Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
CAGL0B01683g8.254ON69169135280.0
YDR107C (TMN2)8.254ON67268623380.0
Suva_2.2678.254ON67268622880.0
Smik_4.3538.254ON69068622750.0
NCAS0B049708.254ON66668922610.0
YLR083C (EMP70)8.254ON66768822570.0
Suva_10.1678.254ON68468822580.0
Smik_12.1428.254ON66368022470.0
NDAI0B023708.254ON72268722520.0
Kpol_543.358.254ON65868522330.0
Skud_12.1518.254ON66468922310.0
KAFR0B026808.254ON66469122270.0
Skud_4.3688.254ON67268622270.0
TBLA0E043708.254ON67668221930.0
ZYRO0C01848g8.254ON64769121250.0
NCAS0B038908.254ON66368321150.0
TPHA0A018408.254ON68568621150.0
Kwal_56.235778.254ON68367721060.0
TBLA0H014508.254ON67368621040.0
KLTH0G13882g8.254ON68769621050.0
KNAG0G019908.254ON66767520960.0
KLLA0F18931g8.254ON66569120860.0
SAKL0H17248g8.254ON66067520390.0
TDEL0F038108.254ON65668519360.0
NDAI0J014208.254ON61964718640.0
AGR097W8.254ON65367518300.0
Ecym_43178.254ON60569113371e-177
NDAI0A015107.411ON6797133908e-39
YER113C (TMN3)7.411ON7067293678e-36
NCAS0A145207.411ON6704873091e-28
KNAG0C034307.411ON6805073054e-28
SAKL0F12914g7.411ON7075342823e-25
Smik_5.2587.411ON7065182805e-25
CAGL0G03487g7.411ON7045222771e-24
TDEL0C027107.411ON6785042691e-23
KAFR0K019507.411ON6645002592e-22
KLLA0E20835g7.411ON6767212547e-22
Suva_5.2347.411ON7065132521e-21
ZYRO0B03784g7.411ON6584812351e-19
Skud_5.2667.411ON7075112154e-17
Kwal_27.107467.411ON6901601993e-15
KLTH0C06226g7.411ON6941521806e-13
TBLA0I003307.411ON7133141298e-07
Ecym_71437.411ON6762691281e-06
TPHA0K007307.411ON7331511262e-06
AGL295C7.411ON6571511253e-06
Kpol_1045.287.411ON6815021172e-05
Skud_2.3676.146ON1113195752.3
Suva_4.4926.146ON1110195742.9
Skud_13.3212.354ON14099694.2
TPHA0N011506.146ON1105208725.1
TBLA0B020501.500ON432130715.9
YBR235W6.146ON1120195716.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0B01683g
         (691 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0B01683g Chr2 complement(154275..156350) [2076 bp, 691 aa] {...  1363   0.0  
YDR107C Chr4 complement(669016..671034) [2019 bp, 672 aa] {ON}  ...   905   0.0  
Suva_2.267 Chr2 complement(463458..465476) [2019 bp, 672 aa] {ON...   885   0.0  
Smik_4.353 Chr4 complement(630320..632392) [2073 bp, 690 aa] {ON...   880   0.0  
NCAS0B04970 Chr2 complement(909770..911770) [2001 bp, 666 aa] {O...   875   0.0  
YLR083C Chr12 complement(294091..296094) [2004 bp, 667 aa] {ON} ...   874   0.0  
Suva_10.167 Chr10 complement(299075..301129) [2055 bp, 684 aa] {...   874   0.0  
Smik_12.142 Chr12 complement(273932..275923) [1992 bp, 663 aa] {...   870   0.0  
NDAI0B02370 Chr2 complement(593012..595180) [2169 bp, 722 aa] {O...   872   0.0  
Kpol_543.35 s543 complement(78246..80222) [1977 bp, 658 aa] {ON}...   864   0.0  
Skud_12.151 Chr12 complement(277467..279461) [1995 bp, 664 aa] {...   863   0.0  
KAFR0B02680 Chr2 complement(537048..539042) [1995 bp, 664 aa] {O...   862   0.0  
Skud_4.368 Chr4 complement(640627..642645) [2019 bp, 672 aa] {ON...   862   0.0  
TBLA0E04370 Chr5 complement(1108954..1110984) [2031 bp, 676 aa] ...   849   0.0  
ZYRO0C01848g Chr3 (146621..148564) [1944 bp, 647 aa] {ON} simila...   823   0.0  
NCAS0B03890 Chr2 (693950..695941) [1992 bp, 663 aa] {ON} Anc_8.254    819   0.0  
TPHA0A01840 Chr1 (371758..373815) [2058 bp, 685 aa] {ON} Anc_8.2...   819   0.0  
Kwal_56.23577 s56 complement(605281..607332) [2052 bp, 683 aa] {...   815   0.0  
TBLA0H01450 Chr8 complement(321416..323437) [2022 bp, 673 aa] {O...   815   0.0  
KLTH0G13882g Chr7 (1204180..1206243) [2064 bp, 687 aa] {ON} simi...   815   0.0  
KNAG0G01990 Chr7 complement(441326..443329) [2004 bp, 667 aa] {O...   811   0.0  
KLLA0F18931g Chr6 complement(1734636..1736633) [1998 bp, 665 aa]...   808   0.0  
SAKL0H17248g Chr8 (1530599..1532581) [1983 bp, 660 aa] {ON} simi...   790   0.0  
TDEL0F03810 Chr6 complement(696251..698221) [1971 bp, 656 aa] {O...   750   0.0  
NDAI0J01420 Chr10 (326749..328608) [1860 bp, 619 aa] {ON} Anc_8....   722   0.0  
AGR097W Chr7 (920133..922094) [1962 bp, 653 aa] {ON} Syntenic ho...   709   0.0  
Ecym_4317 Chr4 (685854..687671) [1818 bp, 605 aa] {ON} similar t...   519   e-177
NDAI0A01510 Chr1 (335693..337732) [2040 bp, 679 aa] {ON} Anc_7.4...   154   8e-39
YER113C Chr5 complement(387932..390052) [2121 bp, 706 aa] {ON}  ...   145   8e-36
NCAS0A14520 Chr1 complement(2860704..2862716) [2013 bp, 670 aa] ...   123   1e-28
KNAG0C03430 Chr3 (674411..676453) [2043 bp, 680 aa] {ON} Anc_7.4...   122   4e-28
SAKL0F12914g Chr6 complement(1013914..1016037) [2124 bp, 707 aa]...   113   3e-25
Smik_5.258 Chr5 complement(396781..398901) [2121 bp, 706 aa] {ON...   112   5e-25
CAGL0G03487g Chr7 complement(337133..339247) [2115 bp, 704 aa] {...   111   1e-24
TDEL0C02710 Chr3 complement(474759..476795) [2037 bp, 678 aa] {O...   108   1e-23
KAFR0K01950 Chr11 complement(401168..403162) [1995 bp, 664 aa] {...   104   2e-22
KLLA0E20835g Chr5 complement(1857426..1859456) [2031 bp, 676 aa]...   102   7e-22
Suva_5.234 Chr5 complement(363605..365725) [2121 bp, 706 aa] {ON...   101   1e-21
ZYRO0B03784g Chr2 complement(314902..316878) [1977 bp, 658 aa] {...    95   1e-19
Skud_5.266 Chr5 (431486..433609) [2124 bp, 707 aa] {ON} YER113C ...    87   4e-17
Kwal_27.10746 s27 (479237..481309) [2073 bp, 690 aa] {ON} YER113...    81   3e-15
KLTH0C06226g Chr3 (541022..543106) [2085 bp, 694 aa] {ON} simila...    74   6e-13
TBLA0I00330 Chr9 (52200..54341) [2142 bp, 713 aa] {ON} Anc_7.411...    54   8e-07
Ecym_7143 Chr7 (290555..292585) [2031 bp, 676 aa] {ON} similar t...    54   1e-06
TPHA0K00730 Chr11 (150877..153078) [2202 bp, 733 aa] {ON} Anc_7....    53   2e-06
AGL295C Chr7 complement(152197..154170) [1974 bp, 657 aa] {ON} S...    53   3e-06
Kpol_1045.28 s1045 (64235..66280) [2046 bp, 681 aa] {ON} (64237....    50   2e-05
Skud_2.367 Chr2 (655638..658979) [3342 bp, 1113 aa] {ON} YBR235W...    33   2.3  
Suva_4.492 Chr4 (857188..860520) [3333 bp, 1110 aa] {ON} YBR235W...    33   2.9  
Skud_13.321 Chr13 complement(547412..547834) [423 bp, 140 aa] {O...    31   4.2  
TPHA0N01150 Chr14 complement(241358..244675) [3318 bp, 1105 aa] ...    32   5.1  
TBLA0B02050 Chr2 (472955..474253) [1299 bp, 432 aa] {ON} Anc_1.5...    32   5.9  
YBR235W Chr2 (686901..690263) [3363 bp, 1120 aa] {ON} Putative i...    32   6.7  

>CAGL0B01683g Chr2 complement(154275..156350) [2076 bp, 691 aa] {ON}
           highly similar to uniprot|Q04562 Saccharomyces
           cerevisiae YDR107c or uniprot|P32802 Saccharomyces
           cerevisiae YLR083c EMP70
          Length = 691

 Score = 1363 bits (3528), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 668/691 (96%), Positives = 668/691 (96%)

Query: 1   MVRQLLVLSLFVASTLGFYLPGAAPRTYKQGDAIPLLVNHLTPSLNFQHVDDDGNEIKGD 60
           MVRQLLVLSLFVASTLGFYLPGAAPRTYKQGDAIPLLVNHLTPSLNFQHVDDDGNEIKGD
Sbjct: 1   MVRQLLVLSLFVASTLGFYLPGAAPRTYKQGDAIPLLVNHLTPSLNFQHVDDDGNEIKGD 60

Query: 61  KARMLYPYDYYNEKLHFCQPEKIEKQPESLGSVIFGEKIYNSPFNVKMLEDNECVQLCST 120
           KARMLYPYDYYNEKLHFCQPEKIEKQPESLGSVIFGEKIYNSPFNVKMLEDNECVQLCST
Sbjct: 61  KARMLYPYDYYNEKLHFCQPEKIEKQPESLGSVIFGEKIYNSPFNVKMLEDNECVQLCST 120

Query: 121 TIPGKDAKFINKLIKNGFMQNWLIDGLPAARKLHDSRTNTEFYGQGFELGFVEVRQAVGG 180
           TIPGKDAKFINKLIKNGFMQNWLIDGLPAARKLHDSRTNTEFYGQGFELGFVEVRQAVGG
Sbjct: 121 TIPGKDAKFINKLIKNGFMQNWLIDGLPAARKLHDSRTNTEFYGQGFELGFVEVRQAVGG 180

Query: 181 KIVSESEKELQLSERDAKNIIDFTDIEIRSPKNLVDLSNLEVREAKNVVDNIVTNVEVPV 240
           KIVSESEKELQLSERDAKNIIDFTDIEIRSPKNLVDLSNLEVREAKNVVDNIVTNVEVPV
Sbjct: 181 KIVSESEKELQLSERDAKNIIDFTDIEIRSPKNLVDLSNLEVREAKNVVDNIVTNVEVPV 240

Query: 241 FANHFDIEVEYHDRGNGDFRVVGVIVNPVSLDNYKSRSCALANQHKLHLDENKDNEVMFT 300
           FANHFDIEVEYHDRGNGDFRVVGVIVNPVSLDNYKSRSCALANQHKLHLDENKDNEVMFT
Sbjct: 241 FANHFDIEVEYHDRGNGDFRVVGVIVNPVSLDNYKSRSCALANQHKLHLDENKDNEVMFT 300

Query: 301 YSVKFTPSDTPWATRWDKYLHIYDPKIQWFSLINFSVIVLLLSSVAIHSLLRALKSDISR 360
           YSVKFTPSDTPWATRWDKYLHIYDPKIQWFSLINFSVIVLLLSSVAIHSLLRALKSDISR
Sbjct: 301 YSVKFTPSDTPWATRWDKYLHIYDPKIQWFSLINFSVIVLLLSSVAIHSLLRALKSDISR 360

Query: 361 YNEFNLGDEFEEDSGWKLVHGDVFRTPKNSMLLSVLVGSGXXXXXXXXXXXXXXXXXXXX 420
           YNEFNLGDEFEEDSGWKLVHGDVFRTPKNSMLLSVLVGSG                    
Sbjct: 361 YNEFNLGDEFEEDSGWKLVHGDVFRTPKNSMLLSVLVGSGIQLFLMIFLSIILSALGILS 420

Query: 421 XXXRGSLPTAMFMFYAIFGFVGSYTSMGIYKFFKGPYWKANMILTPVLLPGIIFLTVIFM 480
              RGSLPTAMFMFYAIFGFVGSYTSMGIYKFFKGPYWKANMILTPVLLPGIIFLTVIFM
Sbjct: 421 PSSRGSLPTAMFMFYAIFGFVGSYTSMGIYKFFKGPYWKANMILTPVLLPGIIFLTVIFM 480

Query: 481 NVLLYFVGSSNVIPLATLVFMVFLWILFSIPLAFAGSLISYKKCNWDEHPTKTNEIPRQI 540
           NVLLYFVGSSNVIPLATLVFMVFLWILFSIPLAFAGSLISYKKCNWDEHPTKTNEIPRQI
Sbjct: 481 NVLLYFVGSSNVIPLATLVFMVFLWILFSIPLAFAGSLISYKKCNWDEHPTKTNEIPRQI 540

Query: 541 PFQPWFLKTVPATLIGGLVSFGSIAVELYFIYSSLWFNKIFYMFGFLLFSIVLFSFTTGL 600
           PFQPWFLKTVPATLIGGLVSFGSIAVELYFIYSSLWFNKIFYMFGFLLFSIVLFSFTTGL
Sbjct: 541 PFQPWFLKTVPATLIGGLVSFGSIAVELYFIYSSLWFNKIFYMFGFLLFSIVLFSFTTGL 600

Query: 601 INVIITYRALCSENWTWQWRSFFIGGLGCSIYIFIHSILFTQFKLGGFATIVLYVGYSFL 660
           INVIITYRALCSENWTWQWRSFFIGGLGCSIYIFIHSILFTQFKLGGFATIVLYVGYSFL
Sbjct: 601 INVIITYRALCSENWTWQWRSFFIGGLGCSIYIFIHSILFTQFKLGGFATIVLYVGYSFL 660

Query: 661 ISFLTCIVTGAIGFICSMFFVRRIFASIKVD 691
           ISFLTCIVTGAIGFICSMFFVRRIFASIKVD
Sbjct: 661 ISFLTCIVTGAIGFICSMFFVRRIFASIKVD 691

>YDR107C Chr4 complement(669016..671034) [2019 bp, 672 aa] {ON}
           TMN2Protein with a role in cellular adhesion and
           filamentous growth; similar to Emp70p and Tmn3p; member
           of the evolutionarily conserved Transmembrane Nine
           family of proteins with nine membrane-spanning segments
          Length = 672

 Score =  905 bits (2338), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 441/686 (64%), Positives = 528/686 (76%), Gaps = 20/686 (2%)

Query: 6   LVLSLFVASTLGFYLPGAAPRTYKQGDAIPLLVNHLTPSLNFQHVDDDGNEIKGDKARML 65
           L++  +   T GF LPG +P TY  GD IPLLVN LTPS+ FQH D++GN++ GDK   L
Sbjct: 7   LLIYCYATLTKGFSLPGLSPTTYHSGDEIPLLVNRLTPSIYFQHQDEEGNDVSGDKEHFL 66

Query: 66  YPYDYYNEKLHFCQPEKIEKQPESLGSVIFGEKIYNSPFNVKMLEDNECVQLCSTTIPGK 125
           Y YDYYN++ HFC+PE +EKQPESLGSVIFG++IYNSPF + MLE+ ECV LC +TIPGK
Sbjct: 67  YSYDYYNKRFHFCRPEHVEKQPESLGSVIFGDRIYNSPFQLNMLEEKECVALCKSTIPGK 126

Query: 126 DAKFINKLIKNGFMQNWLIDGLPAARKLHDSRTNTEFYGQGFELGFVEVRQAVGGKIVSE 185
           DAKFIN LIK+GF QNWL+DGLPAARK +DSRT T +YG GFELGF +V+Q V GK V  
Sbjct: 127 DAKFINTLIKSGFFQNWLVDGLPAARKAYDSRTKTNYYGTGFELGFTDVKQTVDGKAVPS 186

Query: 186 SEKELQLSERDAKNIIDFTDIEIRSPKNLVDLSNLEVREAKNVVDNIVTNVEVPVFANHF 245
           + +EL  SE   +++I                  L+ R  KNV  N+V  VE+P F NHF
Sbjct: 187 TMEELT-SEASNEDVI------------------LDARLPKNVKPNLVKTVELPYFVNHF 227

Query: 246 DIEVEYHDRGNGDFRVVGVIVNPVSLDNYKSRSCALANQHKLHLDENKDNEVMFTYSVKF 305
           DIEVE+HDRGN ++RVVGVIVNPVS++     +C+   +  L LDE+KDNEV FTYSVKF
Sbjct: 228 DIEVEFHDRGNDNYRVVGVIVNPVSIERSSPGACSTTGK-PLILDEDKDNEVYFTYSVKF 286

Query: 306 TPSDTPWATRWDKYLHIYDPKIQWFSLINFSVIVLLLSSVAIHSLLRALKSDISRYNEFN 365
             SDT WATRWDKYLHIYDP+IQWFSLINFSVIV+LLSSV +HSLLRALKSD++RYNE N
Sbjct: 287 VASDTVWATRWDKYLHIYDPQIQWFSLINFSVIVILLSSVVMHSLLRALKSDLARYNELN 346

Query: 366 LGDEFEEDSGWKLVHGDVFRTPKNSMLLSVLVGSGXXXXXXXXXXXXXXXXXXXXXXXRG 425
           L +EF EDSGWKL HGDVFRTP  SMLLS+LVGSG                       RG
Sbjct: 347 LDNEFHEDSGWKLGHGDVFRTPSKSMLLSILVGSGMQLFLMVMCSIFFAAVGLVSPVSRG 406

Query: 426 SLPTAMFMFYAIFGFVGSYTSMGIYKFFKGPYWKANMILTPVLLPGIIFLTVIFMNVLLY 485
           SLPT MF+ YA+FGFVGSY SMG+YKFF+GPYWKANMILTP+LLPG IFL ++ MN  L 
Sbjct: 407 SLPTVMFVLYALFGFVGSYASMGVYKFFRGPYWKANMILTPILLPGAIFLLIVIMNFFLL 466

Query: 486 FVGSSNVIPLATLVFMVFLWILFSIPLAFAGSLISYKKCNWDEHPTKTNEIPRQIPFQPW 545
           F  SS VIP  +L F++ LW L S+PL+FAGS++++K+CNWDEHPTKTN+I RQIP+QPW
Sbjct: 467 FAHSSGVIPARSLFFIILLWFLVSVPLSFAGSIVAHKQCNWDEHPTKTNQIARQIPYQPW 526

Query: 546 FLKTVPATLIGGLVSFGSIAVELYFIYSSLWFNKIFYMFGFLLFSIVLFSFTTGLINVII 605
           +L+T  ATLI G+ SFGSIAVELYFIYSSLWFNKIFYMFGFLLFS +L + TT L+ ++I
Sbjct: 527 YLRTAQATLIAGIFSFGSIAVELYFIYSSLWFNKIFYMFGFLLFSFLLLTLTTSLVTILI 586

Query: 606 TYRALCSENWTWQWRSFFIGGLGCSIYIFIHSILFTQFKLGGFATIVLYVGYSFLISFLT 665
           TY +LC ENW WQWRSF IGGLGCSIY FIHSILFT+FKLGG  T+VLY+GYS +IS L 
Sbjct: 587 TYYSLCLENWLWQWRSFIIGGLGCSIYTFIHSILFTKFKLGGVITVVLYLGYSLIISALC 646

Query: 666 CIVTGAIGFICSMFFVRRIFASIKVD 691
           C+VTGAIGF  SMFF+R+I+++IKV+
Sbjct: 647 CVVTGAIGFFSSMFFIRKIYSAIKVE 672

>Suva_2.267 Chr2 complement(463458..465476) [2019 bp, 672 aa] {ON}
           YDR107C (REAL)
          Length = 672

 Score =  885 bits (2288), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 428/686 (62%), Positives = 520/686 (75%), Gaps = 20/686 (2%)

Query: 6   LVLSLFVASTLGFYLPGAAPRTYKQGDAIPLLVNHLTPSLNFQHVDDDGNEIKGDKARML 65
           L L L++A    F LPG +P TY+  D IPLLVN LTPS+ FQH D++G ++  DK   L
Sbjct: 7   LALFLYIALAKAFSLPGVSPTTYRANDEIPLLVNRLTPSIYFQHKDENGKDVSSDKEHFL 66

Query: 66  YPYDYYNEKLHFCQPEKIEKQPESLGSVIFGEKIYNSPFNVKMLEDNECVQLCSTTIPGK 125
           Y YDYYN+K HFC+PE +EKQPESLGSVIFG++IYNSPF +KMLED ECV LC +TIPGK
Sbjct: 67  YSYDYYNDKFHFCKPEHVEKQPESLGSVIFGDRIYNSPFQLKMLEDKECVALCKSTIPGK 126

