKEYFVSSSAEFLMRKLADWSMM 418

Query: 421 VSDFKTAYTTYESLCQDFERMPKYLASCSEWCAVSLLMGAQNIVTAKMLKNEINPAIERA 480
           +SD+KTAY+TY+SL  D E  PKYLASC EWC+VS+LMGAQNIVTAKMLK +I+P I+RA
Sbjct: 419 LSDYKTAYSTYDSLSHDLEHYPKYLASCLEWCSVSVLMGAQNIVTAKMLKTDIDPLIQRA 478

Query: 481 LGAYELCATESNAHRKFGDSDDLSAPVRSYETRCMFLASELFLSLSDTWTSTPFAIAYLE 540
           +  YE CA           S+ + APVRSYETRCMFLASELFLSLSDTWTSTP+A+  LE
Sbjct: 479 VETYENCALYDTQLSGSKKSNSM-APVRSYETRCMFLASELFLSLSDTWTSTPYALRNLE 537

Query: 541 TILNECKLGPLSEIMIWERLSDCYGMRIDPRIKHRIGNLELL-QKKEENMDDPKNADVFT 599
           TIL EC+LGP S+IMIWERLS+CY  RID RI+H++ +  +  ++K EN DD +     T
Sbjct: 538 TILAECRLGPCSQIMIWERLSNCYQQRIDHRIRHKVNDGAMSNEEKVENEDDSEKE--HT 595

Query: 600 TEDILSKGLTRNRKAALFKLIAARKWCEQKQWRELSWCLDDLESTYSDLKCFNKENLLYT 659
             DI+++GLTR RKAA F+LIAA KW EQKQWR+ SWCL D E  Y+ ++  N+++L   
Sbjct: 596 HADIVTRGLTRMRKAAFFQLIAANKWAEQKQWRQASWCLKDTEDAYAGIEFVNRKDLALA 655

Query: 660 RLRNEL 665
           +L+  L
Sbjct: 656 KLKETL 661

>KAFR0B05570 Chr2 complement(1140432..1142441) [2010 bp, 669 aa]
           {ON} Anc_8.255 YDR108W
          Length = 669

 Score =  755 bits (1949), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 378/681 (55%), Positives = 507/681 (74%), Gaps = 29/681 (4%)

Query: 3   FSYEHYMNLIYHLDDANETVPSDIAKRVVSNAMAPVITVTSTVLLDRHIEETYGIDSLYM 62
           FSYEHYMNL++HL+ ++E +PS+IA+R+VS+A+APVITVTST  LD+HI++TY IDSLYM
Sbjct: 4   FSYEHYMNLLFHLECSDENIPSEIARRIVSHAIAPVITVTSTPELDKHIQDTYSIDSLYM 63

Query: 63  LLRFFGGCVSDRDQANEVKLGTDGLKVTEEGVENEKDGTNGLTVPRQTRVRSNSNSLYQR 122
           LLRFFGGCVSDRDQA+E K              N    ++ LT  + TR RS SNSL+QR
Sbjct: 64  LLRFFGGCVSDRDQASESK-------------ANAPHSSSSLTTTKTTRARSRSNSLFQR 110

Query: 123 DATQSQYVRFTKPLADLINTQDANDMLFDYHSLEVYLQEYLSVVDKKFSPHIPHHLLKTS 182
           D+TQSQY+RFT+PL DL+   D NDMLFD+HSLE YL++YL +V+K       H LLK S
Sbjct: 111 DSTQSQYIRFTRPLPDLVERHDKNDMLFDHHSLESYLRQYLELVEKFTFDSTSHQLLKKS 170

Query: 183 IYHSFFALAISSTSKLSPFECFNHPIVSLLAIDITRNEDYETAAEQLKEFKSMNNNIPSF 242
           +YH+FF+LAISST+ LSPFE FNHPI+SL+A+DIT ++ YE A   L +FK+++N I  F
Sbjct: 171 LYHNFFSLAISSTTTLSPFESFNHPIMSLIALDITNSQSYEDAKGLLIKFKNLHNTIDKF 230

Query: 243 PSFINTNDILPVFLLCYNKDNETEFEECQTLAGKLKKQLFVESIILPLWSTEFTDNLVVS 302
           P +INT D+LPVFLLCYN D+  E ++C+ L+ K+KKQLFVESI LPLW   +     + 
Sbjct: 231 PIYINTYDMLPVFLLCYNADSPEEVQQCEELSVKIKKQLFVESISLPLWKNSYQTEPFIK 290

Query: 303 LHQPVMSSIEEIMFFLQNPVDHKLPLKLVNCIYDQIDMIVYDLMKPFMKRKMTFWEETIL 362
           LHQPVMSS++E+++FLQ+   + LP++L N  YD ++ +VY L+ PFM+RK+ FWEET+L
Sbjct: 291 LHQPVMSSLDEMIYFLQSDEQNTLPIELTNTTYDMLEKLVYALLIPFMQRKIAFWEETVL 350

Query: 363 TPRKSLFHGAKFFKKFMNK-STQALSQPNSLLKENHGSNYLSSTSPEFLMRKLADWSMMV 421
            P+KS+FHG+KF KK M++ ST +  Q N L K++ G+ Y +S+SPE L+RKLADWS+M+
Sbjct: 351 QPKKSIFHGSKFLKKLMSRASTSSHQQQNILTKDHDGNEYFASSSPELLLRKLADWSIML 410

Query: 422 SDFKTAYTTYESLCQDFERMPKYLASCSEWCAVSLLMGAQNIVTAKMLKNEINPAIERAL 481
           SDFKT Y TYE L  D E  PKYLASC EW AVSLLMGAQNIVT KM+KN+I+P I+RAL
Sbjct: 411 SDFKTGYATYEILSHDLELFPKYLASCLEWEAVSLLMGAQNIVTVKMMKNDISPLIDRAL 470

Query: 482 GAYELCATESN-AHRKFGDSDDLSA--PVRSYETRCMFLASELFLSLSDTWTSTPFAIAY 538
            AY+ CA  ++ +++K G +++ ++  PV SYETRC+ L+SELFLSLSDTWTSTP+AI Y
Sbjct: 471 DAYDACAANTHLSNKKIGPTNESTSLEPVLSYETRCLILSSELFLSLSDTWTSTPYAINY 530

Query: 539 LETILNECKLGPLSEIMIWERLSDCYGMRIDPRIKHRIGNLELLQKKEENMDDPKN---- 594
           LE+IL E +LGP S IMIWERLSDCY +R+DPRIK ++  ++    K++N+++P +    
Sbjct: 531 LESILEESRLGPCSRIMIWERLSDCYDLRVDPRIKSKVEQVQ----KQDNLEEPADNEHR 586

Query: 595 ----ADVFTTEDILSKGLTRNRKAALFKLIAARKWCEQKQWRELSWCLDDLESTYSDLKC 650
                D     +I+S+GLTR RKAA F+L+AA+ W EQ QW+++ WCLD++   YS +  
Sbjct: 587 ILNSQDDLNPSNIVSQGLTRKRKAAFFRLLAAKMWAEQGQWKQVKWCLDNITDIYSRVGL 646

Query: 651 FNKENLLYTRLRNELIAARQD 671
            N+++L+ TRLR E   A  D
Sbjct: 647 VNRDDLILTRLREEYNIAVSD 667

>TPHA0B03260 Chr2 complement(749568..751712) [2145 bp, 714 aa] {ON}
           Anc_8.255 YDR108W
          Length = 714

 Score =  753 bits (1945), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 381/714 (53%), Positives = 495/714 (69%), Gaps = 53/714 (7%)

Query: 1   MVFSYEHYMNLIYHLDDANETVPSDIAKRVVSNAMAPVITVTSTVLLDRHIEETYGIDSL 60
           M F+YE+YMNLI+HLD  +E VP DI+KR+VSNA+APVITVT+TV LD HI E YGIDS 
Sbjct: 1   MTFTYENYMNLIFHLDKVHENVPQDISKRIVSNAIAPVITVTATVELDSHISEEYGIDSF 60

Query: 61  YMLLRFFGGCVSDRDQANE--------------------------VKLGTDGLKVTEE-- 92
           Y LLR+FGGC+SDRDQ+NE                          VKL  D  K+ EE  
Sbjct: 61  YTLLRYFGGCISDRDQSNEYIKKTEDEQKSHALNKVNLTTIEETKVKLNEDE-KMEEELQ 119

Query: 93  GVENEKDGTNGLTV------------------PRQTRVRSNSNSLYQRDATQSQYVRFTK 134
             +N  + TN  TV                   + TR RS SNSL+QRD+TQSQ++RFT+
Sbjct: 120 SDQNVINPTNDPTVNNNYLDVDTKTDNLLPKSSQTTRNRSRSNSLFQRDSTQSQFIRFTR 179

Query: 135 PLADLINTQDANDMLFDYHSLEVYLQEYLSVVDKKFSPHIPHHLLKTSIYHSFFALAISS 194
           P+ DL+ +    DMLFDYH+LE++L   L +V+K  +  I H  L+ S+YH FF+ AISS
Sbjct: 180 PIEDLLYSGGTGDMLFDYHTLEIFLGSCLKMVEKYTTDDIDHKTLQKSLYHRFFSSAISS 239

Query: 195 TSKLSPFECFNHPIVSLLAIDITRNEDYETAAEQLKEFKSMNNNIPSFPSFINTNDILPV 254
           T+ LSP+E FNHPIVSL+AIDIT+ ++YE A + L  FK+ N  I +FP F++TNDILPV
Sbjct: 240 TNCLSPYESFNHPIVSLIAIDITKGQNYELARDLLIAFKNQNTTINNFPIFMSTNDILPV 299

Query: 255 FLLCYNKDNETEFEECQTLAGKLKKQLFVESIILPLWSTEFTDNLVVSLHQPVMSSIEEI 314
           F+LCYN  +  E E+   L+ K+KKQLF E I +PLW   ++D++ V LHQP MSS++E+
Sbjct: 300 FVLCYNGSSAEESEKSTELSKKIKKQLFAECIRMPLWDKRYSDDITVKLHQPAMSSLDEM 359

Query: 315 MFFLQNPVDHKLPLKLVNCIYDQIDMIVYDLMKPFMKRKMTFWEETILTPRKSLFHGAKF 374
           ++  Q     KLPL L+N IYDQ++++  DLM PFM+RK+TFWEETIL P+KSLF G K 
Sbjct: 360 LYVFQTSKTDKLPLTLINLIYDQLEILTNDLMIPFMQRKITFWEETILQPKKSLFQGTKL 419

Query: 375 FKKFMNK-STQALSQPNSLLKENHGSNYLSSTSPEFLMRKLADWSMMVSDFKTAYTTYES 433
           F+KFM + S     Q N  +K+N G+ Y +STS  FL+RKLADWSMM+SDFKTAYTT+ES
Sbjct: 420 FRKFMGRPSMTNGRQENIPIKDNQGNEYFASTSNVFLLRKLADWSMMISDFKTAYTTFES 479

Query: 434 LCQDFERMPKYLASCSEWCAVSLLMGAQNIVTAKMLKNEINPAIERALGAYELCATESNA 493
           L +D E  PKYLASC EWCAV +LMGAQNIVT KM+KN++NP IER+L  Y  CA   N+
Sbjct: 480 LLEDIEMYPKYLASCLEWCAVCILMGAQNIVTTKMIKNDVNPLIERSLDVYGNCALLLNS 539

Query: 494 HRKFGDSDDLSAPVRSYETRCMFLASELFLSLSDTWTSTPFAIAYLETILNECKLGPLSE 553
             +  +S D + PVRSYETRCM + SELFLSLSDTWTSTP+A++ LETIL+ECKLG  S+
Sbjct: 540 IAESEESPD-TEPVRSYETRCMLITSELFLSLSDTWTSTPYALSNLETILSECKLGACSQ 598

Query: 554 IMIWERLSDCYGMRIDPRIKHRI-GNLELLQKKEENMDDPKNADVFTTEDILSKGLTRNR 612
           IMIWERLSDCY +R DPR+KH++  N+      E + ++ K  DV     I+ KGLTR R
Sbjct: 599 IMIWERLSDCYNLRTDPRVKHKLRSNISTSSVSEVSEEEIKKQDV---SSIVLKGLTRQR 655

Query: 613 KAALFKLIAARKWCEQKQWRELSWCLDDLESTYSDLKCFNKENLLYTRLRNELI 666
           KA+ F+L+AA+KW EQ QWR++SWCL+D+   Y D     +E+L+Y +L+  L+
Sbjct: 656 KASFFRLLAAKKWAEQHQWRQVSWCLNDISEMYQDTVFGKRESLIYQKLKRNLL 709

>Kwal_56.23583 s56 (607721..609823) [2103 bp, 700 aa] {ON} YDR108W
           (GSG1) - involved in meiosis [contig 176] FULL
          Length = 700

 Score =  728 bits (1880), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 368/715 (51%), Positives = 483/715 (67%), Gaps = 72/715 (10%)

Query: 1   MVFSYEHYMNLIYHLDDANETVPSDIAKRVVSNAMAPVITVTSTVLLDRHIEETYGIDSL 60
           M  SYE YMNL+ HLD A+E VPS+I++++VSNA++PV+TVTS+  LD+HI+E+YG+DSL
Sbjct: 1   MPLSYERYMNLVSHLDSASEPVPSEISRKIVSNAVSPVVTVTSSAALDKHIQESYGLDSL 60

Query: 61  YMLLRFFGGCVSDRDQANEVKLGTDGLKVTEEGVENEKDGTNGLTVPRQTRVRSNSNSLY 120
           YMLLR+FG C+SDRDQA+  +         E GVE           P ++R RS S SL+
Sbjct: 61  YMLLRYFGDCISDRDQADSEQ---------ESGVE-----------PNKSRARSRSGSLF 100

Query: 121 QRDATQSQYVRFTKPLADLINTQDANDMLFDYHSLEVYLQEYLSVVDKKFSPHIPHHLLK 180
           QR A  SQ++RFT+PL+D+I T++  D+LFDYHSLEV+LQ+YL +VD K SP  PH LL+
Sbjct: 101 QRQA--SQFLRFTRPLSDIIGTRETRDLLFDYHSLEVFLQKYLELVDVKTSPDTPHTLLQ 158

Query: 181 TSIYHSFFALAISSTSKLSPFECFNHPIVSLLAIDITRNEDYETAAEQLKEFKSMNNNIP 240
            SIYH FF  AISST+ LSP+ECFNHP+ SLLA+DI++NE YE A + L  FK+M+N  P
Sbjct: 159 HSIYHKFFTTAISSTAHLSPYECFNHPVCSLLALDISQNEGYEDARDLLVTFKNMHNKTP 218

Query: 241 SFPSFINTNDILPVFLLCYNKDNETEFEECQTLAGKLKKQLFVESIILPLWSTEFT--DN 298
            FPSFIN NDILPVFLLCY + +  +FE CQ+LA  +KKQLFVES++LP WS  FT  D 
Sbjct: 219 HFPSFINVNDILPVFLLCYEEGSREQFETCQSLAKMMKKQLFVESLLLPCWSVNFTAKDT 278