Query: 126 DAKFINKLIKNGFMQNWLIDGLPAARKLHDSRTNTEFYGQGFELGFVEVRQAVGGKIVSE 185
           DAKFIN LIKNGF QNWL+DGLPAAR ++DSRT T +YG GFELGF +V+Q VGGK +  
Sbjct: 127 DAKFINTLIKNGFFQNWLVDGLPAARNVYDSRTKTNYYGTGFELGFTDVKQTVGGKTIPS 186

Query: 186 SEKELQLSERDAKNIIDFTDIEIRSPKNLVDLSNLEVREAKNVVDNIVTNVEVPVFANHF 245
           + +EL     D+K                   + L+ R+ KN+  N+V  +E+  F NHF
Sbjct: 187 TMEELD--SEDSKT-----------------GATLDARDPKNIKPNLVQTIELTHFVNHF 227

Query: 246 DIEVEYHDRGNGDFRVVGVIVNPVSLDNYKSRSCALANQHKLHLDENKDNEVMFTYSVKF 305
           +I+VEYHDRGNG++RVVGV VNP+S++     +C+   +  L L E+KDN+V FTYSVKF
Sbjct: 228 NIQVEYHDRGNGNYRVVGVTVNPLSIERSSPGACSTTGE-PLTLVEDKDNDVYFTYSVKF 286

Query: 306 TPSDTPWATRWDKYLHIYDPKIQWFSLINFSVIVLLLSSVAIHSLLRALKSDISRYNEFN 365
             SDT WATRWDKYLH+YDP+IQWFSLINFS+IV+LLSSV IHS+LRA++SD +RYNE N
Sbjct: 287 IASDTVWATRWDKYLHVYDPQIQWFSLINFSIIVILLSSVVIHSILRAVRSDFARYNELN 346

Query: 366 LGDEFEEDSGWKLVHGDVFRTPKNSMLLSVLVGSGXXXXXXXXXXXXXXXXXXXXXXXRG 425
           L +EF ED+GWKL HGDVFR P  SM+LSVLVGSG                       RG
Sbjct: 347 LDNEFHEDAGWKLGHGDVFRIPPKSMVLSVLVGSGIQLFLMIICSIFFAALGLVSPASRG 406

Query: 426 SLPTAMFMFYAIFGFVGSYTSMGIYKFFKGPYWKANMILTPVLLPGIIFLTVIFMNVLLY 485
           SLPT MF+ YA+FGFVGSYTSMG+YKFF GPYWKAN+I+TP+LLPG IFL ++ MN  L 
Sbjct: 407 SLPTVMFVLYALFGFVGSYTSMGVYKFFHGPYWKANLIITPILLPGAIFLLIVAMNFFLL 466

Query: 486 FVGSSNVIPLATLVFMVFLWILFSIPLAFAGSLISYKKCNWDEHPTKTNEIPRQIPFQPW 545
           F  SS VIP  TL F++FLW   SIPL+FAGS I++K+C WDEHPTKTN+I RQ P QPW
Sbjct: 467 FAHSSGVIPARTLFFIIFLWFSVSIPLSFAGSYIAHKRCKWDEHPTKTNQIARQSPRQPW 526

Query: 546 FLKTVPATLIGGLVSFGSIAVELYFIYSSLWFNKIFYMFGFLLFSIVLFSFTTGLINVII 605
           +L+T+ ATLI G+ SFGSIAVELYFIYSSLWFNKIFYMFGFLLFS +L +  T L+ V I
Sbjct: 527 YLRTIQATLIAGIFSFGSIAVELYFIYSSLWFNKIFYMFGFLLFSFLLLTLATSLVTVFI 586

Query: 606 TYRALCSENWTWQWRSFFIGGLGCSIYIFIHSILFTQFKLGGFATIVLYVGYSFLISFLT 665
           TY +LC ENW+WQWRSF IGGLGCS+Y+FIH+ILFT+FKLGGF T+VLYVGYSF+IS L 
Sbjct: 587 TYHSLCLENWSWQWRSFIIGGLGCSVYMFIHAILFTKFKLGGFVTVVLYVGYSFIISALC 646

Query: 666 CIVTGAIGFICSMFFVRRIFASIKVD 691
           C+VTGAIGF  SM F+R+I++ IKV+
Sbjct: 647 CVVTGAIGFFSSMIFIRKIYSRIKVE 672

>Smik_4.353 Chr4 complement(630320..632392) [2073 bp, 690 aa] {ON}
           YDR107C (REAL)
          Length = 690

 Score =  880 bits (2275), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 429/686 (62%), Positives = 519/686 (75%), Gaps = 20/686 (2%)

Query: 6   LVLSLFVASTLGFYLPGAAPRTYKQGDAIPLLVNHLTPSLNFQHVDDDGNEIKGDKARML 65
           L+L  ++  T  F LPG +P TY + D IPLLVN LTPS+ FQH D++G +I  DK   L
Sbjct: 25  LLLFFYIGLTKAFSLPGLSPTTYHKNDEIPLLVNRLTPSIYFQHQDENGKDISSDKEHYL 84

Query: 66  YPYDYYNEKLHFCQPEKIEKQPESLGSVIFGEKIYNSPFNVKMLEDNECVQLCSTTIPGK 125
           Y YDYYNE+ HFC+PE +E+QPESLGS+IFG++IYNSPF ++MLE  ECV LC  TIPGK
Sbjct: 85  YSYDYYNERFHFCRPEHVERQPESLGSIIFGDRIYNSPFQLRMLETKECVALCENTIPGK 144

Query: 126 DAKFINKLIKNGFMQNWLIDGLPAARKLHDSRTNTEFYGQGFELGFVEVRQAVGGKIVSE 185
           DAKFINKLIK+GF QNWL+DGLPAARK+ DSRT T +YG GFELG   V+  + GK++  
Sbjct: 145 DAKFINKLIKSGFFQNWLVDGLPAARKVWDSRTKTNYYGTGFELGITAVKNTIDGKVIPS 204

Query: 186 SEKELQLSERDAKNIIDFTDIEIRSPKNLVDLSNLEVREAKNVVDNIVTNVEVPVFANHF 245
           + +EL     +                     + L+ RE KN+  N+V  VE+P F NHF
Sbjct: 205 TMEELDSETSNTG-------------------AALDAREPKNIKPNLVKTVELPYFVNHF 245

Query: 246 DIEVEYHDRGNGDFRVVGVIVNPVSLDNYKSRSCALANQHKLHLDENKDNEVMFTYSVKF 305
           DIEVE+HDRG+ ++RVVGV VNP+S++     SC+ A +  L LDE  DNE+ FTYSVKF
Sbjct: 246 DIEVEFHDRGDDNYRVVGVTVNPMSIERSSPDSCSKATK-PLILDEEGDNEIYFTYSVKF 304

Query: 306 TPSDTPWATRWDKYLHIYDPKIQWFSLINFSVIVLLLSSVAIHSLLRALKSDISRYNEFN 365
             SDT WATRWDKYLHIYDP+IQWFSLINFSVI++LLSSV +HSLLRAL SD+SRYNE N
Sbjct: 305 VASDTVWATRWDKYLHIYDPQIQWFSLINFSVIIVLLSSVVMHSLLRALNSDLSRYNELN 364

Query: 366 LGDEFEEDSGWKLVHGDVFRTPKNSMLLSVLVGSGXXXXXXXXXXXXXXXXXXXXXXXRG 425
           L +EF EDSGWKL HGDVFRTP  SMLLSVLVGSG                       RG
Sbjct: 365 LDNEFHEDSGWKLGHGDVFRTPTKSMLLSVLVGSGVQLFLMIICSIFLAALGLVSPVSRG 424

Query: 426 SLPTAMFMFYAIFGFVGSYTSMGIYKFFKGPYWKANMILTPVLLPGIIFLTVIFMNVLLY 485
           SLPT MF+FYA+FGFVGSYTSMG+YKFF GPYWKAN+ILTP+LLPG IF+ ++ MN  L 
Sbjct: 425 SLPTVMFVFYALFGFVGSYTSMGVYKFFHGPYWKANLILTPILLPGGIFVLIVAMNFFLL 484

Query: 486 FVGSSNVIPLATLVFMVFLWILFSIPLAFAGSLISYKKCNWDEHPTKTNEIPRQIPFQPW 545
           F  SS VIP +TL F++FLW   SIPL+FAGS+I++K CNWDEHPTKTN+I RQ+P+QPW
Sbjct: 485 FAHSSGVIPASTLFFIIFLWFAVSIPLSFAGSMIAHKWCNWDEHPTKTNQIARQVPYQPW 544

Query: 546 FLKTVPATLIGGLVSFGSIAVELYFIYSSLWFNKIFYMFGFLLFSIVLFSFTTGLINVII 605
           +L+T+ ATLI G+  FGSIAVELYFIYSSLWFNKIFYMFGFLLFS +L + TT L+ V+I
Sbjct: 545 YLRTIQATLIAGIFCFGSIAVELYFIYSSLWFNKIFYMFGFLLFSFLLLTLTTSLVTVLI 604

Query: 606 TYRALCSENWTWQWRSFFIGGLGCSIYIFIHSILFTQFKLGGFATIVLYVGYSFLISFLT 665
           TY +LC ENW WQWRSF IGGLGCS+Y+FIHSILFT+FKLGGF TIVLY GYSF+IS L 
Sbjct: 605 TYHSLCLENWQWQWRSFIIGGLGCSVYMFIHSILFTKFKLGGFITIVLYFGYSFIISALC 664

Query: 666 CIVTGAIGFICSMFFVRRIFASIKVD 691
           C+VTGAIGF   M F+R+I++++K++
Sbjct: 665 CVVTGAIGFFSCMLFIRKIYSAVKIE 690

>NCAS0B04970 Chr2 complement(909770..911770) [2001 bp, 666 aa] {ON} 
          Length = 666

 Score =  875 bits (2261), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 429/689 (62%), Positives = 517/689 (75%), Gaps = 27/689 (3%)

Query: 3   RQLLVLSLFVASTLGFYLPGAAPRTYKQGDAIPLLVNHLTPSLNFQHVDDDGNEIKGDKA 62
           R +L  + F++ T  FYLPG AP TY +GD IPLLVNHLTPS+ FQ  D +G     +K 
Sbjct: 5   RLVLFFTFFLSLTRAFYLPGVAPTTYHEGDEIPLLVNHLTPSVYFQRTDANGKS--KNKE 62

Query: 63  RMLYPYDYYNEKLHFCQPEKIEKQPESLGSVIFGEKIYNSPFNVKMLEDNECVQLCSTTI 122
             LY +DYY ++LHFC+PE IEKQPESLGS+IFG++IYNSPF +KMLE+  CV LC +TI
Sbjct: 63  HFLYSFDYYFDRLHFCKPEHIEKQPESLGSIIFGDRIYNSPFELKMLEEKTCVSLCKSTI 122

Query: 123 PGKDAKFINKLIKNGFMQNWLIDGLPAARKLHDSRTNTEFYGQGFELGFVEVRQAVGGKI 182
           PGKDAKFINKLIKNGF QNWLIDGLPAA +++D +T +EFYG GFELGFVE  QA+ G+ 
Sbjct: 123 PGKDAKFINKLIKNGFFQNWLIDGLPAATQVYDRKTKSEFYGTGFELGFVESFQAIDGQA 182

Query: 183 VSESEKELQLSERDAKNIIDFTDIEIRSPKNLVDLSNLEVREAKNVVDNIVTNVEVPVFA 242
            + ++ +   +E                         LE REAKNV   +V N+E+  F 
Sbjct: 183 PATTKPKQTTNEG----------------------LELETREAKNV--QMVKNIEIAYFV 218

Query: 243 NHFDIEVEYHDRGNGDFRVVGVIVNPVSLDNYKSRSCALANQHKLHLDENKDNEVMFTYS 302
           NH+DI+VEYHDRG G +RVVGVIVNPVS+      +C       L L E+ DN+V FTYS
Sbjct: 219 NHYDIQVEYHDRGEGTYRVVGVIVNPVSIKRSTPGTCETTGD-PLVLSEDADNDVYFTYS 277

Query: 303 VKFTPSDTPWATRWDKYLHIYDPKIQWFSLINFSVIVLLLSSVAIHSLLRALKSDISRYN 362
           VKF PS+T WATRWDKYLH YDP IQWFSL+NFS+IVLLLSSV IHSL++ALKSD +RYN
Sbjct: 278 VKFVPSETVWATRWDKYLHTYDPTIQWFSLVNFSIIVLLLSSVVIHSLMKALKSDFARYN 337

Query: 363 EFNLGDEFEEDSGWKLVHGDVFRTPKNSMLLSVLVGSGXXXXXXXXXXXXXXXXXXXXXX 422
           EFNL D+F+ED+GWKL HGDVFR P  SMLLSVLVGSG                      
Sbjct: 338 EFNLEDDFQEDAGWKLGHGDVFRIPHKSMLLSVLVGSGVQLFLMISCSIFFAALGFLSPS 397

Query: 423 XRGSLPTAMFMFYAIFGFVGSYTSMGIYKFFKGPYWKANMILTPVLLPGIIFLTVIFMNV 482
            RGSL T MF+ YA+FGFVGSYTSM +YKFFKGPYWK NM+LTP ++PG IFLT++ +N 
Sbjct: 398 SRGSLATVMFILYALFGFVGSYTSMAVYKFFKGPYWKVNMLLTPFMIPGFIFLTIVGLNF 457

Query: 483 LLYFVGSSNVIPLATLVFMVFLWILFSIPLAFAGSLISYKKCNWDEHPTKTNEIPRQIPF 542
            L F  SS V+P  TL FM+ LW +FSIPLAFAGSLI++KKC WDEHPTKTN+I RQIPF
Sbjct: 458 FLMFAHSSGVVPAGTLFFMILLWFIFSIPLAFAGSLIAHKKCTWDEHPTKTNQIARQIPF 517

Query: 543 QPWFLKTVPATLIGGLVSFGSIAVELYFIYSSLWFNKIFYMFGFLLFSIVLFSFTTGLIN 602
           QPW+LKT PAT+I G+  FGSIAVELYFIY+SLWFNKIFYMFGFLLFS +L + TT L+ 
Sbjct: 518 QPWYLKTWPATMIAGIFPFGSIAVELYFIYTSLWFNKIFYMFGFLLFSFLLLTLTTSLVT 577

Query: 603 VIITYRALCSENWTWQWRSFFIGGLGCSIYIFIHSILFTQFKLGGFATIVLYVGYSFLIS 662
           ++ITY +LC ENW WQWR F +GG+GC+IY+F+HSILFT+FKLGGFATIVLYVGYS +IS
Sbjct: 578 ILITYHSLCLENWQWQWRGFIVGGVGCAIYVFVHSILFTKFKLGGFATIVLYVGYSTMIS 637

Query: 663 FLTCIVTGAIGFICSMFFVRRIFASIKVD 691
            L C+VTGAIGF+ S+ FVR+I+++IKVD
Sbjct: 638 LLFCVVTGAIGFLSSLIFVRKIYSAIKVD 666

>YLR083C Chr12 complement(294091..296094) [2004 bp, 667 aa] {ON}
           EMP70Protein with a role in cellular adhesion,
           filamentous growth, and endosome-to-vacuole sorting;
           similar to Tmn2p and Tmn3p; member of Transmembrane Nine
           family of proteins with 9 transmembrane segments
          Length = 667

 Score =  874 bits (2257), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 436/688 (63%), Positives = 515/688 (74%), Gaps = 29/688 (4%)

Query: 4   QLLVLSLFVASTLGFYLPGAAPRTYKQGDAIPLLVNHLTPSLNFQHVDDDGNEIKGDKAR 63
           QLL+L  FV++   FYLPG AP TY++ D IPLLVNHLTPS+N+QH D+DGN + GDK  
Sbjct: 9   QLLLLYFFVSTVKAFYLPGVAPTTYRENDNIPLLVNHLTPSMNYQHKDEDGNNVSGDKEN 68

Query: 64  MLYPYDYYNEKLHFCQPEKIEKQPESLGSVIFGEKIYNSPFNVKMLEDNECVQLCSTTIP 123
            LY YDYY  + HFCQPEK+EKQPESLGSVIFG++IYNSPF + ML++ EC  LC T IP
Sbjct: 69  FLYSYDYYYNRFHFCQPEKVEKQPESLGSVIFGDRIYNSPFQLNMLQEKECESLCKTVIP 128

Query: 124 GKDAKFINKLIKNGFMQNWLIDGLPAARKLHDSRTNTEFYGQGFELGFVEVRQAVGGKIV 183
           G DAKFINKLIKNGF QNWLIDGLPAAR+++D RT T FYG GF LGFV+V Q   G  +
Sbjct: 129 GDDAKFINKLIKNGFFQNWLIDGLPAAREVYDGRTKTSFYGAGFNLGFVQVTQ---GTDI 185

Query: 184 SESEKELQLSERDAKNIIDFTDIEIRSPKNLVDLSNLEVREAKNVVDNIVTNVEVPVFAN 243
             + K  + +++D +                     LE R  +N    +V   E+P FAN
Sbjct: 186 EATPKGAETTDKDVE---------------------LETRNDRN----MVKTYELPYFAN 220

Query: 244 HFDIEVEYHDRGNGDFRVVGVIVNPVSLDNYKSRSCALANQHKLHLDENKDNEVMFTYSV 303
           HFDI +EYHDRG G++RVVGVIV PVS+      +C       L LDE  DNEV FTYSV
Sbjct: 221 HFDIMIEYHDRGEGNYRVVGVIVEPVSIKRSSPGTCETTGS-PLMLDEGNDNEVYFTYSV 279

Query: 304 KFTPSDTPWATRWDKYLHIYDPKIQWFSLINFSVIVLLLSSVAIHSLLRALKSDISRYNE 363
           KF  S T WATRWDKYLH+YDP IQWFSLINFS++V+LLSSV IHSLLRALKSD +RYNE
Sbjct: 280 KFNESATSWATRWDKYLHVYDPSIQWFSLINFSLVVVLLSSVVIHSLLRALKSDFARYNE 339

Query: 364 FNLGDEFEEDSGWKLVHGDVFRTPKNSMLLSVLVGSGXXXXXXXXXXXXXXXXXXXXXXX 423
            NL D+F+EDSGWKL HGDVFR+P  S+ LS+LVGSG                       
Sbjct: 340 LNLDDDFQEDSGWKLNHGDVFRSPSQSLTLSILVGSGVQLFLMVTCSIFFAALGFLSPSS 399

Query: 424 RGSLPTAMFMFYAIFGFVGSYTSMGIYKFFKGPYWKANMILTPVLLPGIIFLTVIFMNVL 483
           RGSL T MF+ YA+FGFVGSYTSMGIYKFF GPYWKAN+ILTP+L+PG I L +I +N  
Sbjct: 400 RGSLATVMFILYALFGFVGSYTSMGIYKFFNGPYWKANLILTPLLVPGAILLIIIALNFF 459

Query: 484 LYFVGSSNVIPLATLVFMVFLWILFSIPLAFAGSLISYKKCNWDEHPTKTNEIPRQIPFQ 543
           L FV SS VIP +TL FMVFLW LFSIPL+FAGSLI+ K+C+WDEHPTKTN+I RQIPFQ
Sbjct: 460 LMFVHSSGVIPASTLFFMVFLWFLFSIPLSFAGSLIARKRCHWDEHPTKTNQIARQIPFQ 519

Query: 544 PWFLKTVPATLIGGLVSFGSIAVELYFIYSSLWFNKIFYMFGFLLFSIVLFSFTTGLINV 603
           PW+LKT+PATLI G+  FGSIAVELYFIY+SLWFNKIFYMFGFL FS +L + T+ L+ +
Sbjct: 520 PWYLKTIPATLIAGIFPFGSIAVELYFIYTSLWFNKIFYMFGFLFFSFLLLTLTSSLVTI 579

Query: 604 IITYRALCSENWTWQWRSFFIGGLGCSIYIFIHSILFTQFKLGGFATIVLYVGYSFLISF 663
           +ITY +LC ENW WQWR F IGG GC++Y+FIHSILFT+FKLGGF TIVLYVGYS +IS 
Sbjct: 580 LITYHSLCLENWKWQWRGFIIGGAGCALYVFIHSILFTKFKLGGFTTIVLYVGYSSVISL 639

Query: 664 LTCIVTGAIGFICSMFFVRRIFASIKVD 691
           L C+VTG+IGFI SM FVR+I++SIKVD
Sbjct: 640 LCCLVTGSIGFISSMLFVRKIYSSIKVD 667

>Suva_10.167 Chr10 complement(299075..301129) [2055 bp, 684 aa] {ON}
           YLR083C (REAL)
          Length = 684

 Score =  874 bits (2258), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 438/688 (63%), Positives = 526/688 (76%), Gaps = 8/688 (1%)