Query: 299 LVVSLHQPVMSSIEEIMFFLQNPVDHKLPLKLVNCIYDQIDMIVYDLMKPFMKRKMTFWE 358
               LHQP+MSS+EE MF +       LPL  +  IYD++  +V +LM PFMKRK++FWE
Sbjct: 279 PTRVLHQPIMSSLEETMFSMLKDSAFDLPLPFIEHIYDRLTKLVDELMIPFMKRKISFWE 338

Query: 359 ETILTPRKSLFHGAKFFKKFMNKSTQALSQPNSLLKENHGSNYLSSTSPEFLMRKLADWS 418
           E+IL PR+S+F  +KFF+K ++K+    +  +S      G  Y ++TS E L+RKLADWS
Sbjct: 339 ESILQPRRSIFPNSKFFRKLISKAPTPSTNNDSATHSEQGLAYFAATSNELLLRKLADWS 398

Query: 419 MMVSDFKTAYTTYESLCQDFERMPKYLASCSEWCAVSLLMGAQNIVTAKMLKNEINPAIE 478
            M+SDFKTAY+TYE L +DFE+ P+YLA C EWCA+S+LMGAQ+IVT KM+KN+I+P I 
Sbjct: 399 FMLSDFKTAYSTYELLSKDFEQHPEYLAPCLEWCALSVLMGAQSIVTVKMIKNDIDPLIT 458

Query: 479 RALGAYELCATE---------------------------SNAH--RKFGDSD-----DLS 504
           RAL +YELCA++                           SN+H  R  G +D       S
Sbjct: 459 RALKSYELCASKAKERNGLLKSKLQNRDHDKSLNGFETISNSHDDRVSGTTDFEISSTPS 518

Query: 505 APVRSYETRCMFLASELFLSLSDTWTSTPFAIAYLETILNECKLGPLSEIMIWERLSDCY 564
              +SYETRCM LA+ELFLSLSDTWT+TP+AI YLETIL++C +G LSEI+IWERL+ CY
Sbjct: 519 QSAQSYETRCMLLAAELFLSLSDTWTATPYAIKYLETILDQCTVGALSEIVIWERLAYCY 578

Query: 565 GMRIDPRIKHRIGNLELLQKKE-ENMDDPKNADVFTTED-------------ILSKGLTR 610
            +R+DPR+K R+   E+    + E +D+        + D             I S GLTR
Sbjct: 579 ALRVDPRVKSRLTASEIQSSDQNEKLDEESEGSDNDSGDESQVCQHKMSQSCIASSGLTR 638

Query: 611 NRKAALFKLIAARKWCEQKQWRELSWCLDDLESTYSDLKCFNKENLLYTRLRNEL 665
            RKA LF+LIA +KW E KQWR+  W   DLE  YS L   N+E+L+  +L   +
Sbjct: 639 KRKATLFRLIATKKWTESKQWRQACWSFQDLEVMYSHLVFANREDLILKKLEKRI 693

>KLTH0G13860g Chr7 complement(1201656..1203782) [2127 bp, 708 aa]
           {ON} similar to uniprot|P46944 Saccharomyces cerevisiae
           YDR108W GSG1 Subunit of TRAPP (transport protein
           particle) a multi-subunit complex involved in targeting
           and/or fusion of ER-to-Golgi transport vesicles with
           their acceptor compartment protein has late meiotic role
           following DNA replication
          Length = 708

 Score =  691 bits (1782), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 351/714 (49%), Positives = 481/714 (67%), Gaps = 72/714 (10%)

Query: 1   MVFSYEHYMNLIYHLDDANETVPSDIAKRVVSNAMAPVITVTSTVLLDRHIEETYGIDSL 60
           M  S+  YMNL +HLD A E VP++I++++VS+A++PV+TVTST  LD HI+E+YG+DSL
Sbjct: 1   MPLSFGKYMNLAFHLDSALEPVPTEISRKIVSSAVSPVVTVTSTAALDEHIQESYGVDSL 60

Query: 61  YMLLRFFGGCVSDRDQANE-VKLGTDGLKVTEEGVENEKDGTNGLTVPRQTRVRSNSNSL 119
           YMLLR+FG CVSDRDQA    +LGT+              G N        R R+ SNSL
Sbjct: 61  YMLLRYFGDCVSDRDQAEAGPELGTES-------------GKN--------RNRARSNSL 99

Query: 120 YQRDATQSQYVRFTKPLADLINTQDANDMLFDYHSLEVYLQEYLSVVDKKFSPHIPHHLL 179
           +QR A  S Y+RFT+PL DLI+ +++ D+LFDYHSLEV+L++YLS+V+   +   PH LL
Sbjct: 100 FQRQA--SHYLRFTRPLTDLIDVRESRDLLFDYHSLEVFLEKYLSLVEANTTSDTPHTLL 157

Query: 180 KTSIYHSFFALAISSTSKLSPFECFNHPIVSLLAIDITRNEDYETAAEQLKEFKSMNNNI 239
           + SIYH FF  AISST+ LSP+E FNHP+ SLLA+DI++++ YE A + L  FK+M+N  
Sbjct: 158 QHSIYHKFFTTAISSTAHLSPYESFNHPVASLLALDISKDQGYEEARDLLIAFKNMHNTT 217

Query: 240 PSFPSFINTNDILPVFLLCYNKDNETEFEECQTLAGKLKKQLFVESIILPLWSTEFTDNL 299
           P FP+FIN NDILPVFLLCY +D+  +FE CQ+L+  +KKQLFVES++LP W        
Sbjct: 218 PHFPAFINVNDILPVFLLCYEEDSREQFELCQSLSKTIKKQLFVESLLLPCWGQNINAGA 277

Query: 300 VVS--LHQPVMSSIEEIMFFLQNPVDHKLPLKLVNCIYDQIDMIVYDLMKPFMKRKMTFW 357
             S  LHQP+MSS+EE M+ +       LPL L+N IYD++  ++ +LM PFMKRK++FW
Sbjct: 278 SPSRILHQPIMSSLEETMYSMMKESTITLPLSLINYIYDRLTNLIDELMIPFMKRKISFW 337

Query: 358 EETILTPRKSLFHGAKFFKKFMNKSTQALSQPNSLLKENHGSNYLSSTSPEFLMRKLADW 417
           +E+IL PRKS+F  +KFF+K ++K+       +S      G  Y ++TS EF++RKLADW
Sbjct: 338 DESILQPRKSIFPNSKFFRKLISKTPAPPPASDSATHSQQGVAYFAATSNEFILRKLADW 397

Query: 418 SMMVSDFKTAYTTYESLCQDFERMPKYLASCSEWCAVSLLMGAQNIVTAKMLKNEINPAI 477
           S M+SDFK AY+TYE L +DFE+ P+YLASC EWCA+S+LMGAQ+IVT KM+KN+I+P I
Sbjct: 398 SFMLSDFKNAYSTYELLSKDFEQRPEYLASCLEWCALSVLMGAQSIVTVKMIKNDIDPLI 457

Query: 478 ERALGAYELCAT---------ESNAHRKFGDSDDLSAPVRS------------------- 509
            RAL +YEL A          +S+A  K  + D  SA + S                   
Sbjct: 458 NRALKSYELSARKAKEKNAQLKSSALAKKAEKDSKSATLPSTVSDEHSGQELDEGVSSAP 517

Query: 510 ------YETRCMFLASELFLSLSDTWTSTPFAIAYLETILNECKLGPLSEIMIWERLSDC 563
                 YETRCM LA+ELFLSLSDTWT+TP+AI YLETIL+EC LG LSEI++WERL+ C
Sbjct: 518 SQSAQSYETRCMLLAAELFLSLSDTWTATPYAIKYLETILDECTLGSLSEIVLWERLAYC 577

Query: 564 YGMRIDPRIKHRIGNL-----------ELLQKKEENMDDPKNADVFTTEDIL-SKGLTRN 611
           Y +R+DPR+K ++ +L           E  +  +E+ D+ +  D   +++ + S GL R 
Sbjct: 578 YALRVDPRVKGKLPSLDGQSGQNEKRGEESEGSDESDDETQKYDHKISQNCMASLGLARR 637

Query: 612 RKAALFKLIAARKWCEQKQWRELSWCLDDLESTYSDLKCFNKENLLYTRLRNEL 665
           RK+ LF+LIA +KW E KQWR+  W L D+E  YS+L   N+++L+  +LR ++
Sbjct: 638 RKSTLFRLIATKKWTESKQWRQAYWGLKDIEVVYSELDFANRDDLILEKLRKKI 691

>SAKL0H17226g Chr8 complement(1526848..1529007) [2160 bp, 719 aa]
           {ON} similar to uniprot|P46944 Saccharomyces cerevisiae
           YDR108W GSG1 Subunit of TRAPP (transport protein
           particle) a multi-subunit complex involved in targeting
           and/or fusion of ER-to-Golgi transport vesicles with
           their acceptor compartment protein has late meiotic role
           following DNA replication
          Length = 719

 Score =  668 bits (1723), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 354/743 (47%), Positives = 479/743 (64%), Gaps = 104/743 (13%)

Query: 1   MVFSYEHYMNLIYHLDDANE--TVPSDIAKRVVSNAMAPVITVTSTVLLDRHIEETYGID 58
           M  SYE+YMNL+YH+D + E  TV S++AK++VSNA++PV+ VTST LLD H++E YG+ 
Sbjct: 1   MTLSYENYMNLLYHIDHSGESVTVNSEVAKKIVSNAVSPVVAVTSTSLLDSHLQEAYGLH 60

Query: 59  SLYMLLRFFGGCVSDRDQANEVKLGTDGLKVTEEGVENEKDGTNGLTVPRQTRVRSNSNS 118
           S+YMLLRFFG CV+DRDQ NE +    G                          R  SNS
Sbjct: 61  SMYMLLRFFGDCVTDRDQENETETNFKG--------------------------RPRSNS 94

Query: 119 LYQRDATQSQYVRFTKPLADLINTQDAN-DMLFDYHSLEVYLQEYLSVVDKKFSPHIPHH 177
           L+QR++  S +VRFT+PL DL++ + ++  MLFDYHSLE++L +YL +VD + S + PH 
Sbjct: 95  LFQRES--STFVRFTRPLIDLVDVRVSDHGMLFDYHSLELFLDKYLRLVDHRVSANTPHR 152

Query: 178 LLKTSIYHSFFALAISSTSKLSPFECFNHPIVSLLAIDITRNEDYETAAEQLKEFKSMNN 237
           LLK SIYH FF  AISST+ LSP+E FNHP++SLLA+DI+R + YE A + L  FK+MN+
Sbjct: 153 LLKHSIYHKFFTAAISSTAYLSPYESFNHPVMSLLALDISRGDTYENARDLLIRFKNMNS 212

Query: 238 ---NIPSFPSFINTNDILPVFLLCYNKDNETEFEECQTLAGKLKKQLFVESIILPLW--S 292
              +  SFP+FIN NDILPVFLLCYN  +  +FE CQ+LA  LKKQLFVESI+LPLW  S
Sbjct: 213 ATKSAASFPTFININDILPVFLLCYNDSSHEQFEACQSLAKMLKKQLFVESILLPLWRDS 272

Query: 293 TEF-TDNLVVSLHQPVMSSIEEIMFFL---------------QNPVDH-KLPLKLVNCIY 335
            ++  +     LH P+MSS+EE+++FL                NP+   +LPL LV  IY
Sbjct: 273 EDYDAEEPRRILHPPIMSSLEEMLYFLDLEAPGKDNISYTGSSNPISSFELPLALVETIY 332

Query: 336 DQIDMIVYDLMKPFMKRKMTFWEETILTPRKSLFHGAKFFKKFMNKSTQALSQPNSLLKE 395
           D++++++ +LM PFMKRK++FWEETIL PRKS+F  AKF ++F++KS  A        K 
Sbjct: 333 DRLNLLITELMIPFMKRKISFWEETILQPRKSIFLNAKFLRRFVSKSAPATPAAPINSKS 392

Query: 396 NHG---SNYLSSTSPEFLMRKLADWSMMVSDFKTAYTTYESLCQDFERMPKYLASCSEWC 452
           +     SN+  ++S EFL+RKLADWS M+SD++TAY TY++L +D E   +YLA C EWC
Sbjct: 393 DGAVQRSNFFPASSNEFLLRKLADWSFMLSDYRTAYATYDTLSKDLEHHLEYLAPCLEWC 452

Query: 453 AVSLLMGAQNIVTAKMLKNEINPAIERALGAYELCATE-SNAHRKFGDSDDLSAPVRSYE 511
           AVS+LMGAQ+IVT KM+KN+I+P I ++L  YE CA++ ++ H    DS   S P +SYE
Sbjct: 453 AVSVLMGAQSIVTVKMIKNDIDPLISKSLQCYEKCASKLTSPHVAEADSPVDSKPAQSYE 512

Query: 512 TRCMFLASELFLSLSDTWTSTPFAIAYLETILNECKLGPLSEIMIWERLSDCYGMRIDPR 571
           TRCM L++ELFLSLSDTWT+TP+AI YLETIL  C LGP S++++WE+L+ CY +R+DPR
Sbjct: 513 TRCMLLSAELFLSLSDTWTATPYAIKYLETILQNCPLGPKSQVLLWEKLAYCYELRVDPR 572

Query: 572 IKH-------------------------------------RIGNL----------ELLQK 584
           + H                                     + GN           E L  
Sbjct: 573 VSHIHAKQRHLQYEREEVISKSNERAPQHHSESHFSTEKNQTGNQEEQSDTDSKDEALSN 632

Query: 585 KEENMDDPKNADVFTTEDILSKGLTRNRKAALFKLIAARKWCEQKQWRELSWCLDDLEST 644
           +E+   D  N +    +DI   GLTR RKAA F+LIAA KWCEQKQW++ SW L D+++ 
Sbjct: 633 REKEHADFVNPNKLPYKDIALLGLTRRRKAAFFRLIAANKWCEQKQWKQASWLLRDVDTV 692

Query: 645 YSDLKCFNKENLLYTRLRNELIA 667
           YS L    ++ L+  RL  E+ A
Sbjct: 693 YSGLVFSYRKGLILERLVGEIEA 715

>KNAG0H03270 Chr8 complement(609643..611589) [1947 bp, 648 aa] {ON}
           Anc_8.255 YDR108W
          Length = 648

 Score =  620 bits (1600), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 327/702 (46%), Positives = 440/702 (62%), Gaps = 96/702 (13%)

Query: 1   MVFSYEHYMNLIYHLDDANETVPSDIAKRVVSNAMAPVITVTSTVLLDRHIEETYGIDSL 60
           M FSYEHYMNL+ HL+ A+ETVP DIA+R+VS+A+APVITVTS++ LD HI E+Y + S 
Sbjct: 1   MAFSYEHYMNLLSHLECASETVPPDIARRIVSHAVAPVITVTSSLALDDHIMESYKVQSA 60

Query: 61  YMLLRFFGGCVSDRDQANEVKLGTDGLKVTEEGVENEKDGTNGLTVPRQTRVRSNSNSLY 120
           Y+L R FGGC+SDRDQ  E     D               T G       R R  SNSL+
Sbjct: 61  YLLFRLFGGCISDRDQLMEHYTLDDS-------------STGG-------RTRKRSNSLF 100