Query: 4   QLLVLSLFVASTLGFYLPGAAPRTYKQGDAIPLLVNHLTPSLNFQHVDDDGNEIKGDKAR 63
           QL +L   V++   FYLPG AP TYK+ D IPLLVNHLTPS+ +QH D+DGN + GDK  
Sbjct: 5   QLFLLYFIVSAARAFYLPGVAPTTYKENDEIPLLVNHLTPSMYYQHQDEDGNNVSGDKEH 64

Query: 64  MLYPYDYYNEKLHFCQPEKIEKQPESLGSVIFGEKIYNSPFNVKMLEDNECVQLCSTTIP 123
            LY YDYY +K HFC+PE +EKQPESLGS+IFG++IYNSPF + ML++ ECV LC T IP
Sbjct: 65  FLYSYDYYYDKFHFCKPEHVEKQPESLGSIIFGDRIYNSPFELNMLQEKECVSLCKTVIP 124

Query: 124 GKDAKFINKLIKNGFMQNWLIDGLPAARKLHDSRTNTEFYGQGFELGFVEVRQAVGGKIV 183
           G DAKFINKLIKNGF QNWLIDGLPAAR++HD RT T+FYG GF LGFVEV Q V     
Sbjct: 125 GDDAKFINKLIKNGFFQNWLIDGLPAAREVHDGRTKTDFYGAGFGLGFVEVAQVVD---- 180

Query: 184 SESEKELQLSERDAKNIIDFTDIEIRSPKNLVDLSNLEVREAKNVVDNIVTNVEVPVFAN 243
           SE+E ++Q++  + +      D +    K       +E+ +A++   N+V   E P FAN
Sbjct: 181 SETE-QVQVASGETEQT-QAADGKTEPEKGKSSNEGMEL-DARDQGKNMVKTREFPYFAN 237

Query: 244 HFDIEVEYHDRGNGDFRVVGVIVNPVSLDNYKSRSCALANQHKLHLDENKDNEVMFTYSV 303
           HFDI++EYHDRG G++RVVGVIVNP+S+      +C   N   L LDE  DNEV FTYSV
Sbjct: 238 HFDIKIEYHDRGEGNYRVVGVIVNPLSIKRSSPGTCE-TNGSPLVLDEANDNEVYFTYSV 296

Query: 304 KFTPSDTPWATRWDKYLHIYDPKIQWFSLINFSVIVLLLSSVAIHSLLRALKSDISRYNE 363
           KF  S T WATRWDKYLH+YDP IQWFSLINFS++V+LLSSV IHSLLRALKSD +RYNE
Sbjct: 297 KFEESPTSWATRWDKYLHVYDPSIQWFSLINFSLVVVLLSSVVIHSLLRALKSDFARYNE 356

Query: 364 FNLGDEFEEDSGWKLVHGDVFRTPKNSMLLSVLVGSGXXXXXXXXXXXXXXXXXXXXXXX 423
            NL D+F+EDSGWKL HGDVFR P  S++LS+LVGSG                       
Sbjct: 357 LNLDDDFQEDSGWKLNHGDVFRPPSQSLMLSILVGSGVQIFLMVTCSIFFAALGFLSPSS 416

Query: 424 RGSLPTAMFMFYAIFGFVGSYTSMGIYKFFKGPYWKANMILTPVLLPGIIFLTVIFMNVL 483
           RGSL T MF+ YA+FGFVGSYTSMGIYKFF GPYWKAN+I+TP+L+PG I L +I +N  
Sbjct: 417 RGSLATVMFILYALFGFVGSYTSMGIYKFFDGPYWKANVIMTPLLIPGAILLVIIALNFF 476

Query: 484 LYFVGSSNVIPLATLVFMVFLWILFSIPLAFAGSLISYKKCNWDEHPTKTNEIPRQIPFQ 543
           L FV SS VIP +TL FMVFLW LFSIPL+FAGSL++ KKC+WDEHPTKTN+I RQIPFQ
Sbjct: 477 LMFVHSSGVIPASTLFFMVFLWFLFSIPLSFAGSLVARKKCHWDEHPTKTNQIARQIPFQ 536

Query: 544 PWFLKTVPATLIGGLVSFGSIAVELYFIYSSLWFNKIFYMFGFLLFSIVLFSFTTGLINV 603
           PW+LKT+PATLI G+  FGSIAVELYFIY+SLWFNKIFYMFGFL FS +L + TT L+ V
Sbjct: 537 PWYLKTLPATLIAGIFPFGSIAVELYFIYTSLWFNKIFYMFGFLFFSFLLLTLTTSLVTV 596

Query: 604 IITYRALCSENWTWQWRSFFIGGLGCSIYIFIHSILFTQFKLGGFATIVLYVGYSFLISF 663
           +ITY +LC ENW WQWR F +GG+GC++Y+FIHSILFT+FKLGGF TIVLY+GYS +IS 
Sbjct: 597 MITYHSLCLENWKWQWRGFTVGGVGCALYVFIHSILFTKFKLGGFTTIVLYLGYSSVISL 656

Query: 664 LTCIVTGAIGFICSMFFVRRIFASIKVD 691
           L C+VTG+IGFI SMFF+R+I++SIKVD
Sbjct: 657 LCCLVTGSIGFISSMFFIRKIYSSIKVD 684

>Smik_12.142 Chr12 complement(273932..275923) [1992 bp, 663 aa] {ON}
           YLR083C (REAL)
          Length = 663

 Score =  870 bits (2247), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 433/680 (63%), Positives = 508/680 (74%), Gaps = 29/680 (4%)

Query: 12  VASTLGFYLPGAAPRTYKQGDAIPLLVNHLTPSLNFQHVDDDGNEIKGDKARMLYPYDYY 71
           V++   FYLPG AP TYK+ D IPLLVNHLTPS+ +QH D++GN + GDK   LY YDYY
Sbjct: 13  VSTAKAFYLPGVAPTTYKENDEIPLLVNHLTPSMYYQHKDEEGNNVSGDKENFLYSYDYY 72

Query: 72  NEKLHFCQPEKIEKQPESLGSVIFGEKIYNSPFNVKMLEDNECVQLCSTTIPGKDAKFIN 131
           N + HFC+PEK+EKQPESLGS+IFG++IYNSPF +KMLE+ ECV LC  TIPG DAKFIN
Sbjct: 73  NSRFHFCKPEKVEKQPESLGSIIFGDRIYNSPFQLKMLEEKECVSLCKKTIPGNDAKFIN 132

Query: 132 KLIKNGFMQNWLIDGLPAARKLHDSRTNTEFYGQGFELGFVEVRQAVGGKIVSESEKELQ 191
           KLIKNGF QNWLIDGLPAAR + D RT T FYG GFELGFVEV Q       + SE    
Sbjct: 133 KLIKNGFFQNWLIDGLPAARNVSDKRTKTSFYGAGFELGFVEVTQG------TASEATPN 186

Query: 192 LSERDAKNIIDFTDIEIRSPKNLVDLSNLEVREAKNVVDNIVTNVEVPVFANHFDIEVEY 251
            +E   + +                   L+ R+  N+V       E P F NH+DI +EY
Sbjct: 187 TAETTNQGV------------------ELDTRDGHNMVQT----YEHPYFTNHYDIRIEY 224

Query: 252 HDRGNGDFRVVGVIVNPVSLDNYKSRSCALANQHKLHLDENKDNEVMFTYSVKFTPSDTP 311
           HDRG G++RVVGVIVNPVS+      +C   +   L LDE  DNEV FTYSVKF  S+T 
Sbjct: 225 HDRGEGNYRVVGVIVNPVSIKRSDPETCE-TDGSPLMLDEENDNEVYFTYSVKFVESETS 283

Query: 312 WATRWDKYLHIYDPKIQWFSLINFSVIVLLLSSVAIHSLLRALKSDISRYNEFNLGDEFE 371
           WATRWDKYLH+YDP IQWFSLINFS++V+LLSSV IHSLLRALKSD +RYNE NL D+F+
Sbjct: 284 WATRWDKYLHVYDPSIQWFSLINFSLVVVLLSSVVIHSLLRALKSDFARYNELNLDDDFQ 343

Query: 372 EDSGWKLVHGDVFRTPKNSMLLSVLVGSGXXXXXXXXXXXXXXXXXXXXXXXRGSLPTAM 431
           EDSGWKL HGDVFR P  S+ LS+LVGSG                       RGSL T M
Sbjct: 344 EDSGWKLSHGDVFRAPSRSLTLSILVGSGVQLFFMVTCSIFFAALGFLSPSSRGSLATVM 403

Query: 432 FMFYAIFGFVGSYTSMGIYKFFKGPYWKANMILTPVLLPGIIFLTVIFMNVLLYFVGSSN 491
           FM YA+FGFVGSYTSMGIYKFF GPYWKAN+ILTP+L+PG I + +I +N  L FV SS 
Sbjct: 404 FMLYALFGFVGSYTSMGIYKFFDGPYWKANLILTPLLVPGTILIIIIALNFFLMFVHSSG 463

Query: 492 VIPLATLVFMVFLWILFSIPLAFAGSLISYKKCNWDEHPTKTNEIPRQIPFQPWFLKTVP 551
           VIP +TL FMVFLW LFSIPL+FAGSL++ KKC+WDEHPTKTN+I RQIPFQPW+LKTVP
Sbjct: 464 VIPASTLFFMVFLWFLFSIPLSFAGSLVARKKCHWDEHPTKTNQIARQIPFQPWYLKTVP 523

Query: 552 ATLIGGLVSFGSIAVELYFIYSSLWFNKIFYMFGFLLFSIVLFSFTTGLINVIITYRALC 611
           ATLI G+  FGSIAVELYFIY+SLWFNKIFYMFGFL FS +L + TT L+ ++ITY +LC
Sbjct: 524 ATLIAGVFPFGSIAVELYFIYTSLWFNKIFYMFGFLFFSFLLLTLTTSLVTILITYHSLC 583

Query: 612 SENWTWQWRSFFIGGLGCSIYIFIHSILFTQFKLGGFATIVLYVGYSFLISFLTCIVTGA 671
            ENW WQWR F +GG GC++Y+FIHSILFT+FKLGGF TIVLYVGYS +IS L C+VTG+
Sbjct: 584 LENWKWQWRGFIVGGAGCALYVFIHSILFTKFKLGGFTTIVLYVGYSSVISLLCCLVTGS 643

Query: 672 IGFICSMFFVRRIFASIKVD 691
           IGFI SMFF+R+I++SIKVD
Sbjct: 644 IGFISSMFFIRKIYSSIKVD 663

>NDAI0B02370 Chr2 complement(593012..595180) [2169 bp, 722 aa] {ON}
           Anc_8.254
          Length = 722

 Score =  872 bits (2252), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 441/687 (64%), Positives = 521/687 (75%), Gaps = 24/687 (3%)

Query: 5   LLVLSLFVASTLGFYLPGAAPRTYKQGDAIPLLVNHLTPSLNFQHVDDDGNEIKGDKARM 64
           +L+ +  ++ T  FYLPG AP TY   D IPLLVNHLTPS+ FQH ++DG  +K DK R 
Sbjct: 60  VLLFAFCLSLTRAFYLPGVAPTTYHPDDEIPLLVNHLTPSMYFQHKNEDGKTMKSDKERF 119

Query: 65  LYPYDYYNEKLHFCQPEKIEKQPESLGSVIFGEKIYNSPFNVKMLEDNECVQLCSTTIPG 124
           LY YDYY ++ HFCQPE IEKQPESLGS+IFG++IYNSPF + ML+D  CV LC TTIPG
Sbjct: 120 LYSYDYYYDRFHFCQPEHIEKQPESLGSIIFGDRIYNSPFQINMLQDKTCVSLCKTTIPG 179

Query: 125 KDAKFINKLIKNGFMQNWLIDGLPAARKLHDSRTNTEFYGQGFELGFVEVRQAVGGKIVS 184
           KDAKFINKLIKNGF QNWLIDGLPAAR+++DSRT TEFYG GFELGFV+V Q        
Sbjct: 180 KDAKFINKLIKNGFFQNWLIDGLPAARQVYDSRTKTEFYGTGFELGFVDVVQGT------ 233

Query: 185 ESEKELQLSERDAKNIIDFTDIEIRSPKNLVDLSNLEVREAKNVVDNIVTNVEVPVFANH 244
                   +  D  N +       + P     L  L+ R+AKNV   ++ N E+P FANH
Sbjct: 234 --------TTGDNANTVA------KKPTTNEGL-ELDTRDAKNV--QMLKNFELPYFANH 276

Query: 245 FDIEVEYHDRGNGDFRVVGVIVNPVSLDNYKSRSCALANQHKLHLDENKDNEVMFTYSVK 304
           FDI+VEYHDRG  ++RVVGVIVNPVS+      +C  +    L L E++DN+V FTYSVK
Sbjct: 277 FDIQVEYHDRGENNYRVVGVIVNPVSIKRSTPGTCETSGA-PLMLSEDQDNDVYFTYSVK 335

Query: 305 FTPSDTPWATRWDKYLHIYDPKIQWFSLINFSVIVLLLSSVAIHSLLRALKSDISRYNEF 364
           F PS+T WATRWDKYLHIYDP IQWFSLINFSV+VLLLSSV IHSLL+ALKSD +RYNE 
Sbjct: 336 FIPSETIWATRWDKYLHIYDPAIQWFSLINFSVVVLLLSSVVIHSLLKALKSDFARYNEL 395

Query: 365 NLGDEFEEDSGWKLVHGDVFRTPKNSMLLSVLVGSGXXXXXXXXXXXXXXXXXXXXXXXR 424
           NL D+F+E++GWKL HGDVFR P  S+LLSVLVGSG                       R
Sbjct: 396 NLDDDFQEEAGWKLGHGDVFRIPHRSLLLSVLVGSGVQLFLMIICSIFFAALGFLSPSSR 455

Query: 425 GSLPTAMFMFYAIFGFVGSYTSMGIYKFFKGPYWKANMILTPVLLPGIIFLTVIFMNVLL 484
           GSL T MF+ YA+FGFVGSYTSMG+YKFF GPYWK NM+LTP+L+PG+IF  ++ +N+ L
Sbjct: 456 GSLATVMFILYALFGFVGSYTSMGVYKFFGGPYWKVNMLLTPILVPGLIFCGIVALNIFL 515

Query: 485 YFVGSSNVIPLATLVFMVFLWILFSIPLAFAGSLISYKKCNWDEHPTKTNEIPRQIPFQP 544
            FV SS VIP  TL FM+ LW +FSIPLA AGSLI++KKCNWDEHPTKTN+I RQIPFQP
Sbjct: 516 LFVHSSGVIPAVTLFFMILLWFVFSIPLALAGSLIAHKKCNWDEHPTKTNQIARQIPFQP 575

Query: 545 WFLKTVPATLIGGLVSFGSIAVELYFIYSSLWFNKIFYMFGFLLFSIVLFSFTTGLINVI 604
           W+LKT PATLI G+  FGSIAVELYFIYSSLWFNKIFYMFGFLLFS  L + TT L+ ++
Sbjct: 576 WYLKTWPATLIAGIFPFGSIAVELYFIYSSLWFNKIFYMFGFLLFSFFLLTLTTSLVTIL 635

Query: 605 ITYRALCSENWTWQWRSFFIGGLGCSIYIFIHSILFTQFKLGGFATIVLYVGYSFLISFL 664
           ITY +LC ENW WQWR F IGG+GC+IY+FIHSILFT+FKLGGF TIVLYVGYS +IS L
Sbjct: 636 ITYHSLCLENWMWQWRGFIIGGVGCAIYVFIHSILFTKFKLGGFTTIVLYVGYSTIISLL 695

Query: 665 TCIVTGAIGFICSMFFVRRIFASIKVD 691
            CIVTGAIGF+ SMFF+R+I++SIKV+
Sbjct: 696 FCIVTGAIGFLSSMFFIRKIYSSIKVE 722

>Kpol_543.35 s543 complement(78246..80222) [1977 bp, 658 aa] {ON}
           complement(78246..80222) [1977 nt, 659 aa]
          Length = 658

 Score =  864 bits (2233), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 426/685 (62%), Positives = 510/685 (74%), Gaps = 35/685 (5%)

Query: 7   VLSLFVASTLGFYLPGAAPRTYKQGDAIPLLVNHLTPSLNFQHVDDDGNEIKGDKARMLY 66
           +LS+++A T  FYLPG AP TY +GD IPLLVNHLTPSLNFQH DD GN+IKG+K   LY
Sbjct: 9   LLSVYLALTSAFYLPGVAPTTYGKGDEIPLLVNHLTPSLNFQHKDDQGNDIKGNKEHFLY 68

Query: 67  PYDYYNEKLHFCQPEKIEKQPESLGSVIFGEKIYNSPFNVKMLEDNECVQLCSTTIPGKD 126
            +DYY  KLHFC+PE +EKQPESLGS++FG++IYNSPF++KMLE+ EC  LC  TIP  D
Sbjct: 69  SFDYYFPKLHFCKPEHVEKQPESLGSILFGDRIYNSPFSIKMLENQECTSLCKVTIPADD 128

Query: 127 AKFINKLIKNGFMQNWLIDGLPAARKLHDSRTNTEFYGQGFELGFVEVRQAVGGKIVSES 186
           AKFINKLIKNGF QNWLIDGLPAARKLHD +T ++FYG GF LG V VRQAVGG  ++ S
Sbjct: 129 AKFINKLIKNGFFQNWLIDGLPAARKLHDVKTKSDFYGTGFPLGNVHVRQAVGG--LASS 186

Query: 187 EKELQLSERDAKNIIDFTDIEIRSPKNLVDLSNLEVREAKNVVDNIVTNVEVPVFANHFD 246
           +  L+   R+AKN                             V+N+V NVE+P   NH+D
Sbjct: 187 KLNLENPAREAKN-----------------------------VNNMVHNVEIPFLFNHYD 217

Query: 247 IEVEYHDRGNGDFRVVGVIVNPVSLDNYKSRSCALANQHKLHLDENKDNEVMFTYSVKFT 306
           I VEYHDRG G++RVVGV V+P S     +          L L E +DNEV F+YSV+F 
Sbjct: 218 INVEYHDRGEGNYRVVGVTVDPKS----STGDICTKKSGGLILLETEDNEVQFSYSVRFI 273

Query: 307 PSDTPWATRWDKYLHIYDPKIQWFSLINFSVIVLLLSSVAIHSLLRALKSDISRYNEFNL 366
           PS+T WATRWDKYLH+YDP IQWFSLINFSV+V+LLS V IHSL+RALKSD +RY EFNL
Sbjct: 274 PSETVWATRWDKYLHVYDPTIQWFSLINFSVVVILLSMVVIHSLMRALKSDFARYEEFNL 333

Query: 367 GDEFEEDSGWKLVHGDVFRTPKNSMLLSVLVGSGXXXXXXXXXXXXXXXXXXXXXXXRGS 426
            D F++DSGWKL HGDVFR P  SMLLS+LVGSG                       RGS
Sbjct: 334 DDTFQQDSGWKLGHGDVFRIPDKSMLLSILVGSGTQLFLMVAVSIFFAAIGILSPSSRGS 393

Query: 427 LPTAMFMFYAIFGFVGSYTSMGIYKFFKGPYWKANMILTPVLLPGIIFLTVIFMNVLLYF 486
           LP+AMF+ YA+FGF GSY SMG+YKFF GPYWKANMILTP+L+PG++F++++ +N  L F
Sbjct: 394 LPSAMFILYALFGFCGSYVSMGVYKFFNGPYWKANMILTPILVPGLLFISIVGLNFFLLF 453

Query: 487 VGSSNVIPLATLVFMVFLWILFSIPLAFAGSLISYKKCNWDEHPTKTNEIPRQIPFQPWF 546
             SS  IP   L+F++ LW + SIPL+ AGSLI+ KKCNW EHPTKTNEI RQIPFQPW+
Sbjct: 454 SRSSGTIPPTALIFVIVLWFIISIPLSLAGSLIANKKCNWGEHPTKTNEIARQIPFQPWY 513

Query: 547 LKTVPATLIGGLVSFGSIAVELYFIYSSLWFNKIFYMFGFLLFSIVLFSFTTGLINVIIT 606
           LKTVPATLI GL  FGSIAVELYFIYSSLWFNKIFYMFGFL  S +L + TT L+ ++IT
Sbjct: 514 LKTVPATLIAGLFPFGSIAVELYFIYSSLWFNKIFYMFGFLFVSFLLLTLTTTLVTILIT 573

Query: 607 YRALCSENWTWQWRSFFIGGLGCSIYIFIHSILFTQFKLGGFATIVLYVGYSFLISFLTC 666
           Y +L  ENW WQWRSF +GG+GC+ YIF+HSI+FT+FKLGGF TIVLYVGYS +IS L  
Sbjct: 574 YYSLNLENWRWQWRSFIVGGVGCAFYIFVHSIIFTKFKLGGFTTIVLYVGYSLIISALCA 633

Query: 667 IVTGAIGFICSMFFVRRIFASIKVD 691
           +VTGAIGFI SM FV++I++S+KVD
Sbjct: 634 VVTGAIGFISSMLFVKKIYSSVKVD 658

>Skud_12.151 Chr12 complement(277467..279461) [1995 bp, 664 aa] {ON}
           YLR083C (REAL)
          Length = 664

 Score =  863 bits (2231), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 435/689 (63%), Positives = 515/689 (74%), Gaps = 30/689 (4%)

Query: 4   QLLVLSLFVASTLGFYLPGAAPRTYKQGDAIPLLVNHLTPSLNFQHVDDDGNEIKGDKAR 63
           QLL+L  FV++T  FYLPG AP TYK+ D IPLLVNHLTPS+ +QH D+ GN + GDK  
Sbjct: 5   QLLLLYFFVSATKAFYLPGVAPTTYKENDEIPLLVNHLTPSMYYQHEDEQGNSVSGDKEN 64

Query: 64  MLYPYDYYNEKLHFCQPEKIEKQPESLGSVIFGEKIYNSPFNVKMLEDNECVQLCSTTIP 123
            LY YDYY ++ HFC+P+ +EKQPESLGSVIFG++IYNSPF + ML++ ECV LC+TTIP
Sbjct: 65  FLYSYDYYYDRFHFCRPKHVEKQPESLGSVIFGDRIYNSPFELNMLQEKECVPLCNTTIP 124

Query: 124 GKDAKFINKLIKNGFMQNWLIDGLPAARKLHDSRTNTEFYGQGFELGFVEVRQAVGGKIV 183
           G DAKFINKLIKNGF QNWLIDGLPAAR+++D RT T FYG GFELG VEV Q    K  
Sbjct: 125 GNDAKFINKLIKNGFFQNWLIDGLPAAREVYDGRTKTNFYGAGFELGDVEVSQGTRSKT- 183

Query: 184 SESEKELQLSERDAKNIIDFTDIEIRSPKNLVDLSNLEVREAKNVVD-NIVTNVEVPVFA 242
                                     +PK   + +N  +       D +IV   E P FA
Sbjct: 184 --------------------------APKQ-AETTNEGLELGTRAEDYSIVETFEHPYFA 216

Query: 243 NHFDIEVEYHDRGNGDFRVVGVIVNPVSLDNYKSRSCALANQHKLHLDENKDNEVMFTYS 302
           NHFDI +EYHDRG GD+RVVGVIVNP+S+    + +C   +   L LDE +DNEV FTYS
Sbjct: 217 NHFDIMIEYHDRGGGDYRVVGVIVNPLSIKRSITGTCE-TDASPLILDEERDNEVSFTYS 275

Query: 303 VKFTPSDTPWATRWDKYLHIYDPKIQWFSLINFSVIVLLLSSVAIHSLLRALKSDISRYN 362
           VKF  S T WATRWDKYLH+YDP IQWFSLINFS++V+LLSSV IHSLLRALKSD +RYN
Sbjct: 276 VKFKESATSWATRWDKYLHVYDPSIQWFSLINFSLVVVLLSSVVIHSLLRALKSDFARYN 335

Query: 363 EFNLGDEFEEDSGWKLVHGDVFRTPKNSMLLSVLVGSGXXXXXXXXXXXXXXXXXXXXXX 422
           E NL D+F+EDSGWKL HGDVFR P +S+LLS+LVGSG                      
Sbjct: 336 ELNLEDDFQEDSGWKLNHGDVFRPPSHSLLLSILVGSGVQLFLMVTCSIFFAALGFLSPS 395

Query: 423 XRGSLPTAMFMFYAIFGFVGSYTSMGIYKFFKGPYWKANMILTPVLLPGIIFLTVIFMNV 482
            RGSL T MF+ YA+FGFVGSYTSMGIYKFF GPYWKAN++LTP+L+PG I L ++ +N 
Sbjct: 396 SRGSLATVMFILYALFGFVGSYTSMGIYKFFNGPYWKANLLLTPLLVPGAILLIIVALNF 455

Query: 483 LLYFVGSSNVIPLATLVFMVFLWILFSIPLAFAGSLISYKKCNWDEHPTKTNEIPRQIPF 542
            L  V SS VIP  TL FMVFLW LFSIPL+F GSLI+ KKC WDEHPTKTN+I RQIPF
Sbjct: 456 FLMVVHSSGVIPARTLFFMVFLWFLFSIPLSFGGSLIARKKCGWDEHPTKTNQIARQIPF 515

Query: 543 QPWFLKTVPATLIGGLVSFGSIAVELYFIYSSLWFNKIFYMFGFLLFSIVLFSFTTGLIN 602
           QPW+LKT+PATLI G+  FGSIAVELYFIY+SLWFNKIFYMFGFL FS +L + TT L+ 
Sbjct: 516 QPWYLKTIPATLIAGIFPFGSIAVELYFIYTSLWFNKIFYMFGFLFFSFLLLTLTTSLVT 575

Query: 603 VIITYRALCSENWTWQWRSFFIGGLGCSIYIFIHSILFTQFKLGGFATIVLYVGYSFLIS 662
           ++ITY +LC ENW WQWR F +GG+GC++Y+FIHSILFT+FKLGGF TIVLYVGYS++IS
Sbjct: 576 ILITYHSLCLENWKWQWRGFIVGGVGCALYVFIHSILFTKFKLGGFVTIVLYVGYSYVIS 635

Query: 663 FLTCIVTGAIGFICSMFFVRRIFASIKVD 691
            L C+VTG+IGFI SMFF+RRI++SIKVD
Sbjct: 636 LLCCLVTGSIGFISSMFFLRRIYSSIKVD 664

>KAFR0B02680 Chr2 complement(537048..539042) [1995 bp, 664 aa] {ON}
           Anc_8.254 YLR083C
          Length = 664

 Score =  862 bits (2227), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 434/691 (62%), Positives = 527/691 (76%), Gaps = 27/691 (3%)

Query: 1   MVRQLLVLSLFVASTLGFYLPGAAPRTYKQGDAIPLLVNHLTPSLNFQHVDDDGNEIKGD 60
           M R LL++SLF++ T  FYLPG AP TY +GD IPLLVNHL+PS+ +QH +D+G ++  D
Sbjct: 1   MTRLLLLISLFLSLTRAFYLPGVAPTTYHEGDEIPLLVNHLSPSMYWQHKNDEGKDVSSD 60

Query: 61  KARMLYPYDYYNEKLHFCQPEKIEKQPESLGSVIFGEKIYNSPFNVKMLEDNECVQLCST 120
           K + LY YDYY ++ HFCQPEKIEKQPESLGS++FG++IYNSPF + MLE+ +C  LC +
Sbjct: 61  KNKYLYSYDYYYDRFHFCQPEKIEKQPESLGSIMFGDRIYNSPFQLNMLEEKQCASLCKS 120

Query: 121 TIPGKDAKFINKLIKNGFMQNWLIDGLPAARKLHDSRTNTEFYGQGFELGFVEVRQAVGG 180
           TIPG DAKFINKLIKNGF QNWLIDGLPAA + HD+RT T+FYG GFELG V+V QAV  
Sbjct: 121 TIPGNDAKFINKLIKNGFFQNWLIDGLPAAHEAHDTRTGTDFYGSGFELGLVDVVQAV-- 178

Query: 181 KIVSESEKELQLSERDAKNIIDFTDIEIRSPKNLVDLSNLEVREAKNVVDNIVTNVEVPV 240
               E+E   +++  +                     + L+ R+AKNV    + NVE+  
Sbjct: 179 ---DETEARTKVAAANQG-------------------AELDARDAKNV--KTIKNVELVY 214

Query: 241 FANHFDIEVEYHDRGNGDFRVVGVIVNPVSLDNYKSRSCALANQHKLHLDENKDNEVMFT 300
           F NH+DI +EYHDRGNGD+RVVGVIVNPVS+      SC    Q  L L E++DN+V FT
Sbjct: 215 FVNHYDIRIEYHDRGNGDYRVVGVIVNPVSIQRSSPGSCESTGQ-PLTLQEDEDNDVYFT 273

Query: 301 YSVKFTPSDTPWATRWDKYLHIYDPKIQWFSLINFSVIVLLLSSVAIHSLLRALKSDISR 360
           YSV F PS+T WATRWDKYLH+YDP IQWFSL+NFS+IVLLLS+V +HSLL+ALK+D +R
Sbjct: 274 YSVTFVPSETSWATRWDKYLHVYDPTIQWFSLVNFSLIVLLLSTVVLHSLLKALKNDFAR 333

Query: 361 YNEFNLGDEFEEDSGWKLVHGDVFRTPKNSMLLSVLVGSGXXXXXXXXXXXXXXXXXXXX 420
           YNEFNL DEF+ED+GWKL HGDVFR P  SMLLSVLVGSG                    
Sbjct: 334 YNEFNLDDEFQEDAGWKLCHGDVFRIPHKSMLLSVLVGSGVQLFIMISTTIFFAALGFLS 393

Query: 421 XXXRGSLPTAMFMFYAIFGFVGSYTSMGIYKFFKGPYWKANMILTPVLLPGIIFLTVIFM 480
              RG L T MFM YA+FGFVGSYTSMG+YKFF+GPYWKANM+LTP+L+PG IF+T+I M
Sbjct: 394 PSSRGLLGTVMFMLYALFGFVGSYTSMGVYKFFRGPYWKANMVLTPILVPGSIFITIIAM 453

Query: 481 NVLLYFVGSSNVIPLATLVFMVFLWILFSIPLAFAGSLISYKKCNWDEHPTKTNEIPRQI 540
           N  L +V SS VIP  TL FMV LW +FSIP AFAGSL++ KKCNW+EHPTKT +I RQI
Sbjct: 454 NFFLMYVHSSGVIPAKTLFFMVLLWFVFSIPSAFAGSLVANKKCNWNEHPTKTEQIARQI 513

Query: 541 PFQPWFLKTVPATLIGGLVSFGSIAVELYFIYSSLWFNKIFYMFGFLLFSIVLFSFTTGL 600
           PFQPW+LKT+PAT I G+  FGSIAVE+YFIY+SLW+NKIFYMFGFL  S++L + TT L
Sbjct: 514 PFQPWYLKTIPATFIAGIFPFGSIAVEIYFIYTSLWYNKIFYMFGFLFVSLLLLALTTSL 573

Query: 601 INVIITYRALCSENWTWQWRSFFIGGLGCSIYIFIHSILFTQFKLGGFATIVLYVGYSFL 660
           + V+ITY +LC ENW WQWRSF +GG+GC+IY+FIHSILFT+FKLGGF T+VLY+GYS +
Sbjct: 574 VTVLITYHSLCLENWNWQWRSFIVGGVGCAIYVFIHSILFTKFKLGGFTTVVLYLGYSSI 633

Query: 661 ISFLTCIVTGAIGFICSMFFVRRIFASIKVD 691
           IS L CIVTG+IGF+ SMFFVR+IF+SIKVD
Sbjct: 634 ISLLCCIVTGSIGFLSSMFFVRKIFSSIKVD 664

>Skud_4.368 Chr4 complement(640627..642645) [2019 bp, 672 aa] {ON}
           YDR107C (REAL)
          Length = 672

 Score =  862 bits (2227), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 417/686 (60%), Positives = 511/686 (74%), Gaps = 20/686 (2%)

Query: 6   LVLSLFVASTLGFYLPGAAPRTYKQGDAIPLLVNHLTPSLNFQHVDDDGNEIKGDKARML 65
           L L  ++     F LPG +P TY   D IPLLVN LTPS+ FQH D++GN+I  DK   L
Sbjct: 7   LALLSYIPVAKAFSLPGLSPTTYHSNDEIPLLVNRLTPSIYFQHQDENGNDISSDKEHFL 66

Query: 66  YPYDYYNEKLHFCQPEKIEKQPESLGSVIFGEKIYNSPFNVKMLEDNECVQLCSTTIPGK 125
           Y YDYYNE+ HFC+PE +EKQPESLGSVIFG++IYNSPF ++MLE+ ECV LC  TIPG+
Sbjct: 67  YSYDYYNERFHFCRPEHVEKQPESLGSVIFGDRIYNSPFQLRMLEEKECVALCKGTIPGR 126

Query: 126 DAKFINKLIKNGFMQNWLIDGLPAARKLHDSRTNTEFYGQGFELGFVEVRQAVGGKIVSE 185
           DA+FIN+LI +GF QNWL+DGLPAAR ++DSRT T +YG GFELGF +V Q VG + V  
Sbjct: 127 DAEFINRLIISGFFQNWLVDGLPAARSVYDSRTKTNYYGTGFELGFTDVIQTVGDETVPN 186

Query: 186 SEKELQLSERDAKNIIDFTDIEIRSPKNLVDLSNLEVREAKNVVDNIVTNVEVPVFANHF 245
           + +E  +   +A                    + L +R  KN+  N V  VE+P F NHF
Sbjct: 187 TMEEADMDASNAG-------------------ATLHIRSPKNIRPNPVKTVELPYFVNHF 227

Query: 246 DIEVEYHDRGNGDFRVVGVIVNPVSLDNYKSRSCALANQHKLHLDENKDNEVMFTYSVKF 305
           +I VE+H+RGN  +R+VGV VNPVS++     SC+   +  L L E++DNEV FTYSVKF
Sbjct: 228 EIVVEFHERGNDSYRIVGVTVNPVSIERSSPGSCS-RTRKPLTLHEDRDNEVYFTYSVKF 286

Query: 306 TPSDTPWATRWDKYLHIYDPKIQWFSLINFSVIVLLLSSVAIHSLLRALKSDISRYNEFN 365
             S T WATRWDKYLHIYDP+IQWFSLI FSVIV+LLSS  IHSLLRALKSD++RYNE N
Sbjct: 287 VASATVWATRWDKYLHIYDPQIQWFSLIGFSVIVILLSSAVIHSLLRALKSDLTRYNELN 346

Query: 366 LGDEFEEDSGWKLVHGDVFRTPKNSMLLSVLVGSGXXXXXXXXXXXXXXXXXXXXXXXRG 425
           L +EF ED+GWKL HGDVFRTP  SMLLSVLVGSG                       RG
Sbjct: 347 LNNEFHEDAGWKLSHGDVFRTPPKSMLLSVLVGSGIQLFLMIICSIFFAAFGLVSPISRG 406

Query: 426 SLPTAMFMFYAIFGFVGSYTSMGIYKFFKGPYWKANMILTPVLLPGIIFLTVIFMNVLLY 485
           SL T MF+ YA+FGFVGSYTSMG+YKFF GPYWKAN+I+TP+LLPG I L ++ MN+ L 
Sbjct: 407 SLQTVMFLLYALFGFVGSYTSMGVYKFFHGPYWKANLIITPILLPGAILLLIVAMNIFLL 466

Query: 486 FVGSSNVIPLATLVFMVFLWILFSIPLAFAGSLISYKKCNWDEHPTKTNEIPRQIPFQPW 545
           F  SS VIP  +L F++FLW + SIPL+F GS++++K+C+W+EHPTKTN+I RQIP QPW
Sbjct: 467 FAHSSGVIPAKSLFFIIFLWFVVSIPLSFVGSVLAHKRCSWNEHPTKTNQIARQIPHQPW 526

Query: 546 FLKTVPATLIGGLVSFGSIAVELYFIYSSLWFNKIFYMFGFLLFSIVLFSFTTGLINVII 605
           +L+T  AT++ G+ SFGSIAVELYFIYSSLWFNKIFYMFGFLLFS +L + TT LI V+I
Sbjct: 527 YLRTTQATMVAGIFSFGSIAVELYFIYSSLWFNKIFYMFGFLLFSFLLLTLTTSLITVLI 586

Query: 606 TYRALCSENWTWQWRSFFIGGLGCSIYIFIHSILFTQFKLGGFATIVLYVGYSFLISFLT 665
           TY +LC ENW WQWRSF IGGLGCSIY+FIHSILFT+FKLGGF T+VLY+GYSF++S L 
Sbjct: 587 TYHSLCLENWLWQWRSFIIGGLGCSIYMFIHSILFTKFKLGGFITVVLYLGYSFIMSVLC 646

Query: 666 CIVTGAIGFICSMFFVRRIFASIKVD 691
           C+VTGAIGF  SM F+R+I+ ++KV+
Sbjct: 647 CVVTGAIGFFSSMIFIRKIYYAVKVE 672

>TBLA0E04370 Chr5 complement(1108954..1110984) [2031 bp, 676 aa]
           {ON} Anc_8.254 YLR083C
          Length = 676

 Score =  849 bits (2193), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 417/682 (61%), Positives = 508/682 (74%), Gaps = 22/682 (3%)

Query: 12  VASTLGFYLPGAAPRTYKQGDAIPLLVNHLTPSLNFQHVDDDGNEIKGDKARMLYPYDYY 71
           ++ T GFYLPG AP TY + D+IPLLVNHLTPS+ F+H D DGNE+  DK   LY YDYY
Sbjct: 15  LSVTNGFYLPGVAPTTYHELDSIPLLVNHLTPSMFFKHKDSDGNELSSDKENFLYSYDYY 74

Query: 72  NEKLHFCQP--EKIEKQPESLGSVIFGEKIYNSPFNVKMLEDNECVQLCSTTIPGKDAKF 129
             KLHFC+P   +I+KQPESLGS++FG++IYNSPF +KML D  C +LCST IPG DAKF
Sbjct: 75  YSKLHFCKPLDREIKKQPESLGSILFGDRIYNSPFELKMLVDENCKELCSTNIPGDDAKF 134

Query: 130 INKLIKNGFMQNWLIDGLPAARKLHDSRTNTEFYGQGFELGFVEVRQAVGGKIVSESEKE 189
           IN LIK+GF+QNWLIDGLPAAR+L+D  T + FYG GFELG VE+ Q V       + K+
Sbjct: 135 INDLIKSGFLQNWLIDGLPAARQLYDQTTKSSFYGSGFELGSVEMIQVVDEAPSHTTPKQ 194

Query: 190 LQLSERDAKNIIDFTDIEIRSPKNLVDLSNLEVREAKNVVDNIVTNVEVPVFANHFDIEV 249
             + +  ++ + +    E R+ + LV                  ++VE   FANHFDI +
Sbjct: 195 PIVEDVLSQELDEEQATEKRANQMLV------------------SSVERTYFANHFDIHI 236

Query: 250 EYHDRGNGDFRVVGVIVNPVSLDNYKSRSCALANQHKLHLDENKDNEVMFTYSVKFTPSD 309
           EYHDRGN ++R+VGV VNP+S+   +  +    N  KL L E  D +V+FTYSV F  SD
Sbjct: 237 EYHDRGNNEYRIVGVTVNPISMK--RDSAICDTNLGKLALSEVSDTDVIFTYSVTFEKSD 294

Query: 310 TPWATRWDKYLHIYDPKIQWFSLINFSVIVLLLSSVAIHSLLRALKSDISRYNEFNLGDE 369
           T WATRWDKYLHIYDP IQWFSLINF+VIV++LS + +H L +ALK+D  RYNEFNL D 
Sbjct: 295 TVWATRWDKYLHIYDPTIQWFSLINFTVIVVVLSIIVVHFLTKALKNDFVRYNEFNLNDS 354

Query: 370 FEEDSGWKLVHGDVFRTPKNSMLLSVLVGSGXXXXXXXXXXXXXXXXXXXXXXXRGSLPT 429
           F+EDSGWKL HGDVFR P  SMLLS+ VGSG                       RGSLPT
Sbjct: 355 FDEDSGWKLAHGDVFRIPTKSMLLSIFVGSGTQLFFMISSVLVLAALGFLSPSARGSLPT 414

Query: 430 AMFMFYAIFGFVGSYTSMGIYKFFKGPYWKANMILTPVLLPGIIFLTVIFMNVLLYFVGS 489
            MF+ YA+FGFVGSYTSMG+Y+FF GPYWKANMILTP+++PG IF+ +I MN+ L FV S
Sbjct: 415 IMFILYAVFGFVGSYTSMGVYRFFNGPYWKANMILTPLIVPGGIFMFIISMNLFLVFVHS 474

Query: 490 SNVIPLATLVFMVFLWILFSIPLAFAGSLISYKKCNWDEHPTKTNEIPRQIPFQPWFLKT 549
           S+V+P+ TL  MV LWI+ S+PL+FAGSLIS+K+C W +HPTKTNE+ RQIPFQPW+LKT
Sbjct: 475 SDVVPIGTLSLMVLLWIVLSLPLSFAGSLISFKRCTWYDHPTKTNEVLRQIPFQPWYLKT 534

Query: 550 VPATLIGGLVSFGSIAVELYFIYSSLWFNKIFYMFGFLLFSIVLFSFTTGLINVIITYRA 609
           VPATLIGG+  FGSIAVELYFIYSSLWFNKIFYMFGFLL S +L + TT L+ +I+TY +
Sbjct: 535 VPATLIGGIFPFGSIAVELYFIYSSLWFNKIFYMFGFLLVSFLLLTMTTSLVTIIVTYHS 594

Query: 610 LCSENWTWQWRSFFIGGLGCSIYIFIHSILFTQFKLGGFATIVLYVGYSFLISFLTCIVT 669
           LC ENW WQWRSF IGG+GCSIYIFIHSILFT+FKLGGF TIVLYVGYS LI+ L  +VT
Sbjct: 595 LCLENWRWQWRSFIIGGIGCSIYIFIHSILFTEFKLGGFITIVLYVGYSALIAILCAMVT 654