Query: 121 QRDATQSQYVRFTKPLADLINTQDANDMLFDYHSLEVYLQEYLSVVDK------------ 168
           QRDATQSQ++RF +PL DL+ +      LFD  SLE YL  YLS + K            
Sbjct: 101 QRDATQSQFIRFAQPLPDLLRSYTEQQGLFDNDSLEWYLTHYLSWIQKLTATDPEKVEQL 160

Query: 169 --KFSPH--------IPHHLLKTSIYHSFFALAISSTSKLSPFECFNHPIVSLLAIDITR 218
             + +P         +PH LL+ ++YH+FFALA+SST+++SPFE FN P+++L+AID++R
Sbjct: 161 PDELTPSSPPQRGKPLPHKLLRNAVYHNFFALAVSSTTRISPFETFNVPVMNLIAIDVSR 220

Query: 219 NEDYETAAEQLKEFKSMNNNIPSFPSFINTNDILPVFLLCYNKDNETEFEECQTLAGKLK 278
            +DYE   + +  FK++N  +  FP FIN NDILP+ +LCY+  +ET+   C+ L  K+K
Sbjct: 221 GQDYEVVRDLVTTFKNLNKFLEDFPVFINVNDILPMIVLCYDAADETQLATCEQLQRKIK 280

Query: 279 KQLFVESIILPLWSTEFTDNLVVSLHQPVMSSIEEIMFFLQNPVD-------------HK 325
           K LFV+SI L LW  E  ++ +V LH+P+MSS++EI+ F  +                  
Sbjct: 281 KCLFVDSIPLALWD-EDPESPLVPLHEPIMSSLDEIVKFYSSNSSAGGDEVGTDGHSRAA 339

Query: 326 LPLKLVNCIYDQIDMIVYDLMKPFMKRKMTFWEETILTPRKSLFHGA-KFFKKFMNKSTQ 384
           LPL ++  +Y  +D++V +++ PFM RK  +WEE IL PRKS+FHG+  FFKKF+ K+T 
Sbjct: 340 LPLNIITHMYQALDVLVDEMLIPFMHRKTKYWEENILQPRKSIFHGSNNFFKKFIGKTTT 399

Query: 385 ALSQPNSLLKENHGSNYLSSTSPEFLMRKLADWSMMVSDFKTAYTTYESLCQDFERMPKY 444
                    ++   + +  ++S E L+RKLADWS+M+SDFKTAY TY+SL  D +  P Y
Sbjct: 400 Q--------RDPSDTQFFPASSTECLLRKLADWSLMLSDFKTAYLTYDSLSNDLQNSPNY 451

Query: 445 LASCSEWCAVSLLMGAQNIVTAKMLKNEINPAIERALGAYELCATESNAHRKFGDSDDLS 504
           LASC EWCAVSLL+GAQNIVT KM+K EI P IERA+  Y          R+ G S    
Sbjct: 452 LASCLEWCAVSLLLGAQNIVTVKMIKTEITPLIERAVATY----------RQQGRS---- 497

Query: 505 APVRSYETRCMFLASELFLSLSDTWTSTPFAIAYLETILNEC-KLGPLSEIMIWERLSDC 563
               SYETRCM L++ELFL+L DTWTSTP+AI YLETIL +C +LG  S++MIWERLSDC
Sbjct: 498 ----SYETRCMILSAELFLALRDTWTSTPYAIRYLETILRDCPQLGACSQVMIWERLSDC 553

Query: 564 YGMRIDPRIKHRIGNLELLQKKEENMDDPKNADVFTTEDILSKGLTRNRKAALFKLIAAR 623
           Y  R DPR+   +               P N       +IL++G TR RKAA F+LIAA+
Sbjct: 554 YQSRTDPRVASALST-----NTSPGSAQPGN-------EILAQGFTRKRKAAFFRLIAAK 601

Query: 624 KWCEQKQWRELSWCLDDLESTYSDLKCFNKENLLYTRLRNEL 665
           KW EQ QWR++ WCL D++  Y+    ++K+ LL  RL  E+
Sbjct: 602 KWAEQGQWRQVQWCLHDIKDIYTASALYDKKGLLIDRLNTEV 643

>TBLA0E04380 Chr5 (1112393..1115062) [2670 bp, 889 aa] {ON}
           Anc_8.255 YDR108W
          Length = 889

 Score =  552 bits (1422), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/633 (47%), Positives = 418/633 (66%), Gaps = 79/633 (12%)

Query: 111 RVRSNSNSLYQRDATQSQYVRFTKPLADLINTQDANDMLFDYHSLEVYLQEYLSVVDKKF 170
           + R  SNSL+QRD+TQSQY+RFTKP+ DL+NT+D  D LFD+ SLE  L+ YL +++   
Sbjct: 183 KTRKRSNSLFQRDSTQSQYIRFTKPIPDLVNTRDPTDSLFDHQSLETLLKGYLKIIETNT 242

Query: 171 SPHIPHHLLKTSIYHSFFALAISSTSKLSPFECFNHPIVSLLAIDITRNEDYETAAEQLK 230
           +P +PH+ LK S+YH FF++ ++ST+ L PFE F+HPIVSLL+ID+T N++Y+TA E L 
Sbjct: 243 TPDMPHNALKKSLYHRFFSMTVTSTTNLCPFESFDHPIVSLLSIDLTLNQNYDTAKEMLI 302

Query: 231 EFKSMNNNIPSFPSFINTNDILPVFLLCYNKDNETEFEECQTLAGKLKKQLFVESIILPL 290
           +FK++++  P+FP ++N NDILPVFLLCY+  +  + +  + ++ K+KKQLF ESI+LPL
Sbjct: 303 KFKNIHSKTPNFPVYLNINDILPVFLLCYDASSPEQLDIAKKISTKIKKQLFFESILLPL 362

Query: 291 WSTE-FTDNLVVSLHQPVMSSIEEIMFFLQN-------PVDHKLPLKLVNCIYDQIDMIV 342
           W+ + + ++  V LH+P+MSS++E ++FLQ          D+KLPL LV  IY+ I  + 
Sbjct: 363 WNDKIYNNDKFVKLHEPMMSSVDETLYFLQQYLQKNSCVTDNKLPLSLVKYIYEMIANLS 422

Query: 343 YDLMKPFMKRKMTFWEETILTPRKSLFHGAKFFKKFMNKS---------------TQALS 387
            +L+ PFM+RK+ FW+ETIL PRKS+F   K FK FMN++                    
Sbjct: 423 VNLIIPFMQRKIRFWDETILQPRKSIFRN-KLFKSFMNRNSNVSSSTGTSSSEISNSISK 481

Query: 388 QPNSLL-KENHGSNYLSSTSPEFLMRKLADWSMMVSDFKTAYTTYESLCQDFERMPKYLA 446
             +SLL K+++G  Y S+ S EF +RKLADWSMMVSDFKTAYTTYESL +D E   KY+A
Sbjct: 482 HHHSLLTKDSNGHEYFSALSTEFQLRKLADWSMMVSDFKTAYTTYESLSRDLENTSKYMA 541

Query: 447 SCSEWCAVSLLMGAQNIVTAKMLKNEINPAIERALGAYE----------LCATESNAHRK 496
           SC EW AVS+LMGAQNIVTAKMLKN+++P IE AL +YE          L +   N+   
Sbjct: 542 SCLEWWAVSILMGAQNIVTAKMLKNDVDPLIESALESYEKPLPPVPNSRLPSNNINSLNS 601

Query: 497 FGDSDDLSAP----------VRSYETRCMFLASELFLSLSDTWTSTPFAIAYLETILNEC 546
                  +            +RSYE RCM L SELFLSLSDTWTSTP+A+ YLETIL++ 
Sbjct: 602 RSSISSATKAEVSLIENNHTIRSYEIRCMLLLSELFLSLSDTWTSTPYALRYLETILSDY 661