Query: 670 GAIGFICSMFFVRRIFASIKVD 691
           GAIGFI +MFFV++I++SIKV+
Sbjct: 655 GAIGFISNMFFVKKIYSSIKVE 676

>ZYRO0C01848g Chr3 (146621..148564) [1944 bp, 647 aa] {ON} similar
           to uniprot|P32802 Saccharomyces cerevisiae YLR083C EMP70
           Protein whose 24kDa cleavage product is found in
           endosome-enriched membrane fractions predicted to be a
           transmembrane protein
          Length = 647

 Score =  823 bits (2125), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 420/691 (60%), Positives = 502/691 (72%), Gaps = 45/691 (6%)

Query: 1   MVRQLLVLSLFVASTLGFYLPGAAPRTYKQGDAIPLLVNHLTPSLNFQHVDDDGNEIKGD 60
           +   LL + L  +    FYLPG AP TY   D I LLVNHLTPS+NFQH D+DGN +KGD
Sbjct: 2   LSHSLLFVCLLTSLVKAFYLPGVAPTTYHSNDEIQLLVNHLTPSMNFQHEDEDGNMVKGD 61

Query: 61  KARMLYPYDYYNEKLHFCQPEKIEKQPESLGSVIFGEKIYNSPFNVKMLEDNECVQLCST 120
           K   LY YDYY  K HFC+PE + +QP SLGSVIFG++I+NSPF + MLE+ ECV LCS+
Sbjct: 62  KEHYLYSYDYYYSKFHFCKPENVVRQPASLGSVIFGDRIFNSPFKLNMLEEKECVPLCSS 121

Query: 121 TIPGKDAKFINKLIKNGFMQNWLIDGLPAARKLHDSRTNTEFYGQGFELGFVEVRQAVGG 180
            IPG+DAKF+NKLIKNGFMQNWLIDGLPA R++HDSRTN+ FYG GF+LGFV+V +    
Sbjct: 122 RIPGEDAKFVNKLIKNGFMQNWLIDGLPAGREIHDSRTNSNFYGTGFQLGFVDVTEG--- 178

Query: 181 KIVSESEKELQLSERDAKNIIDFTDIEIRSPKNLVDLSNLEVREAKNVVDNIVTNVEVPV 240
                                 F+D            SN E ++       I+  +EVP 
Sbjct: 179 ----------------------FSD------------SNDEEKK-------IMKTLEVPY 197

Query: 241 FANHFDIEVEYHDRGNGDFRVVGVIVNPVSLDNYKSRSCALANQHKLHLDENKDNEVMFT 300
            ANH+DI +EYHDRGN ++RVVGV V+PVS+    S SC   N   L L E ++NEV FT
Sbjct: 198 LANHYDINIEYHDRGNDNYRVVGVTVDPVSIKRSSSDSCQY-NSGSLTLSETEENEVHFT 256

Query: 301 YSVKFTPSDTPWATRWDKYLHIYDPKIQWFSLINFSVIVLLLSSVAIHSLLRALKSDISR 360
           YSVKF  SDT WATRWDKYLH+YDP IQWFSLIN SVIV+ LSSV +H LLRALK+D+SR
Sbjct: 257 YSVKFIKSDTVWATRWDKYLHVYDPTIQWFSLINCSVIVVALSSVVLHMLLRALKNDLSR 316

Query: 361 YNEFNLGDEFEEDSGWKLVHGDVFRTPKNSMLLSVLVGSGXXXXXXXXXXXXXXXXXXXX 420
           YNEFNL +EF EDSGWKL HGDVFR P  S+LLS+LVGSG                    
Sbjct: 317 YNEFNLDNEFHEDSGWKLSHGDVFRIPPRSLLLSILVGSGVQLFLMIACSIIFAALGFLS 376

Query: 421 XXXRGSLPTAMFMFYAIFGFVGSYTSMGIYKFFKGPYWKANMILTPVLLPGIIFLTVIFM 480
              RGSLPT MF+ YA+FGFVGSYTSM IYKFFKGP WK N++LTPVL+PG IF+T+I +
Sbjct: 377 PSSRGSLPTVMFLLYALFGFVGSYTSMAIYKFFKGPLWKVNLLLTPVLVPGGIFVTIILL 436

Query: 481 NVLLYFVGSSNVIPLATLVFMVFLWILFSIPLAFAGSLISYKKCNWDEHPTKTNEIPRQI 540
           N  L FV SS  IP  TL  ++ LW +FSIPL+FAGSLI++K+C  D HPTKTN+I RQI
Sbjct: 437 NFFLVFVRSSGAIPAGTLFTIILLWFVFSIPLSFAGSLIAHKRCRLDNHPTKTNQIARQI 496

Query: 541 PFQPWFLKTVPATLIGGLVSFGSIAVELYFIYSSLWFNKIFYMFGFLLFSIVLFSFTTGL 600
           P QPW+LKT+P +LI G+  F SIAVELYFIY+SLWFNKIFYMFGFLLFS +L +FTT L
Sbjct: 497 PIQPWYLKTIPVSLIAGVFPFASIAVELYFIYTSLWFNKIFYMFGFLLFSFLLLTFTTAL 556

Query: 601 INVIITYRALCSENWTWQWRSFFIGGLGCSIYIFIHSILFTQFKLGGFATIVLYVGYSFL 660
           + ++ TY +LC ENW WQWRSF IGG GC+IY+FIHSILFT+FKLGGF T+VLY+GYS L
Sbjct: 557 VTILTTYHSLCLENWKWQWRSFIIGGCGCAIYVFIHSILFTKFKLGGFTTVVLYLGYSGL 616

Query: 661 ISFLTCIVTGAIGFICSMFFVRRIFASIKVD 691
           IS L CIVTG+IGFI SMFF+R+I++S+KVD
Sbjct: 617 ISVLCCIVTGSIGFISSMFFIRKIYSSVKVD 647

>NCAS0B03890 Chr2 (693950..695941) [1992 bp, 663 aa] {ON} Anc_8.254
          Length = 663

 Score =  819 bits (2115), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 384/683 (56%), Positives = 496/683 (72%), Gaps = 29/683 (4%)

Query: 10  LFVASTL-GFYLPGAAPRTYKQGDAIPLLVNHLTPSLNFQHVDDDGNEIKGDKARMLYPY 68
           LF  S +  F LPG  P TY++GD IPLLVNHLTPS++F H +++G +I   K  +++ Y
Sbjct: 9   LFCLSVVEAFNLPGLGPVTYQKGDDIPLLVNHLTPSMHFHHKNEEGKDISTAKKYVVHSY 68

Query: 69  DYYNEKLHFCQPEKIEKQPESLGSVIFGEKIYNSPFNVKMLEDNECVQLCSTTIPGKDAK 128
           DYY EK HFCQP  IEK   S+GS++FG++IYNSPF + MLE+  CV LC + IPGKDA+
Sbjct: 69  DYYYEKFHFCQPVHIEKAGSSIGSILFGDRIYNSPFQLNMLENKTCVPLCESIIPGKDAE 128

Query: 129 FINKLIKNGFMQNWLIDGLPAARKLHDSRTNTEFYGQGFELGFVEVRQAVGGKIVSESEK 188
           FINKLIKNG+ QNW IDGLPAAR+++D RT + FYG GFELG VE+RQ  G K++     
Sbjct: 129 FINKLIKNGYYQNWFIDGLPAAREVYDKRTKSSFYGNGFELGLVEIRQTTGDKLL----- 183

Query: 189 ELQLSERDAKNIIDFTDIEIRSPKNLVDLSNLEVREAKNVVDNIVTNVEVPVFANHFDIE 248
                                 P ++ D+S+L  R+AKN+V N++  VEVP F NHFDI 
Sbjct: 184 ----------------------PDSVHDISDLAKRDAKNLVQNLIKEVEVPYFVNHFDIV 221

Query: 249 VEYHDRGNGDFRVVGVIVNPVSLDNYKSRSCALANQHKLHLDENKDNEVMFTYSVKFTPS 308
           +EYH+RGNG++RVVG  VNPVS+    +  C    +  L L+E +DN V  TYSV F PS
Sbjct: 222 IEYHERGNGNYRVVGATVNPVSIARKSAGDCTPTGK-SLTLNEEEDNNVHSTYSVTFVPS 280

Query: 309 DTPWATRWDKYLHIYDPKIQWFSLINFSVIVLLLSSVAIHSLLRALKSDISRYNEFNLGD 368
            T W TRWDKYLH+YDPKIQWFSLINFS+IV+LLS + I+SLL+ALKSD +RYN  NL D
Sbjct: 281 KTSWVTRWDKYLHVYDPKIQWFSLINFSLIVILLSVILINSLLKALKSDFARYNNINLDD 340

Query: 369 EFEEDSGWKLVHGDVFRTPKNSMLLSVLVGSGXXXXXXXXXXXXXXXXXXXXXXXRGSLP 428
           + +E+SGWKLVHG VFR PKN M+LS+LVGSG                       RG+LP
Sbjct: 341 DVKEESGWKLVHGYVFRIPKNPMILSILVGSGFQLFLVIVCTVFLAAIDILSPIYRGALP 400

Query: 429 TAMFMFYAIFGFVGSYTSMGIYKFFKGPYWKANMILTPVLLPGIIFLTVIFMNVLLYFVG 488
           TAM + Y +FGF+ SY SMG+YKFFKGPYWK NM+LTP+L+PG+I +T + +N+ L F  
Sbjct: 401 TAMIILYILFGFISSYVSMGVYKFFKGPYWKVNMLLTPILVPGLIIITFLALNLFLMFSE 460

Query: 489 SSNVIPLATLVFMVFLWILFSIPLAFAGSLISYKKCNWDEHPTKTNEIPRQIPFQPWFLK 548
           SS+V+P  T++ ++ LW   SIPL+ AGSL++ KKC+WDEHPT TN+I + IP Q W+LK
Sbjct: 461 SSSVVPAKTIMTLILLWFAVSIPLSVAGSLMAQKKCHWDEHPTVTNQIAKVIPPQKWYLK 520

Query: 549 TVPATLIGGLVSFGSIAVELYFIYSSLWFNKIFYMFGFLLFSIVLFSFTTGLINVIITYR 608
           T+PA+LIGGL SFGSI+V+LYFIY+SLWFN IFYM+GFLLFSI LF+ T  L+ ++ TY 
Sbjct: 521 TIPASLIGGLFSFGSISVQLYFIYTSLWFNNIFYMYGFLLFSICLFTMTITLVTILFTYH 580

Query: 609 ALCSENWTWQWRSFFIGGLGCSIYIFIHSILFTQFKLGGFATIVLYVGYSFLISFLTCIV 668
           +LC ENW WQWR FFIGGLGCSIY+ +HS+ F + KLGGF  I+LY+GYS +++ L  +V
Sbjct: 581 SLCQENWKWQWRGFFIGGLGCSIYVLLHSLFFIELKLGGFTNILLYMGYSSVVTALIFLV 640

Query: 669 TGAIGFICSMFFVRRIFASIKVD 691
           TG++GF+ SMFF++RIF+S+KVD
Sbjct: 641 TGSVGFLSSMFFIKRIFSSVKVD 663

>TPHA0A01840 Chr1 (371758..373815) [2058 bp, 685 aa] {ON} Anc_8.254
           YLR083C
          Length = 685

 Score =  819 bits (2115), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 403/686 (58%), Positives = 509/686 (74%), Gaps = 6/686 (0%)

Query: 6   LVLSLFVASTLGFYLPGAAPRTYKQGDAIPLLVNHLTPSLNFQHVDDDGNEIKGDKARML 65
           L+++  V+    FYLPG AP TY +GD +PLLVNHLTPSLN+Q  DD G +++  + +ML
Sbjct: 6   LLIAALVSFCNAFYLPGVAPSTYNEGDELPLLVNHLTPSLNYQKKDDLGKKVE-SREKML 64

Query: 66  YPYDYYNEKLHFCQPEKIEKQPESLGSVIFGEKIYNSPFNVKMLEDNECVQLCSTTIPGK 125
           Y +DYY  KLHFC+PEKI KQP+SLGS++FG++IYNSPF++KML+    V+LCS TIPG 
Sbjct: 65  YSFDYYFPKLHFCKPEKIVKQPDSLGSILFGDRIYNSPFSIKMLKPENNVKLCSITIPGS 124

Query: 126 DAKFINKLIKNGFMQNWLIDGLPAARKLHDSRTNTEFYGQGFELGFVEVRQAVGGKIVSE 185
           DAKFINKLIKNGF QNWLIDGLPAARK++DS T+TEFY  GF LGFVE+++ VGG  +  
Sbjct: 125 DAKFINKLIKNGFFQNWLIDGLPAARKIYDSNTHTEFYDVGFPLGFVEIKKNVGGLGIPM 184

Query: 186 SEKELQLSERDAKNIIDFTDIEIRSPKNLVDLSNLEVREAKNVVDNIVTNVEVPVFANHF 245
             K     ++++ +       +    +   D +  E RE K +   +V NVE P  ANH+
Sbjct: 185 DAKTKDSGKKNSNSDKKKDSKKKDDSQKKEDSNKKEKREPKRI-SKLVHNVEFPYLANHY 243

Query: 246 DIEVEYHDRGNGDFRVVGVIVNPVSLDNYKSRSCALANQHKLHLDENKDNEVMFTYSVKF 305
            I VE HDRG G++RVVGV V+P S     + S      +KL LDE KDNEV F+YSV F
Sbjct: 244 VINVEVHDRGEGNYRVVGVTVDPYS----TTDSANPEKGNKLFLDEKKDNEVTFSYSVNF 299

Query: 306 TPSDTPWATRWDKYLHIYDPKIQWFSLINFSVIVLLLSSVAIHSLLRALKSDISRYNEFN 365
             S+T WATRWDKYLH Y+P IQWFSL+NFS+IVLLLS++  +SLL+ALKSD +RY EFN
Sbjct: 300 IESETVWATRWDKYLHTYNPTIQWFSLVNFSIIVLLLSALVTYSLLKALKSDFARYEEFN 359

Query: 366 LGDEFEEDSGWKLVHGDVFRTPKNSMLLSVLVGSGXXXXXXXXXXXXXXXXXXXXXXXRG 425
           L + F EDSGWKL HGDVFR P  SMLLS+LVGSG                       RG
Sbjct: 360 LDNSFNEDSGWKLGHGDVFRIPSQSMLLSILVGSGAQLFLMIISSIFLAAIGIISPSSRG 419

Query: 426 SLPTAMFMFYAIFGFVGSYTSMGIYKFFKGPYWKANMILTPVLLPGIIFLTVIFMNVLLY 485
           SLP+AMF FYA+FGF GSY SM +YKFFKGPYWKANMILTP+L+PG I ++++ +N  L 
Sbjct: 420 SLPSAMFTFYALFGFWGSYISMSVYKFFKGPYWKANMILTPLLVPGFILVSILGLNFFLL 479

Query: 486 FVGSSNVIPLATLVFMVFLWILFSIPLAFAGSLISYKKCNWDEHPTKTNEIPRQIPFQPW 545
           FV SS  IP+  L+ +V +W + S+PL+F GSL++ K+ NW EHPTKTN+I RQIPFQ W
Sbjct: 480 FVHSSGTIPMTALLLIVVIWFVISLPLSFLGSLLANKRSNWGEHPTKTNQIARQIPFQSW 539

Query: 546 FLKTVPATLIGGLVSFGSIAVELYFIYSSLWFNKIFYMFGFLLFSIVLFSFTTGLINVII 605
           +LKT+PA LI G+  FG+IAVELYFIY+SLWFNKIFYMFGFL  S +L + TT L+ V+I
Sbjct: 540 YLKTIPAILIAGIFPFGAIAVELYFIYTSLWFNKIFYMFGFLFVSFLLLTLTTSLVTVLI 599

Query: 606 TYRALCSENWTWQWRSFFIGGLGCSIYIFIHSILFTQFKLGGFATIVLYVGYSFLISFLT 665
           TY++LC ENW WQWRSF IGG+GCS+YIFIHSILFT+FKLGGF T++LY+GY+ L+S L+
Sbjct: 600 TYQSLCMENWNWQWRSFTIGGVGCSLYIFIHSILFTKFKLGGFTTMILYIGYTLLLSILS 659

Query: 666 CIVTGAIGFICSMFFVRRIFASIKVD 691
           CIVTGA+GFI SM FVR+I+++++VD
Sbjct: 660 CIVTGAVGFISSMIFVRKIYSNVRVD 685

>Kwal_56.23577 s56 complement(605281..607332) [2052 bp, 683 aa] {ON}
           YLR083C (EMP70) - endosomal membrane protein [contig
           176] FULL
          Length = 683

 Score =  815 bits (2106), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 410/677 (60%), Positives = 504/677 (74%), Gaps = 14/677 (2%)

Query: 17  GFYLPGAAPRTYKQGDAIPLLVNHLTPSLNFQHVDDDGNEIKGDKARMLYPYDYYNEKLH 76
           GFYLPG AP TY +GD+IPLLVNHLTPS+ F+HVDDDG +  GD+   LY YDYY +K H
Sbjct: 19  GFYLPGVAPTTYHEGDSIPLLVNHLTPSMYFKHVDDDGKDT-GDRESFLYSYDYYYDKFH 77

Query: 77  FCQPEKIEKQPESLGSVIFGEKIYNSPFNVKMLEDNECVQLCSTTIPGKDAKFINKLIKN 136
           FC+PEK+EKQ ESLGS+IFG++IYNSPF ++ML+D EC  LCS+ IP  DAKFINKLI N
Sbjct: 78  FCKPEKLEKQRESLGSIIFGDRIYNSPFKLEMLKDKECEALCSSKIPANDAKFINKLIAN 137

Query: 137 GFMQNWLIDGLPAARKLHDSRTNTEFYGQGFELGFVEVRQAVGGKIVSESEKELQLSERD 196
           GF QNWL+DGLPAARK  D RT +EFY  GFELGF++V    G K+  + + E     + 
Sbjct: 138 GFFQNWLVDGLPAARKTTDERTKSEFYTPGFELGFIDVG---GAKLRMDGQGEEDAHPKG 194

Query: 197 AKNIIDFTDIEIRSPKNLVDLSNLEVREAKNVVD--NIVTNVEVPVFANHFDIEVEYHDR 254
           A   +   D   R  K+       +  + K +VD   +V  +E   FANHF+IEV+YHDR
Sbjct: 195 ATKPVAQDDYLDRPSKS-------KNEKRKKIVDPKELVKQLETAYFANHFNIEVQYHDR 247

Query: 255 GNGDFRVVGVIVNPVSLDNYKSRSCALANQHKLHLDENKDNEVMFTYSVKFTPSDTPWAT 314
           GNGD+RVVGVIVNP S+    S SCA A    L L E ++  V F+YSVKFTPSDT WAT
Sbjct: 248 GNGDYRVVGVIVNPQSIKRDSSNSCA-ATGELLKLSEEEETTVHFSYSVKFTPSDTVWAT 306

Query: 315 RWDKYLHIYDPKIQWFSLINFSVIVLLLSSVAIHSLLRALKSDISRYNEFNLGDEFEEDS 374
           RWDKYLH+YDPKIQW+SLINFS++V++LSSV IHSL R L+ D+SRYN+ NL D+F+E++
Sbjct: 307 RWDKYLHVYDPKIQWYSLINFSIVVIVLSSVVIHSLYRTLRDDLSRYNQLNLDDDFQEET 366

Query: 375 GWKLVHGDVFRTPKNSMLLSVLVGSGXXXXXXXXXXXXXXXXXXXXXXXRGSLPTAMFMF 434
           GWKLVHGDVFRTP  S+LLSVLVGSG                       RGSL T MF+ 
Sbjct: 367 GWKLVHGDVFRTPTKSLLLSVLVGSGTQLFVMAACTIAFALLGLLSPSSRGSLTTVMFIL 426

Query: 435 YAIFGFVGSYTSMGIYKFFKGPYWKANMILTPVLLPGIIFLTVIFMNVLLYFVGSSNVIP 494
           YA+FG +GSYTSM  YKFF G YWK NMILTP+L+PG++F  V+ +N  L  V S+  IP
Sbjct: 427 YALFGSLGSYTSMATYKFFGGEYWKVNMILTPILVPGLLFCVVLGLNFFLIMVESAGAIP 486

Query: 495 LATLVFMVFLWILFSIPLAFAGSLISYKKCNWDEHPTKTNEIPRQIPFQPWFLKTVPATL 554
             T+  +V LW +FSIPL+ AGSLI+ KKC W+EHPTKT +IPRQIPFQPW+LKT PA L
Sbjct: 487 FGTMCAIVLLWFVFSIPLSLAGSLIAKKKCRWNEHPTKTRQIPRQIPFQPWYLKTAPAAL 546

Query: 555 IGGLVSFGSIAVELYFIYSSLWFNKIFYMFGFLLFSIVLFSFTTGLINVIITYRALCSEN 614
           I G+  FGSIAVELYF+YSSLWFNKIFYMFGFL  S +L + TT L+ V++TY +LC EN
Sbjct: 547 IAGIFPFGSIAVELYFVYSSLWFNKIFYMFGFLFVSFLLLTLTTALVTVLLTYYSLCLEN 606

Query: 615 WTWQWRSFFIGGLGCSIYIFIHSILFTQFKLGGFATIVLYVGYSFLISFLTCIVTGAIGF 674
           W WQWR F+IGG GC++Y+F+H+ILFT+FKLGGF TIVLYVGYS +IS LTC++TGA+GF
Sbjct: 607 WKWQWRGFWIGGAGCALYVFLHAILFTKFKLGGFVTIVLYVGYSLVISLLTCLITGAVGF 666

Query: 675 ICSMFFVRRIFASIKVD 691
           + S++FVRRI++SIKVD
Sbjct: 667 MSSLWFVRRIYSSIKVD 683

>TBLA0H01450 Chr8 complement(321416..323437) [2022 bp, 673 aa] {ON}
           Anc_8.254 YLR083C
          Length = 673

 Score =  815 bits (2104), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 380/686 (55%), Positives = 493/686 (71%), Gaps = 22/686 (3%)

Query: 5   LLVLSLFVASTLGFYLPGAAPRTYKQGDAIPLLVNHLTPSLNFQHVDDDGNEIKGDKARM 64
           L ++S  +  +  FY+PG +  TY  GD I L VN LTPS+ F+H D++G  +  DK   
Sbjct: 9   LCLISFHIIFSNAFYIPGISANTYHPGDPIELEVNRLTPSMYFEHTDENGQSVANDKEHF 68

Query: 65  LYPYDYYNEKLHFCQPEKIEKQPESLGSVIFGEKIYNSPFNVKMLEDNECVQLCSTTIPG 124
           LY YDYY +K HFC+PEK+E++ ESLGSV+FG++IYNSPF + MLE  ECV LC TTIP 
Sbjct: 69  LYSYDYYYDKFHFCRPEKVERKSESLGSVLFGDRIYNSPFELYMLEPKECVPLCKTTIPA 128

Query: 125 KDAKFINKLIKNGFMQNWLIDGLPAARKLHDSRTNTEFYGQGFELGFVEVRQAVGGKIVS 184
            DAKFINKLIKNGF  NWLIDGLP+ARK++DS+T + FY  GF LG V V    GG    
Sbjct: 129 DDAKFINKLIKNGFFYNWLIDGLPSARKIYDSKTESIFYSSGFPLGSVSVEHMSGG---- 184

Query: 185 ESEKELQLSERDAKNIIDFTDIEIRSPKNLVDLSNLEVREAKNVVDNIVTNVEVPVFANH 244
                   S+     +    +  +++ K          REAKNV   ++T  EV  FANH
Sbjct: 185 --------SKVTIPGVSKLVNEAVKAYKK---------REAKNVPAGLITAEEVEYFANH 227

Query: 245 FDIEVEYHDRGNGDFRVVGVIVNPVSLDNYKSRSCALANQHKLHLDENKDNEVMFTYSVK 304
           F+I +EYHDRGN ++RVVGV V+P+S+      SC     ++LHL+EN +N+V+FTYSV 
Sbjct: 228 FNIHIEYHDRGNNNYRVVGVTVDPISIKRDDFESCT-PTGNQLHLNENAENQVLFTYSVD 286

Query: 305 FTPSDTPWATRWDKYLHIYDPKIQWFSLINFSVIVLLLSSVAIHSLLRALKSDISRYNEF 364
           F  S+T WATRWDKYLH YDP IQWFSLINF+++V+LLS++ IH+LLRALK DISRY + 
Sbjct: 287 FIKSETAWATRWDKYLHTYDPSIQWFSLINFTIVVVLLSTIVIHALLRALKKDISRYTDL 346

Query: 365 NLGDEFEEDSGWKLVHGDVFRTPKNSMLLSVLVGSGXXXXXXXXXXXXXXXXXXXXXXXR 424
           NL + F EDSGWKL HGDVFR P+ +M+LS+ VGSG                       R
Sbjct: 347 NLDNSFTEDSGWKLTHGDVFRMPRKAMVLSIYVGSGVQLFLMILCCLTVAALGFMSPSYR 406

Query: 425 GSLPTAMFMFYAIFGFVGSYTSMGIYKFFKGPYWKANMILTPVLLPGIIFLTVIFMNVLL 484
           G+LPT MF+ YAIFGFVGSYTSMG+YKFF GPYWKANMILTP+L+PG + L +IF+N  L
Sbjct: 407 GALPTCMFVLYAIFGFVGSYTSMGVYKFFHGPYWKANMILTPLLVPGSMLLLIIFLNFFL 466

Query: 485 YFVGSSNVIPLATLVFMVFLWILFSIPLAFAGSLISYKKCNWDEHPTKTNEIPRQIPFQP 544
             V SS  IP +T++ M+ LW+L S+PL+F GS +++KKCNW+++PT  NEIPR+IP QP
Sbjct: 467 LGVHSSGTIPASTIILMICLWLLVSVPLSFLGSFVAFKKCNWNDNPTTVNEIPREIPIQP 526

Query: 545 WFLKTVPATLIGGLVSFGSIAVELYFIYSSLWFNKIFYMFGFLLFSIVLFSFTTGLINVI 604
           W+++++P  L+ G+V FG+IAVELYFIYSSLW+NKIFYMFGFLL S +L  FT+ L+++I
Sbjct: 527 WYMRSIPVVLLSGIVPFGAIAVELYFIYSSLWYNKIFYMFGFLLVSFILMIFTSVLVSII 586

Query: 605 ITYRALCSENWTWQWRSFFIGGLGCSIYIFIHSILFTQFKLGGFATIVLYVGYSFLISFL 664
           + Y +LC ENW WQWRSF  GGLGC+ YIF++SI FT+FK  GF +I+LY+GYS LI  +
Sbjct: 587 VVYHSLCLENWRWQWRSFVAGGLGCAFYIFLYSIAFTRFKFTGFVSILLYMGYSSLICVV 646

Query: 665 TCIVTGAIGFICSMFFVRRIFASIKV 690
           +C++TGA+ F+C+MFFV+RIF SIKV
Sbjct: 647 SCLITGAVSFMCNMFFVKRIFTSIKV 672

>KLTH0G13882g Chr7 (1204180..1206243) [2064 bp, 687 aa] {ON} similar
           to uniprot|P32802 Saccharomyces cerevisiae YLR083C EMP70
           Protein whose 24kDa cleavage product is found in
           endosome-enriched membrane fractions predicted to be a
           transmembrane protein
          Length = 687

 Score =  815 bits (2105), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 407/696 (58%), Positives = 511/696 (73%), Gaps = 14/696 (2%)

Query: 1   MVRQLLVLSLFVASTL-GFYLPGAAPRTYKQGDAIPLLVNHLTPSLNFQHVDDDGNEIKG 59
           MV  +L+LS+  AS + GFYLPG AP TY +GDAIPLLVNHLTP++ +QH D+DGN++ G
Sbjct: 1   MVSAILLLSILWASQVSGFYLPGVAPTTYHEGDAIPLLVNHLTPTMYYQHADEDGNDL-G 59

Query: 60  DKARMLYPYDYYNEKLHFCQPEKIEKQPESLGSVIFGEKIYNSPFNVKMLEDNECVQLCS 119
           DK  +LY YDYY  K HFC+PEK+EKQ ESLGS+IFG++IYNSPF ++ML++ EC  LCS
Sbjct: 60  DKESLLYSYDYYYPKFHFCRPEKLEKQRESLGSIIFGDRIYNSPFQIEMLKNKECASLCS 119

Query: 120 TTIPGKDAKFINKLIKNGFMQNWLIDGLPAARKLHDSRTNTEFYGQGFELGFVEVRQAVG 179
            +IP  DAKFINKLI NGF QNWL+DGLPAARK  D RT +EFY  GFELG+V     +G
Sbjct: 120 ESIPADDAKFINKLITNGFFQNWLVDGLPAARKTTDVRTKSEFYTPGFELGYV----GIG 175

Query: 180 GKIVSESEKELQLSERDAKNIIDFTDIEIRSPKNLVDL----SNLEVREAKNVVDNIVTN 235
           G   SE     Q   +D  +       +  S  + +D      +L  R+  +    +V  
Sbjct: 176 G---SELRMNGQGGSQDGDDSGSHGSTKEVSESDYLDAPPAKRSLAKRKQVSNTKELVKQ 232

Query: 236 VEVPVFANHFDIEVEYHDRGNGDFRVVGVIVNPVSLDNYKSRSCALANQHKLHLDENKDN 295
           +E P FANHF+IEV+YHDRGNG++RVVGVIVNP S+      +C    +  L L E +  
Sbjct: 233 LETPYFANHFEIEVQYHDRGNGNYRVVGVIVNPYSIKRESPDTCDKTGE-LLKLSETEAT 291

Query: 296 EVMFTYSVKFTPSDTPWATRWDKYLHIYDPKIQWFSLINFSVIVLLLSSVAIHSLLRALK 355
           EV F+YSVKFTPS+T WATRWDKYLH+YDPKIQWFSLINFS++V+ LS+V IH L   L 
Sbjct: 292 EVHFSYSVKFTPSETVWATRWDKYLHVYDPKIQWFSLINFSLVVVFLSTVMIHRLYVTLT 351

Query: 356 SDISRYNEFNLGDEFEEDSGWKLVHGDVFRTPKNSMLLSVLVGSGXXXXXXXXXXXXXXX 415
            D+SRYN+ NL D+F+E++GWKL+HGDVFRTP+ S++LSVLVGSG               
Sbjct: 352 DDLSRYNQINLDDDFQEETGWKLIHGDVFRTPERSLILSVLVGSGAQLFLMAACTIGFAL 411

Query: 416 XXXXXXXXRGSLPTAMFMFYAIFGFVGSYTSMGIYKFFKGPYWKANMILTPVLLPGIIFL 475
                   RGSL T MF+ YA+FG  GSYTSM  YKFF GPYWK NM+LTP+L+PG++F 
Sbjct: 412 LGLLSPSSRGSLTTVMFILYALFGSFGSYTSMATYKFFGGPYWKVNMLLTPILVPGLLFC 471

Query: 476 TVIFMNVLLYFVGSSNVIPLATLVFMVFLWILFSIPLAFAGSLISYKKCNWDEHPTKTNE 535
            ++ +N  L  V S+  IP  T+  +V LW LFSIPL+ AGSLI+ KKC WDEHPTKT +
Sbjct: 472 VMLALNFFLVVVESAGAIPFGTMCVIVLLWFLFSIPLSVAGSLIARKKCKWDEHPTKTKQ 531

Query: 536 IPRQIPFQPWFLKTVPATLIGGLVSFGSIAVELYFIYSSLWFNKIFYMFGFLLFSIVLFS 595
           IPRQIPFQPW+LKTVPA+LI G+  FGSIAVELYFIYSSLWFNKIFYMFGFL  S +L +
Sbjct: 532 IPRQIPFQPWYLKTVPASLIAGIFPFGSIAVELYFIYSSLWFNKIFYMFGFLFVSFLLLT 591

Query: 596 FTTGLINVIITYRALCSENWTWQWRSFFIGGLGCSIYIFIHSILFTQFKLGGFATIVLYV 655
            TT LI V++TY +LC ENW WQWR F+IGG GC++Y+FIH+ILFT+F+LGGF TIVLYV
Sbjct: 592 LTTSLITVLLTYYSLCLENWKWQWRGFWIGGAGCALYMFIHAILFTKFRLGGFTTIVLYV 651

Query: 656 GYSFLISFLTCIVTGAIGFICSMFFVRRIFASIKVD 691
           GYS ++S L+C++TG +GF+ S++FVRRI++S+KVD
Sbjct: 652 GYSLVMSLLSCLITGTVGFLSSLWFVRRIYSSVKVD 687

>KNAG0G01990 Chr7 complement(441326..443329) [2004 bp, 667 aa] {ON}
           Anc_8.254 YLR083C
          Length = 667

 Score =  811 bits (2096), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 414/675 (61%), Positives = 504/675 (74%), Gaps = 28/675 (4%)

Query: 17  GFYLPGAAPRTYKQGDAIPLLVNHLTPSLNFQHVDDDGNEIKGDKARMLYPYDYYNEKLH 76
            FYLPG AP TYK  D IPLLVNHL+PS+ +QH  +DG  +KGDK+R LY YDYY ++ H
Sbjct: 21  AFYLPGVAPTTYKANDEIPLLVNHLSPSMYWQHETEDGENMKGDKSRYLYSYDYYYDRFH 80

Query: 77  FCQPEKIEKQPESLGSVIFGEKIYNSPFNVKMLEDNECVQLCSTTIPGKDAKFINKLIKN 136
           FCQPEKI K+PESLGS+IFG++IYNSP+ +KMLE+  CV LC+T IPGKDA+FINKLIKN
Sbjct: 81  FCQPEKIVKEPESLGSIIFGDRIYNSPYQIKMLEEKTCVPLCNTIIPGKDAEFINKLIKN 140

Query: 137 GFMQNWLIDGLPAARKLHDSRTNTEFYGQGFELGFVEVRQAVGGKIVSESEKELQLSERD 196
           GF QNWLIDGLPAAR +HD  TN++FYG GFELG VEV QAV       ++ +    E D
Sbjct: 141 GFFQNWLIDGLPAARVVHDKSTNSDFYGNGFELGSVEVVQAV-------AQAKTHPKEDD 193

Query: 197 AKNIIDFTDIEIRSPKNLVDLSNLEVREAKNVVDNIVTNVEVPVFANHFDIEVEYHDRGN 256
           + +                  + L  R+AKNV   ++ NVE+P FANH DI VEYHDRG 
Sbjct: 194 SGS------------------AKLSTRDAKNV--QMLKNVELPYFANHHDITVEYHDRGE 233

Query: 257 GDFRVVGVIVNPVSLDNYKSRSCALANQHKLHLDENKDNEVMFTYSVKFTPSDTPWATRW 316
           G+ RVVGV V+P+S+      +C  +    L LDE  DNEV FTYSV+F  SDT WATRW
Sbjct: 234 GNLRVVGVTVDPISIKRSSPGTCQTSGD-PLMLDEKNDNEVYFTYSVRFVASDTVWATRW 292

Query: 317 DKYLHIYDPKIQWFSLINFSVIVLLLSSVAIHSLLRALKSDISRYNEFNLGDEFEEDSGW 376
           DKYLH YDP IQWFSL+NFS++V+LLSSV IH LL+AL+SD +RYNE NL +EF+EDSGW
Sbjct: 293 DKYLHTYDPTIQWFSLVNFSIVVVLLSSVVIHMLLKALRSDFARYNELNLDNEFQEDSGW 352

Query: 377 KLVHGDVFRTPKNSMLLSVLVGSGXXXXXXXXXXXXXXXXXXXXXXXRGSLPTAMFMFYA 436
           KL HGDVFR P  SMLLS+LVGSG                       RGSL T MFM YA
Sbjct: 353 KLTHGDVFRIPSKSMLLSILVGSGIQLFLMISVSIFFAALGFLSPSSRGSLGTVMFMLYA 412

Query: 437 IFGFVGSYTSMGIYKFFKGPYWKANMILTPVLLPGIIFLTVIFMNVLLYFVGSSNVIPLA 496
           +FGFVGSYTSMG+YKFF+GPYWKANMILTP+L+PG + L+++ +N+ L    SS  IP  
Sbjct: 413 LFGFVGSYTSMGVYKFFRGPYWKANMILTPLLVPGCLLLSIVGLNMFLLGAHSSGTIPAK 472

Query: 497 TLVFMVFLWILFSIPLAFAGSLISYKKCNWDEHPTKTNEIPRQIPFQPWFLKTVPATLIG 556
           TL F+V LW + S+P A AGSLI++KKC+WDEHPTKTN++ RQ+PFQPW+LKTV AT I 
Sbjct: 473 TLFFIVLLWFVISVPSALAGSLIAHKKCSWDEHPTKTNQVARQVPFQPWYLKTVAATFIA 532

Query: 557 GLVSFGSIAVELYFIYSSLWFNKIFYMFGFLLFSIVLFSFTTGLINVIITYRALCSENWT 616
           G+  FGSIAVELYFIY+SLW+NKIFYMFGFL  S +L + TT L+ ++ITY +L  ENW 
Sbjct: 533 GIFPFGSIAVELYFIYTSLWYNKIFYMFGFLFVSFLLLTLTTVLVTILITYHSLSLENWQ 592

Query: 617 WQWRSFFIGGLGCSIYIFIHSILFTQFKLGGFATIVLYVGYSFLISFLTCIVTGAIGFIC 676
           WQWRSF +GG+GC+IY+F+HSILFT+ KLGGF TIVLYVGYS +IS L C+VTG+IGF+ 
Sbjct: 593 WQWRSFIVGGVGCAIYMFVHSILFTKLKLGGFVTIVLYVGYSAVISLLCCLVTGSIGFLS 652

Query: 677 SMFFVRRIFASIKVD 691
           SMFFVRRI++SIKV+
Sbjct: 653 SMFFVRRIYSSIKVE 667

>KLLA0F18931g Chr6 complement(1734636..1736633) [1998 bp, 665 aa]
           {ON} similar to uniprot|P32802 Saccharomyces cerevisiae
           YLR083C EMP70 Protein whose 24kDa cleavage product is
           found in endosome-enriched membrane fractions predicted
           to be a transmembrane protein
          Length = 665

 Score =  808 bits (2086), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 391/691 (56%), Positives = 491/691 (71%), Gaps = 34/691 (4%)

Query: 3   RQLLVLSLFVASTL--GFYLPGAAPRTYKQGDAIPLLVNHLTPSLNFQHVDDDGNEIKGD 60
           R LLV S  + S L   FYLPG AP TY +GD +PLLVNHLTPS  ++H D D ++  GD
Sbjct: 7   RSLLV-STLIGSLLVEAFYLPGVAPTTYHEGDDLPLLVNHLTPSQFYKHYDTDQHD-TGD 64

Query: 61  KARMLYPYDYYNEKLHFCQPEKIEKQPESLGSVIFGEKIYNSPFNVKMLEDNECVQLCST 120
           K   LY YDYY +K HFCQP +++KQPESLGS+IFG++IYNSPF +++L++ EC  LC +
Sbjct: 65  KEGFLYSYDYYYKKFHFCQPAELKKQPESLGSIIFGDRIYNSPFKLQLLKNVECQSLCKS 124

Query: 121 TIPGKDAKFINKLIKNGFMQNWLIDGLPAARKLHDSRTNTEFYGQGFELGFVEVRQAVGG 180
            IPGKDAKFINKLI NGF QNW+IDGLPAARK+ D++TN  FYG GFELG V+V      
Sbjct: 125 VIPGKDAKFINKLILNGFFQNWIIDGLPAARKMEDTKTNKIFYGNGFELGLVDV------ 178

Query: 181 KIVSESEKELQLSERDAKNIIDFTDIEIRSPKNLVDLSNLEVREAKNVVDNIVTNVEVPV 240
                    L   E D +++ D  ++++ + KN++   +                 E+P 
Sbjct: 179 ---------LSDYEPDTRSLHDELELQLNAKKNVLSPGD--------------KVTEIPY 215

Query: 241 FANHFDIEVEYHDRGNGDFRVVGVIVNPVSLDNYKSRSCALANQHKLHLDENKDNEVMFT 300
           F NH+DI++EYHDRG  ++R+VGV VNP S+      SC  +    L L E +DNEV FT
Sbjct: 216 FVNHYDIQIEYHDRGENNYRIVGVTVNPASIKRDSPDSCE-STGKSLVLSETEDNEVYFT 274

Query: 301 YSVKFTPSDTPWATRWDKYLHIYDPKIQWFSLINFSVIVLLLSSVAIHSLLRALKSDISR 360
           YSVKF  SDT WATRWDKYLH+YDPKIQWFSLINFS IV+LLSSV +HSL  ALK+D++R
Sbjct: 275 YSVKFIKSDTVWATRWDKYLHVYDPKIQWFSLINFSTIVVLLSSVMLHSLYSALKNDLAR 334

Query: 361 YNEFNLGDEFEEDSGWKLVHGDVFRTPKNSMLLSVLVGSGXXXXXXXXXXXXXXXXXXXX 420
           YNE NL  +FEE++GWKL+HGDVFR+P  ++LLSVLVGSG                    
Sbjct: 335 YNELNLDTDFEEETGWKLIHGDVFRSPNKALLLSVLVGSGGQLALMLTTTILFACLGFLS 394

Query: 421 XXXRGSLPTAMFMFYAIFGFVGSYTSMGIYKFFKGPYWKANMILTPVLLPGIIFLTVIFM 480
              RGSL T MF+ YAIFG  GS+TSM  YKFF G  W+ N++LTP+L+PG I   V+ +
Sbjct: 395 PSSRGSLSTVMFLLYAIFGSFGSFTSMATYKFFNGKAWRLNLVLTPLLVPGSILTVVLGL 454