Query: 547 KLGPLSEIMIWERLSDCYGMRIDPRIKHR--IGNL-----------------ELLQ---- 583
           KLGP S+ ++WERLS CY +R+DPRIK +  I N+                 E+ +    
Sbjct: 662 KLGPCSQTILWERLSFCYDLRVDPRIKRKPTITNINKGTKATGSEASHSSIKEVNEKYRN 721

Query: 584 --KKEENMDDPKNA---DVFTTE------DILSKGLTRNRKAALFKLIAARKWCEQKQWR 632
             K+E+   D KN+   DV + E      DILS G TR RKAA FKLIAA+KW EQKQWR
Sbjct: 722 DGKQEKYSIDRKNSLIIDVNSNEEYDCGYDILSDGFTRKRKAAFFKLIAAKKWSEQKQWR 781

Query: 633 ELSWCLDDLESTYSDLKCFNKENLLYTRLRNEL 665
           +L WCL D+E+ Y ++   ++++L+  +L+++L
Sbjct: 782 QLDWCLKDIENVYKEVGFSDRKDLILIKLKDQL 814

 Score =  124 bits (310), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 51/79 (64%), Positives = 70/79 (88%)

Query: 1  MVFSYEHYMNLIYHLDDANETVPSDIAKRVVSNAMAPVITVTSTVLLDRHIEETYGIDSL 60
          M FSYE+YMNL++HLD  NE +P+DIAKR+V N++AP+I+VT+T  LD+H++++Y IDSL
Sbjct: 1  MPFSYENYMNLLFHLDRTNEEIPTDIAKRIVQNSIAPLISVTATPELDKHVQDSYNIDSL 60

Query: 61 YMLLRFFGGCVSDRDQANE 79
          YMLLR+FGGC+SDRDQ +E
Sbjct: 61 YMLLRYFGGCISDRDQYHE 79

>Ecym_4316 Chr4 complement(683492..685363) [1872 bp, 623 aa] {ON}
           similar to Ashbya gossypii AGR096C
          Length = 623

 Score =  499 bits (1286), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 280/669 (41%), Positives = 421/669 (62%), Gaps = 59/669 (8%)

Query: 2   VFSYEHYMNLIYHLDDANETVPSDIAKRVVSNAMAPVITVTSTVLLDRHIEETYGIDSLY 61
           + SYE YMNL+++ D  ++ VP +I+++V+ NA++P I+V ST  L++H+EE + I SLY
Sbjct: 1   MLSYEKYMNLLHYPDQWSQPVPREISRKVICNALSPCISVQSTDALNQHLEEVFKIGSLY 60

Query: 62  MLLRFFGGCVSDRDQANEVKLGTDGLKVTEEGVENEKDGTNGLTVPRQTRVRSNSNSLYQ 121
            LLR+FG  + DRDQ ++        K++ +   N +              R   NSL+Q
Sbjct: 61  KLLRYFGDYIQDRDQLDD--------KISAKLQPNNR--------------RQRQNSLFQ 98

Query: 122 RDATQSQYVRFTKPLADLINTQDANDMLFDYHSLEVYLQEYLSVVDKKFSPHIPHHLLKT 181
           R++  S+Y+RF  PL D+I+  D + +  +++ LE  L E+L  +++      P  LLK 
Sbjct: 99  RNS--SRYIRFQTPLTDIISVGDNHQV--EFNDLEESLSEFLKDIEEHTVNDSPCELLKH 154

Query: 182 SIYHSFFALAISSTSKLSPFECFNHPIVSLLAIDITRNEDYETAAEQLKEFKSMNNNIPS 241
           SI+H F  +  S+T  LSP+  FNHPI++LLA+DIT+ E+YE A E L EFK++ N +  
Sbjct: 155 SIFHKFITMLSSTT--LSPYHSFNHPILALLALDITQGEEYELARELLMEFKNLPNTLSK 212

Query: 242 FPSFINTNDILPVFLLCYNKDNETEFEECQTLAGKLKKQLFVESIILPLWSTEFTDNLVV 301
           FP+FINTND+LPVF+LC+++ +  ++E  Q+L   +KKQLFVES+ LP++ T F D  +V
Sbjct: 213 FPAFINTNDVLPVFILCFDQSSPQQWETVQSLMKVIKKQLFVESVPLPIF-TNFRDRSIV 271

Query: 302 SLHQPVMSSIEEIMFFLQNPVDHKLPLKLVNCIYDQIDMIVYDLMKPFMKRKMTFWEETI 361
            LH P+ +S++E ++   +PV  KL  +LV  IYD I+ +V DLM PFM RK++FW+ETI
Sbjct: 272 -LHPPITNSLQEQLYDSSHPVSLKLCPRLVKLIYDTINSMVEDLMIPFMNRKISFWDETI 330

Query: 362 LTPRKSLFHGAKFFKKFMNKSTQALSQPNSLLKENHGSNYLSSTSPEFLMRKLADWSMMV 421
           L PRKS+FH  K  K+F++KS+ +   P + +  +   ++L+S++ EFL+RKLADW  M+
Sbjct: 331 LQPRKSIFHSNKLLKRFISKSSGS---PTASMPTSPDGHFLASSN-EFLLRKLADWCFML 386

Query: 422 SDFKTAYTTYESLCQDFERMPKYLASCSEWCAVSLLMGAQNIVTAKMLKNEINPAIERAL 481
           SD+KTAY+ YE L +DFE  P Y++SC E+ A+SLLMGA +IVTAKM+KN+I+P I + L
Sbjct: 387 SDYKTAYSIYEILIRDFENYPLYMSSCQEFSALSLLMGAHSIVTAKMIKNDIDPLIMKYL 446

Query: 482 GAYELCATESNAHRKFGDSDDLSAPVRSYETRCMFLASELFLSLSDTWTSTPFAIAYLET 541
                          +  ++ +S      + RCM   +ELFLSLSDTWTS PFAI YLE 
Sbjct: 447 D--------------YAVNNIISLD----QIRCMIYMTELFLSLSDTWTSAPFAIKYLEV 488

Query: 542 ILNE--CKLGPLSEIMIWERLSDCYGMRIDPRIKHRIGNLELLQKKEENMDDP--KNADV 597
           IL +   KLGP+   +IWER+S  Y +RIDPRI     + +     + ++++    N   
Sbjct: 489 ILQKENLKLGPVCRNLIWERISFAYRLRIDPRIH---ADDDSTSDCDHDLEEELYLNPHK 545

Query: 598 FTTEDILSKGLTRNRKAALFKLIAARKWCEQKQWRELSWCLDDLESTYSDLKCFNKENLL 657
                I ++G TR RK A+F+L+AA+KW +  Q R+ +W L      Y DL   N E  L
Sbjct: 546 LHCGKIQNQGFTRYRKEAVFQLLAAKKWLQCGQTRQGAWSLKRCNRVYRDLPFANAEGTL 605

Query: 658 YTRLRNELI 666
            +RL + ++
Sbjct: 606 LSRLADAVV 614

>AGR096C Chr7 complement(917898..919769) [1872 bp, 623 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR108W
           (GSG1)
          Length = 623

 Score =  479 bits (1232), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 277/683 (40%), Positives = 404/683 (59%), Gaps = 92/683 (13%)

Query: 2   VFSYEHYMNLIYHLDDANETVPSDIAKRVVSNAMAPVITVTSTVLLDRHIEETYGIDSLY 61
           + SYE YMNL+++ +  ++ VP +I++RV+ NA++P ++V ST  L+ H+ E +   SLY
Sbjct: 1   MLSYETYMNLVHYPEHWSQPVPHEISRRVICNALSPCVSVQSTAALEAHLAEEFSEGSLY 60