Query: 481 NVLLYFVGSSNVIPLATLVFMVFLWILFSIPLAFAGSLISYKKCNWDEHPTKTNEIPRQI 540
           N  L FV SS  IP  T++ +V LW + SIPL+  GS+I++KKCNW+EHPTKTN+I RQI
Sbjct: 455 NFFLIFVHSSGAIPFQTMLVLVLLWFVISIPLSAIGSVIAWKKCNWNEHPTKTNQIARQI 514

Query: 541 PFQPWFLKTVPATLIGGLVSFGSIAVELYFIYSSLWFNKIFYMFGFLLFSIVLFSFTTGL 600
           PFQPW+LKT+P  L+ G+  FGSIAVELYFIYSSLWFNKI+YMFGFL FS +L + TT L
Sbjct: 515 PFQPWYLKTIPVALLAGIFPFGSIAVELYFIYSSLWFNKIYYMFGFLFFSFILLALTTSL 574

Query: 601 INVIITYRALCSENWTWQWRSFFIGGLGCSIYIFIHSILFTQFKLGGFATIVLYVGYSFL 660
           I V++TY +LC ENW WQWRSF IGG GC+ Y+F HSILFT+F+LGG  TIVLY+GYS L
Sbjct: 575 ITVLLTYHSLCMENWKWQWRSFVIGGCGCAFYVFCHSILFTKFRLGGLTTIVLYLGYSIL 634

Query: 661 ISFLTCIVTGAIGFICSMFFVRRIFASIKVD 691
           IS L C+VTGAIGF+ S+  VR+I++ +KVD
Sbjct: 635 ISGLCCLVTGAIGFLSSLILVRKIYSCVKVD 665

>SAKL0H17248g Chr8 (1530599..1532581) [1983 bp, 660 aa] {ON} similar
           to uniprot|P32802 Saccharomyces cerevisiae YLR083C EMP70
           Protein whose 24kDa cleavage product is found in
           endosome-enriched membrane fractions predicted to be a
           transmembrane protein
          Length = 660

 Score =  790 bits (2039), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 398/675 (58%), Positives = 486/675 (72%), Gaps = 29/675 (4%)

Query: 17  GFYLPGAAPRTYKQGDAIPLLVNHLTPSLNFQHVDDDGNEIKGDKARMLYPYDYYNEKLH 76
            FYLPG AP TY +GD IPLLVNHLTPS  FQH D +G+ + GDK R LY YDYY +K H
Sbjct: 15  AFYLPGVAPTTYHKGDEIPLLVNHLTPSTYFQHADQEGHTMSGDKERFLYSYDYYYDKFH 74

Query: 77  FCQPEKIEKQPESLGSVIFGEKIYNSPFNVKMLEDNECVQLCSTTIPGKDAKFINKLIKN 136
           FC+PE + KQPESLGS+IFG++IYNSPF + MLE+  CV LC + IP  DAKFINKLI+N
Sbjct: 75  FCRPENLIKQPESLGSIIFGDRIYNSPFELNMLENKTCVPLCKSEIPKDDAKFINKLIRN 134

Query: 137 GFMQNWLIDGLPAARKLHDSRTNTEFYGQGFELGFVEVRQAVGGKIVSESEKELQLSERD 196
           GF  NWL+DGLPAAR++HD RTN+ FYG GFELGFV+V   +      E     ++SE D
Sbjct: 135 GFFHNWLVDGLPAAREMHDGRTNSYFYGNGFELGFVDVVDTI------EDPDTKKVSESD 188

Query: 197 AKNIIDFTDIEIRSPKNLVDLSNLEVREAKNVVDNIVTNVEVPVFANHFDIEVEYHDRGN 256
              I D  D E++             R AK          E+  F NHFDI++EYHDRG 
Sbjct: 189 YIEIAD-ADKELKE------------RSAKLT--------ELSYFINHFDIKIEYHDRGE 227

Query: 257 GDFRVVGVIVNPVSLDNYKSRSCALANQHKLHLDENKDNEVMFTYSVKFTPSDTPWATRW 316
            ++RVVGV V P S+    S SC    +  L L E+ DN V FTYSV F PS T WATRW
Sbjct: 228 DNYRVVGVSVIPASIKRDSSDSCDTEGE-PLVLSEDADNTVHFTYSVSFVPSQTLWATRW 286

Query: 317 DKYLHIYDPKIQWFSLINFSVIVLLLSSVAIHSLLRALKSDISRYNEFNLGDEFEEDSGW 376
           DKYLH+YDP+IQWFSLI+FS+IV+LLSSV +HSL RALK+D+SRYNE NL DEF+E++GW
Sbjct: 287 DKYLHVYDPQIQWFSLISFSLIVILLSSVMVHSLFRALKNDLSRYNELNLDDEFQEETGW 346

Query: 377 KLVHGDVFRTPKNSMLLSVLVGSGXXXXXXXXXXXXXXXXXXXXXXXRGSLPTAMFMFYA 436
           KLVHGDVFRTP+ +MLLSVLVGSG                       RGSL T MF+ YA
Sbjct: 347 KLVHGDVFRTPERTMLLSVLVGSGAQLFLMAGFTILFALLGLLSPSSRGSLTTVMFILYA 406

Query: 437 IFGFVGSYTSMGIYKFFKGPYWKANMILTPVLLPGIIFLTVIFMNVLLYFVGSSNVIPLA 496
           +FG  GSYTSM +YKFF G  WK NMILTP+L+P +IF++++ +N  L FV SS  IP  
Sbjct: 407 LFGSFGSYTSMAVYKFFNGQNWKLNMILTPILIPSMIFISMLGLNTFLVFVHSSGAIPFG 466

Query: 497 TLVFMVFLWILFSIPLAFAGSLISYKKCNWDEHPTKTNEIPRQIPFQPWFLKTVPATLIG 556
           T++ +V LW +FSIPL+ AGS+IS KK  WD  PT TN+I RQIPFQPW+LKTVPA+LI 
Sbjct: 467 TMLAIVVLWFVFSIPLSVAGSIISRKKSQWDR-PTNTNQIARQIPFQPWYLKTVPASLIA 525

Query: 557 GLVSFGSIAVELYFIYSSLWFNKIFYMFGFLLFSIVLFSFTTGLINVIITYRALCSENWT 616
           G   FGSI VELYFIYSSLWFNKIFYMFGFL FS +L + TT L+ V++TY +LC ENW 
Sbjct: 526 GTFPFGSIVVELYFIYSSLWFNKIFYMFGFLFFSFLLLTLTTTLVTVLLTYYSLCMENWK 585

Query: 617 WQWRSFFIGGLGCSIYIFIHSILFTQFKLGGFATIVLYVGYSFLISFLTCIVTGAIGFIC 676
           WQWR F+IGG GC+ Y+F+H+ILFT+FKLGG  T+VLY+GYS +IS L C++TGA+GF+ 
Sbjct: 586 WQWRGFWIGGAGCAFYVFVHAILFTKFKLGGLTTVVLYLGYSVVISGLCCLITGAVGFLS 645

Query: 677 SMFFVRRIFASIKVD 691
           S++FVR+I+ SIKVD
Sbjct: 646 SLWFVRKIYGSIKVD 660

>TDEL0F03810 Chr6 complement(696251..698221) [1971 bp, 656 aa] {ON}
           Anc_8.254 YLR083C
          Length = 656

 Score =  750 bits (1936), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 362/685 (52%), Positives = 457/685 (66%), Gaps = 35/685 (5%)

Query: 7   VLSLFVASTLGFYLPGAAPRTYKQGDAIPLLVNHLTPSLNFQHVDDDGNEIKGDKARMLY 66
            LSL  A +   +LPG +P  Y     I L VNHLTPS +FQH D DGN IK DK   LY
Sbjct: 7   ALSLLWAVSRASFLPGISPTNYDAKSEIALYVNHLTPSRHFQHKDKDGNNIKSDKEHYLY 66

Query: 67  PYDYYNEKLHFCQPEKIEKQPESLGSVIFGEKIYNSPFNVKMLEDNECVQLCSTTIPGKD 126
            YDYYN KLHFC+PE + +Q ESLGSV+FG+++YNSPF + MLED  CV LC + IPG+D
Sbjct: 67  SYDYYNSKLHFCKPENVIEQAESLGSVLFGDRLYNSPFKLNMLEDKSCVSLCKSVIPGED 126

Query: 127 AKFINKLIKNGFMQNWLIDGLPAARKLHDSRTNTEFYGQGFELGFVEVRQAVGGKIVSES 186
           A FINKLIKNGF+ NWL+DGLPA   +++ R ++     GF LG VE+ Q V    ++  
Sbjct: 127 AAFINKLIKNGFLHNWLVDGLPAGTLINNERESSAHITNGFPLGSVEIMQGVHNGAMATP 186

Query: 187 EKELQLSERDAKNIIDFTDIEIRSPKNLVDLSNLEVREAKNVVDNIVTNVEVPVFANHFD 246
            +E  +S   +                                 N+V N+E+P   NH+D
Sbjct: 187 REETGISAHGS---------------------------------NVVVNLELPHLNNHYD 213

Query: 247 IEVEYHDRGNGDFRVVGVIVNPVSLDNYKSRSCALANQHKLHLDENKDNEVMFTYSVKFT 306
           I ++YH+   G +R+VGV V P S+    S SC    + ++ L E++DNEV++TYSV++ 
Sbjct: 214 ITIQYHEPEAGKYRIVGVEVEPKSIKQ-TSNSCEFTGE-QISLSEDQDNEVLYTYSVRYV 271

Query: 307 PSDTPWATRWDKYLHIYDPKIQWFSLINFSVIVLLLSSVAIHSLLRALKSDISRYNEFNL 366
                WATRWD Y   YD  +QWFSLI+  ++V+ LSSV +H LLRALKSD +RYNE NL
Sbjct: 272 RFSHTWATRWDNYRFSYDTTVQWFSLISCVIVVIGLSSVVLHMLLRALKSDFARYNELNL 331

Query: 367 GDEFEEDSGWKLVHGDVFRTPKNSMLLSVLVGSGXXXXXXXXXXXXXXXXXXXXXXXRGS 426
            DEF E+SGWKL HGDVFR P  S+LLSVLVGSG                       R  
Sbjct: 332 DDEFHEESGWKLSHGDVFRMPNKSLLLSVLVGSGVQLLLLAVGGIVIAAIAFNNAGSREV 391

Query: 427 LPTAMFMFYAIFGFVGSYTSMGIYKFFKGPYWKANMILTPVLLPGIIFLTVIFMNVLLYF 486
           LPT  F+ YA+FGFVGSY SMG+Y+FFKGPY K NMILTP L+PG+I LT+I +N  L  
Sbjct: 392 LPTIFFVLYALFGFVGSYASMGVYRFFKGPYPKVNMILTPFLIPGLILLTIISLNFFLLI 451

Query: 487 VGSSNVIPLATLVFMVFLWILFSIPLAFAGSLISYKKCNWDEHPTKTNEIPRQIPFQPWF 546
             SS+ IP + L  +V LW++ S+PL+ AGSL + K C+WD+HPTKTN+I RQIPFQPW+
Sbjct: 452 AHSSDAIPFSALFAVVLLWLIISVPLSLAGSLTAIKTCSWDQHPTKTNQIARQIPFQPWY 511

Query: 547 LKTVPATLIGGLVSFGSIAVELYFIYSSLWFNKIFYMFGFLLFSIVLFSFTTGLINVIIT 606
           LKT+PA L+ G+  F SIAVELYFIY+SLWF++ FYMFGF + S+ L   TT L+ V+IT
Sbjct: 512 LKTLPAALVAGIFPFASIAVELYFIYNSLWFHQFFYMFGFSMVSLFLLVLTTALVTVMIT 571

Query: 607 YRALCSENWTWQWRSFFIGGLGCSIYIFIHSILFTQFKLGGFATIVLYVGYSFLISFLTC 666
           Y +LC ENW WQWRSF +GGLG ++YIFIHSI FT+FKL GF TIVLYVGYS LIS L C
Sbjct: 572 YHSLCLENWQWQWRSFIVGGLGSAVYIFIHSIFFTEFKLRGFTTIVLYVGYSMLISILCC 631

Query: 667 IVTGAIGFICSMFFVRRIFASIKVD 691
           + TGA+GF  SMF VR+IF+S+KVD
Sbjct: 632 LTTGAVGFFSSMFLVRKIFSSVKVD 656

>NDAI0J01420 Chr10 (326749..328608) [1860 bp, 619 aa] {ON} Anc_8.254
          Length = 619

 Score =  722 bits (1864), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 340/647 (52%), Positives = 451/647 (69%), Gaps = 28/647 (4%)

Query: 45  LNFQHVDDDGNEIKGDKARMLYPYDYYNEKLHFCQPEKIEKQPESLGSVIFGEKIYNSPF 104
           +++ H + +G +I  D  R +Y YDYY EKLHFC+PE +EK   S+GSV+FG+++YNSPF
Sbjct: 1   MHYHHKNQEGQDISTDDKRTIYSYDYYYEKLHFCKPEHVEKAGVSIGSVLFGDRLYNSPF 60

Query: 105 NVKMLEDNECVQLCSTTIPGKDAKFINKLIKNGFMQNWLIDGLPAARKLHDSRTNTEFYG 164
            + ML++  C +LC++TI G+DAKFINKLIKNG+ QNWLIDGLPAAR+++D+RT + FYG
Sbjct: 61  QLNMLKNKTCERLCNSTIIGRDAKFINKLIKNGYYQNWLIDGLPAAREVYDTRTKSNFYG 120

Query: 165 QGFELGFVEVRQAVGGKIVSESEKELQLSERDAKNIIDFTDIEIRSPKNLVDLSNLEVRE 224
            GFELG VE+RQ  G K++  S    +                           +L  R+
Sbjct: 121 NGFELGLVEIRQTTGEKLLPNSADTFR---------------------------DLHKRD 153

Query: 225 AKNVVDNIVTNVEVPVFANHFDIEVEYHDRGNGDFRVVGVIVNPVSLDNYKSRSCALANQ 284
           AKN+V N++ ++EVP F NHFDI +EYHDRGN ++RVVGV VNPVS+D      C    +
Sbjct: 154 AKNIVQNLMQDIEVPYFVNHFDIRIEYHDRGNDNYRVVGVTVNPVSIDRSPDGGCKPTGK 213

Query: 285 HKLHLDENKDNEVMFTYSVKFTPSDTPWATRWDKYLHIYDPKIQWFSLINFSVIVLLLSS 344
             L L E++ N + FTYSV+F PS+T W TRWDKYLH+YDP IQW S++NFS++V++LS 
Sbjct: 214 -ALSLSESEVNYIHFTYSVEFIPSETAWVTRWDKYLHVYDPTIQWVSIVNFSIVVIILSC 272

Query: 345 VAIHSLLRALKSDISRYNEFNLGDEFEEDSGWKLVHGDVFRTPKNSMLLSVLVGSGXXXX 404
               SLL+ALKSD SRY E NL +  +ED+ WKL HGDVFR P + MLLS+LVGSG    
Sbjct: 273 AVARSLLQALKSDFSRYGELNLDETIKEDASWKLGHGDVFRAPDHPMLLSILVGSGVQLF 332

Query: 405 XXXXXXXXXXXXXXXXXXXRGSLPTAMFMFYAIFGFVGSYTSMGIYKFFKGPYWKANMIL 464
                              RG+LPT MF+ Y  F F+ S+ SMG+YKFF G  W  N IL
Sbjct: 333 LMIICTIFLPAVGLITPGSRGTLPTVMFLLYLGFSFISSFVSMGVYKFFNGQKWHINCIL 392

Query: 465 TPVLLPGIIFLTVIFMNVLLYFVGSSNVIPLATLVFMVFLWILFSIPLAFAGSLISYKKC 524
           TP L+PG++ L +I +N+ L FV SS VIPLAT   ++ LW    +PL+  GSL++ K C
Sbjct: 393 TPFLVPGLLLLVIIGLNIFLIFVHSSGVIPLATFTSLILLWFFIGVPLSITGSLMARKTC 452

Query: 525 NWDEHPTKTNEIPRQIPFQPWFLKTVPATLIGGLVSFGSIAVELYFIYSSLWFNKIFYMF 584
           +WD HPTKTN + + IP Q W+L+T+PA+LIGGL SFGS++VELYF+Y+SLWFNKIFYM+
Sbjct: 453 HWDIHPTKTNTVSKVIPPQKWYLQTIPASLIGGLFSFGSLSVELYFVYTSLWFNKIFYMY 512

Query: 585 GFLLFSIVLFSFTTGLINVIITYRALCSENWTWQWRSFFIGGLGCSIYIFIHSILFTQFK 644
           GFL  S +LF+ T  L+ V+ TY +L +ENW WQWRSF I GLGCS Y+F+HS+LFT+ K
Sbjct: 513 GFLFGSAILFTLTVSLVTVLFTYYSLSAENWQWQWRSFLIAGLGCSFYVFLHSLLFTEVK 572

Query: 645 LGGFATIVLYVGYSFLISFLTCIVTGAIGFICSMFFVRRIFASIKVD 691
           LGGF   +LY+GYSF+I+ L  +VTGA+GF+ SM FVR I++++KVD
Sbjct: 573 LGGFTNALLYMGYSFVITSLAFVVTGALGFLSSMLFVRTIYSAVKVD 619

>AGR097W Chr7 (920133..922094) [1962 bp, 653 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR083C (EMP70) and
           YDR107C
          Length = 653

 Score =  709 bits (1830), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 366/675 (54%), Positives = 474/675 (70%), Gaps = 37/675 (5%)

Query: 17  GFYLPGAAPRTYKQGDAIPLLVNHLTPSLNFQHVDDDGNEIKGDKARMLYPYDYYNEKLH 76
           GFYLPG+AP TY++GDAIPLLVNH+TP++     D  G + + DK R LY YDYY  +LH
Sbjct: 16  GFYLPGSAPTTYRRGDAIPLLVNHITPTVFSD--DRAGTDGQRDKERYLYAYDYYYPRLH 73

Query: 77  FCQPEKIEKQPESLGSVIFGEKIYNSPFNVKMLEDNECVQLCSTTIPGKDAKFINKLIKN 136
            C+P+KIEK  ESLGS+IFG++++NSPF +KMLE+  CV LC  T+P +DAKFIN+LI++
Sbjct: 74  MCRPDKIEKVSESLGSIIFGDRLHNSPFELKMLEEKSCVALCEKTVPAEDAKFINQLIRS 133

Query: 137 GFMQNWLIDGLPAARKLHDSRTNTEFYGQGFELGFVEVRQAVGGKIVSESEKELQLSERD 196
           GF  NWL+DGLPA R++HD+RTNT FYG GFELG          +++  +E         
Sbjct: 134 GFFHNWLVDGLPAGREMHDARTNTVFYGTGFELG----------RVIRGTED-------- 175

Query: 197 AKNIIDFTDIEIRSPKNLVDLSNLEVREAKNVVDNIVTNVEVPVFANHFDIEVEYHDRGN 256
            +N  +  +IE+++               + V+    + V VP F NHF+I V+YH R  
Sbjct: 176 -RNQEEPGEIELQT---------------RRVLQPGESVVAVPYFINHFEITVDYHKRAE 219

Query: 257 GDFRVVGVIVNPVSLDNYKSRSCALANQHKLHLDENKDNEVMFTYSVKFTPSDTPWATRW 316
            + RVVGV V P SL N     CA  + + L L E  D +V FTYSV+F  SD  WATRW
Sbjct: 220 DELRVVGVSVLPRSLQNPVGDKCA-NSGNGLVLSETADTKVTFTYSVRFHESDVSWATRW 278

Query: 317 DKYLHIYDPKIQWFSLINFSVIVLLLSSVAIHSLLRALKSDISRYNEFNLGDEFEEDSGW 376
            KYLH+YDPK+QW+SLINFS++VLLLSS+ +HSL RALK+D+ RYN+FNL +EF+ED GW
Sbjct: 279 GKYLHVYDPKVQWYSLINFSLVVLLLSSIMVHSLFRALKTDLDRYNDFNLDNEFQEDYGW 338

Query: 377 KLVHGDVFRTPKNSMLLSVLVGSGXXXXXXXXXXXXXXXXXXXXXXXRGSLPTAMFMFYA 436
           KL+H DVFR+P  ++LLSV VGSG                       RGSL T MF+ YA
Sbjct: 339 KLLHSDVFRSPSKTLLLSVFVGSGGQLFLMSACTLFIAMLGFLSPSSRGSLGTIMFVLYA 398

Query: 437 IFGFVGSYTSMGIYKFFKGPYWKANMILTPVLLPGIIFLTVIFMNVLLYFVGSSNVIPLA 496
           IFG  GSY SM  YK F G  WK NM+LTP+L+PGIIF T++ MN  L  V SS  +P  
Sbjct: 399 IFGGFGSYLSMSTYKMFGGEKWKVNMVLTPLLVPGIIFATMLLMNFFLVMVQSSGAMPFG 458