Query: 62  MLLRFFGGCVSDRDQANEVKLGTDGLKVTEEGVENEKDGTNGLTVPRQTRVRSNSNSLYQ 121
           MLLR+F   V +R +                    E    +G   P          S+YQ
Sbjct: 61  MLLRYFADYVRERGE--------------------EVGSVSGQRRP---------GSVYQ 91

Query: 122 RDATQSQYVRFTKPLADLINTQDANDMLFDYHSLEVYLQEYLSVVDKKFSPHIPHHLLKT 181
           R    S+YVRF +PL ++I T +   +  D+  LE  L ++L  ++ + +   P  LLK 
Sbjct: 92  RQT--SRYVRFQRPLEEVIETVEQQAV--DFEDLEEALGQHLRDIEARTTNESPSELLKH 147

Query: 182 SIYHSFFALAISSTSKLSPFECFNHPIVSLLAIDITRNEDYETAAEQLKEFKSMNNNIPS 241
           SI+H F  +   S++ LSP+   NHPI++LLA+D+T+ E+Y  A E L +FK++ +    
Sbjct: 148 SIFHKFITML--SSTALSPYHTVNHPIMALLALDVTQGEEYTLARELLVQFKNLPSKSSK 205

Query: 242 FPSFINTNDILPVFLLCYNKDNETEFEECQTLAGKLKKQLFVESIILPLWSTEFTDNLVV 301
           FPS+INTND+LPVF+LC+++ +  ++E  Q L   +KKQLFVES+ LP+++   +D +V 
Sbjct: 206 FPSYINTNDVLPVFILCFDESSSEQWETVQALQKAIKKQLFVESVPLPIFTNYESDPVV- 264

Query: 302 SLHQPVMSSIEEIMFFLQNPVDHKLPLKLVNCIYDQIDMIVYDLMKPFMKRKMTFWEETI 361
            LH P+ +S++E ++   +P   +L  +LV+ IY+ I+ +V DLM PFM RK++FW+ETI
Sbjct: 265 -LHPPITNSLQEQVYDGSHPPLLRLCPQLVDVIYETINAMVEDLMIPFMNRKISFWDETI 323

Query: 362 LTPRKSLFHGAKFFKKFMNKSTQALSQPNSLLKENHGSNYLSSTSPEFLMRKLADWSMMV 421
           L PRKS+FHG KF K+FMNK+    S   +L   + G  Y  ++S EFL+RKLADWS M+
Sbjct: 324 LQPRKSIFHGNKFLKRFMNKTNS--SAAGTLSTSSDG--YFLASSNEFLLRKLADWSFML 379

Query: 422 SDFKTAYTTYESLCQDFERMPKYLASCSEWCAVSLLMGAQNIVTAKMLKNEINPAIERAL 481
           SD+KTAY+ Y  L +DFE  P+YL+SC E+ A+SLLMGA +IVT KM+KN+I+P I + +
Sbjct: 380 SDYKTAYSIYYILLRDFELYPQYLSSCQEFSALSLLMGAHSIVTTKMIKNDIDPLIMKYM 439

Query: 482 GAYELCATESNAHRKFGDSDDLSAPVRSYETRCMFLASELFLSLSDTWTSTPFAIAYLET 541
            +        N   KF               RC+   +ELFLSLSDTWTS PFAI YLE 
Sbjct: 440 DS---TVASLNYLGKF---------------RCLVYMAELFLSLSDTWTSAPFAIKYLEL 481

Query: 542 ILN--ECKLGPLSEIMIWERLSDCYGMRIDPRIKHRIGNLELLQKKEENMDDPKNADVF- 598
           IL   + KLGPLS  M+WER+S  Y +RIDPRI               + DD   +D F 
Sbjct: 482 ILQNEQLKLGPLSRTMLWERISYAYQLRIDPRI---------------HTDDEYLSDNFM 526

Query: 599 --TTED-------------ILSKGLTRNRKAALFKLIAARKWCEQKQWRELSWCLDDLES 643
             TTED             I S GLTR+RK A+F+L+AA+KW E    R+ +W L     
Sbjct: 527 ELTTEDDFCMNPNKLHHWRIHSLGLTRHRKEAVFRLLAAKKWLEYGHIRQGAWSLKGCNK 586

Query: 644 TYSDLKCFNKENLLYTRLRNELI 666
            Y +L   N +  L +RL + ++
Sbjct: 587 VYRNLGFANADGTLLSRLVDMVV 609

>KLLA0F18953g Chr6 (1737522..1739465) [1944 bp, 647 aa] {ON} similar
           to uniprot|P46944 Saccharomyces cerevisiae YDR108W GSG1
           Subunit of TRAPP (transport protein particle) a
           multi-subunit complex involved in targeting and/or
           fusion of ER-to-Golgi transport vesicles with their
           acceptor compartment protein has late meiotic role
           following DNA replication
          Length = 647

 Score =  450 bits (1157), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 264/684 (38%), Positives = 398/684 (58%), Gaps = 63/684 (9%)

Query: 3   FSYEHYMNLIYHLDDANETVPSDIAKRVVSNAMAPVITVTSTVLLDRHIEETYGIDSLYM 62
           FSYE YMNLI + +  +  +P +I+K+V+ N ++P I V S + LD H+++ Y IDS+ M
Sbjct: 5   FSYEKYMNLIQYPEHWSNPIPHEISKKVIYNTLSPCICVQSNLELDNHLKDMYNIDSISM 64

Query: 63  LLRFFGGCVSDRDQANEVKLGTDGLKVTEEGVENEKDGTNGLTVPRQTRVRSNSNSLYQR 122
           L R+FG  + DRDQ   +   TD        +++    ++G         R  S+SL+QR
Sbjct: 65  LFRYFGDYIQDRDQ---IPSTTD--------LKDPGSVSSG---------RHRSDSLFQR 104

Query: 123 DATQSQYVRFTKPLADLINTQDANDMLFDYHSLEVYLQEYLSVVDKKFSPH-IPHHLLKT 181
            A  S+ VRFT+ L DLI+  D+ D +     ++ +L +YL  ++   + +  P  LLK 
Sbjct: 105 QA--SECVRFTRSLEDLISI-DSEDHILQSTDIDSFLSQYLQNLEPIMNENGTPSKLLKH 161

Query: 182 SIYHSFFALAISSTSKLSPFECFNHPIVSLLAIDITRNEDYETAAEQLKEFKSMNNNIPS 241
           SIYH FF + +SS + LS +  F+HP+V+LL +DIT+ + YE A E L  FK++NN + +
Sbjct: 162 SIYHRFF-ITLSSIN-LSRYHSFHHPVVALLPLDITKGQGYENAREILIHFKNLNNTLEN 219

Query: 242 FPSFINTNDILPVFLLCYNKDNETEFEECQTLAGKLKKQLFVESIILPLWSTEFTDNLVV 301
           FP FIN NDILPVF+LCY++++  ++E  Q L   LKKQLFVES+ + L+ T   +    
Sbjct: 220 FPEFININDILPVFVLCYDENSREQWESVQALTKSLKKQLFVESVSISLF-TPHDNQKST 278

Query: 302 SLHQPVMSSIEEIMFFLQNPVDHKLPLKLVNCIYDQIDMIVYDLMKPFMKRKMTFWEETI 361
           +LH P+  S+ E +F + +P    +P +L+  IYD I  IV ++M PFM RK+ FW+ET+
Sbjct: 279 TLHSPITVSLHEQVFNMSHPTSINIPSRLLTHIYDTISFIVEEMMIPFMHRKLVFWDETV 338

Query: 362 LTPRKSLFHGAKFFKKFMN-KSTQALSQP-NSLLKENHGSNYLSSTSPEFLMRKLADWSM 419
           L PRKS+F   KFF++F++ KS   ++   N       G     ++SPEFL+RKLADWS 
Sbjct: 339 LQPRKSIFQSNKFFRRFISPKSNHPIAHKVNDPQDPAEGDIMFPASSPEFLLRKLADWSF 398

Query: 420 MVSDFKTAYTTYESLCQDFERMPKYLASCSEWCAVSLLMGAQNIVTAKMLKNEINPAIER 479
           M+SDFK AY+ Y+ L +DFE  P+YLA C E+  +SLLMGAQNI+TAK +K E++P + R
Sbjct: 399 MLSDFKKAYSIYDLLTKDFESYPQYLAPCLEYKTISLLMGAQNIITAKTIKTEVDPLMTR 458

Query: 480 ALGAYELCATESNAHRKFGDSDDLSAPVRSYETRCMFLASELFLSLSDTWTSTPFAIAYL 539
           A+  Y          +K  +   L          C+   S+L LSLSDTW S+P A+ YL
Sbjct: 459 AIEQY----------KKQDEKHSLRV------IHCILTFSDLLLSLSDTWVSSPLAVNYL 502

Query: 540 ETILNECKLGPLSEIMIWERLSDCYGMRIDPRI----------KHRIGNLELLQ--KKEE 587
             I     LGP + ++I ER++  Y + ID R+          +++    E  +  KK E
Sbjct: 503 TYIQKSHLLGPYATVIILERIAYAYEICIDLRVNDHFLPKPDEENKADESEAAENSKKGE 562

Query: 588 N------MDDPKNADVFTTEDILSKGLTRNRKAALFKLIAARKWCEQKQWRELSWCLDDL 641
           N      M + +N +     ++ S+GLTR RK +L++L+AA+KW E  +  +  WC+   
Sbjct: 563 NGLEVDDMHEWRNENKLIQNNLRSEGLTRFRKYSLYQLVAAKKWVELHKRNQAKWCIYHA 622

Query: 642 ESTYSDLKCFNKENLLYTRLRNEL 665
              Y  L    + + L+ RL  EL
Sbjct: 623 APAYEKLSLSKRPDGLFHRLSMEL 646

>ZYRO0D05258g Chr4 complement(448819..451071) [2253 bp, 750 aa] {ON}
           highly similar to uniprot|P31382 Saccharomyces
           cerevisiae YAL023C PMT2 Transfers mannosyl residues from
           dolichyl phosphate-D-mannose to seryl and threonyl
           residues in proteins acts in complex with Pmt1p dolichyl
           phosphate-D-mannose:protein O-D-mannosyltransferase
          Length = 750

 Score = 36.2 bits (82), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 25/82 (30%), Positives = 42/82 (51%), Gaps = 11/82 (13%)

Query: 348 PFMKRKMTFW-----EETILTPRKSLFHGAK--FFKKFMNKSTQALSQPNSLLKENHGSN 400
           PF + K T+W     E  +L PR   F   K  FFK F++ +   ++  N+L+ EN   +
Sbjct: 505 PFRRDKRTWWNVETHENELLPPRPEGFKFPKTNFFKDFIHLNLAMMATNNALIPENDKLD 564

Query: 401 YLSSTSPEF----LMRKLADWS 418
           YL+S + ++    +  +L  WS
Sbjct: 565 YLTSAAWQWPSLNIGLRLCGWS 586

>Kpol_1060.56 s1060 complement(132691..133983) [1293 bp, 430 aa]
           {ON} complement(132691..133983) [1293 nt, 431 aa]
          Length = 430

 Score = 35.4 bits (80), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 26/88 (29%), Positives = 37/88 (42%), Gaps = 17/88 (19%)

Query: 3   FSYEHYMNLIYHLDDANETVPSDIAKRVVSNAMAPVITVTSTVLLDR----HIEE-TYGI 57
           F  E YMN   HLDD+                 APV T+ +++LLD+    H +E  YG 
Sbjct: 324 FRSEKYMNYFKHLDDSGGFYYERWGD-------APVHTIAASLLLDKNEIIHFDELGYGH 376

Query: 58  DSLY-----MLLRFFGGCVSDRDQANEV 80
           +  Y        R   GC+ D +  N +
Sbjct: 377 NPFYSCPTAYYFRLVHGCLCDPNGVNSI 404

>CAGL0J08734g Chr10 (862513..864741) [2229 bp, 742 aa] {ON} highly
           similar to uniprot|P31382 Saccharomyces cerevisiae
           YAL023c PMT2 or uniprot|P47190 Saccharomyces cerevisiae
           YOR321w PMT3
          Length = 742

 Score = 34.7 bits (78), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 19/68 (27%), Positives = 38/68 (55%), Gaps = 6/68 (8%)

Query: 348 PFMKRKMTFWE------ETILTPRKSLFHGAKFFKKFMNKSTQALSQPNSLLKENHGSNY 401
           PF + K T+W       E + TP +  + G+ F K F++ +   ++  N+L+ E+   +Y
Sbjct: 503 PFRRDKRTWWNVESHENEKLPTPEEFKYPGSGFLKDFIHLNLAMMATNNALVPESDKFDY 562

Query: 402 LSSTSPEF 409
           L+S++ E+
Sbjct: 563 LASSAWEW 570

>KLTH0C08250g Chr3 complement(701335..702309) [975 bp, 324 aa] {ON}
           some similarities with uniprot|Q03937 Saccharomyces
           cerevisiae YDR014W-A HED1 Meiosis-specific protein that
           down-regulates Rad51p-mediated mitotic recombination
           when the meiotic recombination machinery is impaired
          Length = 324

 Score = 33.9 bits (76), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 30/69 (43%), Gaps = 2/69 (2%)

Query: 106 VPRQTRVRSNSNSLYQRDATQSQYVRFTKPLADLINTQDANDMLFDYHSLEVYLQEYLSV 165
           VP  T+   NS    QR   QS  V   KPL DLIN    N   +   S +V  +  LS 
Sbjct: 252 VPSPTQAEPNSVLSCQRSVLQSPDVSVHKPLRDLINK--TNHACYRTDSSKVRYKAGLSR 309

Query: 166 VDKKFSPHI 174
              K  PH+
Sbjct: 310 KSSKLIPHL 318

>Ecym_2113 Chr2 (210298..212937) [2640 bp, 879 aa] {ON} similar to
           Ashbya gossypii ADR287C
          Length = 879

 Score = 32.7 bits (73), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 25/88 (28%), Positives = 46/88 (52%), Gaps = 14/88 (15%)

Query: 596 DVFTTEDILSKG----LTRNRKAALFKL---------IAARKWCEQKQWRELSWCLDDLE 642
           +V T+ +ILS+G    L     +A+ K+         +A +K+ ++++ ++L W + DLE
Sbjct: 28  EVGTSREILSEGGEARLESTDGSAVEKVEGSMDELRRLARQKYLDRREHQKLEWVIHDLE 87

Query: 643 STYSDLKCFNKENLLYTRLRNELIAARQ 670
               D+K +  +NL   R R E+   RQ
Sbjct: 88  ILEEDVKKYGWDNLT-EREREEISIKRQ 114

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.133    0.395 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 74,349,418
Number of extensions: 3381383
Number of successful extensions: 10657
Number of sequences better than 10.0: 51
Number of HSP's gapped: 10870
Number of HSP's successfully gapped: 56
Length of query: 672
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 556
Effective length of database: 40,180,143
Effective search space: 22340159508
Effective search space used: 22340159508
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 69 (31.2 bits)