Query: 497 TLVFMVFLWILFSIPLAFAGSLISYKKCNWDEHPTKTNEIPRQIPFQPWFLKTVPATLIG 556
           T++ +V LW + SIP++  GSL + KK  WD+HPTKT++I +QIP QPW+L+T PA  I 
Sbjct: 459 TMLAIVVLWFVLSIPISIMGSLFARKKNTWDQHPTKTSQIAKQIPPQPWYLRTWPAAYIA 518

Query: 557 GLVSFGSIAVELYFIYSSLWFNKIFYMFGFLLFSIVLFSFTTGLINVIITYRALCSENWT 616
           GL  FG+IAVELYFIY+S+WFN +FYMFGFL F+ +L + TT L+ +++TY +LC ENW+
Sbjct: 519 GLFPFGAIAVELYFIYTSIWFNTMFYMFGFLFFTFLLLTLTTALVTILLTYYSLCMENWS 578

Query: 617 WQWRSFFIGGLGCSIYIFIHSILFTQFKLGGFATIVLYVGYSFLISFLTCIVTGAIGFIC 676
           WQWRSF IGG+GCS Y+FI+SILFT+F+LGGF TIVLYVGYS LISFL C+VTG IGF+ 
Sbjct: 579 WQWRSFIIGGIGCSTYVFINSILFTKFRLGGFVTIVLYVGYSLLISFLFCLVTGTIGFVS 638

Query: 677 SMFFVRRIFASIKVD 691
           S++FVR+I++SIKVD
Sbjct: 639 SLWFVRKIYSSIKVD 653

>Ecym_4317 Chr4 (685854..687671) [1818 bp, 605 aa] {ON} similar to
           Ashbya gossypii AGR097W
          Length = 605

 Score =  519 bits (1337), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 293/691 (42%), Positives = 409/691 (59%), Gaps = 88/691 (12%)

Query: 1   MVRQLLVLSLFVASTLGFYLPGAAPRTYKQGDAIPLLVNHLTPSLNFQHVDDDGNEIKGD 60
           ++R  L+ +     + GFY PG +P TY  GD IPLLVN+L+                  
Sbjct: 3   LIRSFLLCA---GVSYGFYFPGVSPVTYHIGDEIPLLVNYLS------------------ 41

Query: 61  KARMLYPYDYYNEKLHFCQPEKIEKQPESLGSVIFGEKIYNSPFNVKMLEDNECVQLCST 120
            +  L+  DYY++ +  C+P  I++Q ESLGSVIFG+++YNSPF V ML+++ECV+LC T
Sbjct: 42  -SDFLWNIDYYSDSIGLCKPNTIKEQSESLGSVIFGDRLYNSPFKVSMLKNSECVKLCDT 100

Query: 121 TIPGKDAKFINKLIKNGFMQNWLIDGLPAARKLHDSRTNTEFYGQGFELGFVEVRQAVGG 180
           TI   D    N      +  NWL+DGLP                    LG      A G 
Sbjct: 101 TI---DTALWNTFFGYRYSYNWLVDGLPV-------------------LGIDGTSDANGY 138

Query: 181 KIVSESEKELQLSERDAKNIIDFTDIEIRSPKNLVDLSNLEVREAKNVVDNIVTNVEVPV 240
              SE     Q  E+  K I +  DI I                                
Sbjct: 139 HNNSELFMGYQADEQ--KYIYNHFDIYIH------------------------------- 165

Query: 241 FANHFDIEVEYHDRGNGDFRVVGVIVNPVSLDNYKSRSCALANQHKLHLDENKDNEVMFT 300
                     Y+DRG G++RVV     P+SL    S  C+  +   + +       + FT
Sbjct: 166 ----------YNDRGKGEYRVVFAEAKPISLPRTGSELCS-KDAKPVPIGSGNHENITFT 214

Query: 301 YSVKFTPSDTPWATRWDKYLHIYDPKIQWFSLINFSVIVLLLSSVAIHSLLRALKSDISR 360
           YSV F  SD  W+TRWD+YLH+YD  IQ   LI+FS++VLLLSSV +HSL R LK DI+ 
Sbjct: 215 YSVIFKKSDISWSTRWDQYLHVYDFDIQLAELISFSLVVLLLSSVLVHSLFRVLKRDIAA 274

Query: 361 YNEFNLGDEFEEDSGWKLVHGDVFRTPKNSMLLSVLVGSGXXXXXXXXXXXXXXXXXXXX 420
           Y+EFNL DEF++D  WK++HG+VFR+P  ++LLSV VGSG                    
Sbjct: 275 YSEFNLDDEFQQDYCWKIIHGEVFRSPSKALLLSVFVGSGSQLFFMALCTVLLGSCGFLS 334

Query: 421 XXXRGSLPTAMFMFYAIFGFVGSYTSMGIYKFFKGPYWKANMILTPVLLPGIIFLTVIFM 480
              RGSL T MF+ YA+FG VGSYTSM IYKFF G  WK N+ILTP+L+P  +F+T + +
Sbjct: 335 PSARGSLGTVMFVLYALFGGVGSYTSMSIYKFFGGQNWKLNLILTPLLIPVFLFVTTVLL 394

Query: 481 NVLLYFVGSSNVIPLATLVFMVFLWILFSIPLAFAGSLISYKKCNWDEHPTKTNEIPRQI 540
           N  L +  SS  +P  T+V ++ LW + S+P++  GSL+S+K   WDEHP KTN+I RQ+
Sbjct: 395 NFFLIYAKSSGAMPFGTMVTIIILWFILSVPVSIIGSLLSWKLNRWDEHPAKTNQIARQV 454

Query: 541 PFQPWFLKTVPATLIGGLVSFGSIAVELYFIYSSLWFNKIFYMFGFLLFSIVLFSFTTGL 600
           P QPW++KT  AT + G+  FG++AVELY+IY+S+W   IF+M+GFL  + +L + TT L
Sbjct: 455 PSQPWYIKTWVATFLAGMFPFGAMAVELYYIYASIWGEIIFFMYGFLFVAFILLTLTTSL 514

Query: 601 INVIITYRALCSENWTWQWRSFFIGGLGCSIYIFIHSILFTQFKLGGFATIVLYVGYSFL 660
           + +++TY +LC ENW WQWRSF IGG+GCS+Y+F+HS+ F +FK  GF ++VLY+GYS +
Sbjct: 515 VTILLTYYSLCMENWKWQWRSFIIGGVGCSVYVFLHSLFFIKFKFPGFVSMVLYLGYSAM 574

Query: 661 ISFLTCIVTGAIGFICSMFFVRRIFASIKVD 691
           +S + C+VTG+IGF+ +++FVR+I+++IKVD
Sbjct: 575 VSIVCCLVTGSIGFLANLWFVRKIYSNIKVD 605

>NDAI0A01510 Chr1 (335693..337732) [2040 bp, 679 aa] {ON} Anc_7.411
           YER113C
          Length = 679

 Score =  154 bits (390), Expect = 8e-39,   Method: Compositional matrix adjust.
 Identities = 175/713 (24%), Positives = 292/713 (40%), Gaps = 137/713 (19%)

Query: 25  PRTYKQGDAIPLLVNHLTPSLNFQHVDDDGNEIKGDKARMLYPYDYYNEKLHFCQPEKIE 84
           P  Y QGD + L+VN                +++ D  ++  PY YY+  L F  P  + 
Sbjct: 43  PNFYFQGDEVELIVN----------------KVESDLTQL--PYAYYD--LPFTCPPTMH 82

Query: 85  KQPE--SLGSVIFGEKIYNSPFNVKMLEDNECVQLCSTTIPGKDAKFINKLIKNGFMQNW 142
           K+P   SL  +I G++ + S + +K  +D+ C  LC+     +  K   KL+++G++  W
Sbjct: 83  KKPLHLSLNEIIRGDRKWQSDYILKFGQDDTCHILCTRKTTKEGLKNAKKLVEDGYVVQW 142

Query: 143 LID-GLPAARKLHDSRTNTEFYGQGFELGFVEVRQAVGGKIVSESEKELQLSERDAKNII 201
           LID  LPAA     +    ++Y  GF LGFV                     + D   + 
Sbjct: 143 LIDEELPAATTFISTIDQKKYYASGFPLGFV---------------------DPDTGKVY 181

Query: 202 DFTDIEIRSPKNLVDLSNLEVREAKNVVDNIVTNVEVPVFANHFDIEVEYHDRGNGDFRV 261
             T + +    N VD++                         H  +  E + +   DF  
Sbjct: 182 LNTHVMLVIRYNTVDVN------------------------KHTIVGFEVYPKSVSDFHC 217

Query: 262 VGVIVNPVSLDNYKSRSCALANQHKLHLDENKDNE--VMFTYSVKFTPSD-TPWATRWDK 318
                 P +  NY+         +++ + EN D+   + FTYSV +       W  RWD 
Sbjct: 218 ------PGASKNYEP--------YEIVIPENDDDLTFIPFTYSVYWREEYLVDWDHRWDL 263

Query: 319 YLHIYD------PKIQWFSLINFSVIVLLLSSVAIHSLLRALKS------DISRYNEFNL 366
           YL+  +       +  W SL N + IV L+S V    LLR+ KS      DI++  E   
Sbjct: 264 YLNSGELSENKTTQFHWISLANSAGIVFLMSFVVSVILLRSFKSSRDISTDINKSEEHRN 323

Query: 367 GDEFEEDSGWKLVHGDVFRTPKNSMLLSVLVGSGXXXXXXXXXXXXXXXXXXXXXXXRGS 426
           G  +E    W +      RTP  ++L+ + V  G                         S
Sbjct: 324 GLVYEVARNWIINE----RTPLANLLI-LFVSMGVQFLFTVLGSLTISCSLNKLHDIGDS 378

Query: 427 LPTAMFMFYAIFGFVGSYTSMGIYKFFKGPYWKAN----------MILTPVLLPGIIFLT 476
           + T   + + +  F+ SY    + +       K             IL    LPGI+ + 
Sbjct: 379 VLTMAVLCFVLGAFMSSYIGSVLLRLKNKATMKKQPIKKGFHLFFAILCGSFLPGIVMIV 438

Query: 477 VIFMNVLLYFVGSSNVIPLATLVFMVFLWILFSIPLAFAGSLI---SYKKCNWDEHPTKT 533
            + +N +++   S++ +P  T+V  + ++ +  IPL+  G  +   S  K +  +    T
Sbjct: 439 TLLLNSIVWAHDSTHALPFKTVVMFITVYFIVCIPLSILGGYMANSSKTKGSLTDPKFHT 498

Query: 534 NEIPRQI------PFQPWFL--------KTVPATLIGGLVSFGSIAVELYFIYSSLWFNK 579
           +    ++      P +  FL        K     L+ G+  F  I VEL ++Y S+W  K
Sbjct: 499 SRPELELFANKLKPKKHIFLFGARLKSIKIALPILLSGIFPFVIIYVELQYVYKSVWLEK 558

Query: 580 --IFYMFGFLLFSIVLFSFTTGLINVIITYRALC---SENWTWQWRSFFIGGLGCSIYIF 634
              +Y +GFL  +I+L     G I +I TY  L      N  W+W SFF+G   C+ Y+ 
Sbjct: 559 TAFYYFYGFLFANILLLCIVVGEIAIIGTYTMLHMADRNNTDWRWISFFMGS-SCAWYME 617

Query: 635 IHSILFTQFKLG--GFATIVLYVGYSFLISFLTCIVTGAIGFICSMFFVRRIF 685
           ++S+ +  F L   GF++I + V Y  L + L     G+I  + S FFV +++
Sbjct: 618 LYSLYYVFFILNIRGFSSIFISVCYGALFNTLCGCAMGSIASLTSHFFVEKLY 670

>YER113C Chr5 complement(387932..390052) [2121 bp, 706 aa] {ON}
           TMN3Protein with a role in cellular adhesion and
           filamentous growth; similar to Emp70p and Tmn2p; member
           of Transmembrane Nine family with 9 transmembrane
           segments; localizes to Golgi; induced by
           8-methoxypsoralen plus UVA irradiation
          Length = 706

 Score =  145 bits (367), Expect = 8e-36,   Method: Compositional matrix adjust.
 Identities = 161/729 (22%), Positives = 298/729 (40%), Gaps = 148/729 (20%)

Query: 24  APRTYKQGDAIPLLVNHLTPSLNFQHVDDDGNEIKGDKARMLYPYDYYNEKLHFCQPEKI 83
            P  Y++GD + L+VN                +++ D  ++  PY YY+  L F  P  +
Sbjct: 53  TPNFYRKGDPLELIVN----------------KVESDLTQL--PYAYYD--LPFTCPPTM 92

Query: 84  EKQPE--SLGSVIFGEKIYNSPFNVKMLEDNECVQLCSTTIPGKDAKFINKLIKNGFMQN 141
            K+P   SL  +I G++ + S + +K  EDN C  LC+     +  + ++KL++ G++  
Sbjct: 93  HKKPLHLSLNEIIRGDRKWESDYKLKFGEDNPCETLCARKTTKEGMQTLDKLVREGYVVQ 152

Query: 142 WLIDG-LPAARKLHDSRTNTEFYGQGFELGFVEVRQAVGGKIVSESEKELQLSERDAKNI 200
           WLID  LPAA     +  + ++Y  GF LGF++                    + D   +
Sbjct: 153 WLIDDELPAATTFISTTDHKKYYASGFPLGFID-------------------PDTDKTYL 193

Query: 201 IDFTDIEIRSPKNLVDLSNLEVREAKNVVDNIVTNVEVPVFANHFDIEVEYHDRGNGDFR 260
            +   + IR               A +   N +   EV             + R   D+ 
Sbjct: 194 HNHVMLVIRF-------------HASDNDKNTIVGFEV-------------YPRSVSDYH 227

Query: 261 VVGVIVNPVSLDNYKSRSCALANQHKLHLDENKDNEVMFTYSVKFTPS-DTPWATRWDKY 319
                  P +  NY+     +         EN+   + FTYSV +    +  W  RWD +
Sbjct: 228 C------PGASKNYEQYEIVIPED------ENELTYLPFTYSVYWREEFEVDWNHRWDYF 275

Query: 320 LHIYD------PKIQWFSLINFSVIVLLLSSVAIHSLLRALKSDISRYNE---------F 364
           L+  +       +  W SL N   IVL +S + +   +R + +D S              
Sbjct: 276 LNAGELSDEQSIQFHWMSLANSVGIVLSISFITLIIYVRVMYTDKSNSKSPKYMINIEGI 335

Query: 365 NLGDEFEEDSGWK----LVHGDVFRTPKNSM----LLSVLVGSGXXXXXXXXXXXXXXXX 416
              D+ ++D   K     V  D  +  + ++    +L +LV  G                
Sbjct: 336 ETEDDLDDDKYGKYSVYTVAKDWIQNGRPNLFGLKVLILLVSFGVQFLFTIIGSLTISCS 395

Query: 417 XXXXXXXRGSLPTAMFMFYAIFGFVGSYTSMGIYKFFKGPYWKAN--------------- 461
                  R S+ T   +F+ +  F+ S+    +    K    KAN               
Sbjct: 396 MNKLHNVRNSVLTMAILFFVLGAFMASFVGTRLSMVTKTKRTKANYLDDNRYLKDYKKFS 455

Query: 462 ---MILTPVLLPGIIFLTVIFMNVLLYFVGSSNVIPLATLVFMVFLWILFSIPLAFAGSL 518
               IL    LPGI+ ++   +N +++   S++ +P  T+VF + ++ +  IPL+  G +
Sbjct: 456 PIFTILCGSSLPGIVMVSTFLLNSIVWAHDSTSALPFKTIVFFMSIYFIVCIPLSLFGGI 515

Query: 519 IS---------YKKCNWDEHPTKTNE--IPR-QIPFQPWFLKTVPATLIGGLVSFGSIAV 566
           ++               DE  +  N   +P+ +  F P          + G+     I V
Sbjct: 516 VANNIPLPQYWLSGITKDESNSDGNGLFVPKSRAKFNPL---VYCGIYLCGIFPLLVIYV 572

Query: 567 ELYFIYSSLWFNKI--FYMFGFLLFSIVLFSFTTGLINVIITYRAL--CSENW----TWQ 618
           E+ ++Y SLW  K   +Y +GFL  SI+L    T  I++I +Y  +  C E+      W+
Sbjct: 573 EMQYVYKSLWLEKTTFYYFYGFLFLSIILLCVLTMEISIIGSYLLMRFCFEDKVVRNNWR 632

Query: 619 WRSFFIGGLGCSIYIFIHSI--LFTQFKLGGFATIVLYVGYSFLISFLTCIVTGAIGFIC 676
           W+ F +G  G  +Y+ ++S+  +F    + GF++I++ + YS + + +  +  GA+ ++ 
Sbjct: 633 WKCFEMGFSG-GVYMELYSLYYIFAVLNIHGFSSILISICYSLIFNVMCSLGLGALSYLT 691

Query: 677 SMFFVRRIF 685
           + +F+ +I+
Sbjct: 692 ASWFINKIY 700

>NCAS0A14520 Chr1 complement(2860704..2862716) [2013 bp, 670 aa]
           {ON} Anc_7.411 YER113C
          Length = 670

 Score =  123 bits (309), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 130/487 (26%), Positives = 216/487 (44%), Gaps = 51/487 (10%)

Query: 243 NHFDIEVEYHDRGNGDFRVVGVIVNPVS-LDNYKSRSCALANQHKLHLDENKDNE--VMF 299
            H  I + Y+        + G  + P S +D +   +     Q++L + EN D+   + F
Sbjct: 185 THVMIVIRYNTVDTNKHTIFGFELYPKSTVDFHCPGASKDYEQYELVVPENDDDLTFIPF 244

Query: 300 TYSVKFTPSD-TPWATRWDKYLHIYD------PKIQWFSLINFSVIVLLLSSVAIHSLLR 352
           TYSV +       W  RWD YL+  +       +  W SL N   IV L+SS+    L R
Sbjct: 245 TYSVYWREEYLVDWEHRWDLYLNAGELSNDKSKQFHWISLANSFGIVFLISSITAVILYR 304

Query: 353 ALKSDISRYNEFNLGDEFEEDSGWKLVHGDVF----RTPKNSMLLSVLVGSGXXXXXXXX 408
             K  ISR +  ++  E E+D G   V    +    +TP  ++L+ + V  G        
Sbjct: 305 TFK--ISRRSFSDISKE-EDDKGSIYVVARKWLLNEQTPLANVLI-IFVSMGVQFLFTVL 360

Query: 409 XXXXXXXXXXXXXXXRGSLPTAMFMFYAIFGFVGSYTSMGIYKFFK----------GPYW 458
                          R S+ T   + +    F+ S+T   + K  +            Y+
Sbjct: 361 GSLIISCSLKKLHNVRDSVLTMGLLCFVTGAFMASFTGAHLLKSREEMCSESQMKPTRYY 420

Query: 459 KANMILTPVLLPGIIFLTVIFMNVLLYFVGSSNVIPLATLVFMVFLWILFSIPLAFAGSL 518
               +L   LLP  + L  + +N +++   S++ +P  T++F++ ++ +  IPL+  G  
Sbjct: 421 PVFALLCGSLLPSFVMLVALLLNSIVWAHDSTHALPFGTVLFLISVYFVVCIPLSLLGGY 480

Query: 519 ISYKKCNWDEHPTKTNEIP---------RQIPFQPWFLKTVP----ATLIGGLVSFGSIA 565
           I+ K  N    P+ +  I          + I   P  L   P    A L GGL  F  I 
Sbjct: 481 IAVKSTN--SKPSFSFSIGNYSDRIFVYKTITMSPSVLINRPLSSLAILAGGLFPFIIIY 538

Query: 566 VELYFIYSSLWFNKI--FYMFGFLLFSIVLFSFTTGLINVIITYRALCSENW---TWQWR 620
           VEL ++Y SLW  K   +Y +GFLL +I+L       I++I T+  L S +     W+W 
Sbjct: 539 VELQYVYKSLWLEKTTFYYFYGFLLANILLLCIVICEISIIGTFILLNSADKNSNNWRWT 598

Query: 621 SFFIGGLGCSIYIFIHSILFTQFKLG--GFATIVLYVGYSFLISFLTCIVTGAIGFICSM 678
           SF IG   C+ Y+ ++S+ +  F L   GF++I + V Y  L + +    TG+I  + S 
Sbjct: 599 SFQIGA-SCAFYMEVYSLYYVFFILNIRGFSSIFISVCYGTLFNIMCGCATGSIACLTSH 657

Query: 679 FFVRRIF 685
           +FV++I+
Sbjct: 658 WFVQKIY 664

 Score = 75.1 bits (183), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 46/152 (30%), Positives = 76/152 (50%), Gaps = 23/152 (15%)

Query: 25  PRTYKQGDAIPLLVNHLTPSLNFQHVDDDGNEIKGDKARMLYPYDYYNEKLHFCQPEKIE 84
           P  Y +GD + L+VN                +++ D  ++  PY YY+  L F  P  + 
Sbjct: 44  PNYYSKGDPVELIVN----------------KVESDLTQL--PYAYYD--LPFTCPPTMH 83

Query: 85  KQPE--SLGSVIFGEKIYNSPFNVKMLEDNECVQLCSTTIPGKDAKFINKLIKNGFMQNW 142
           K+P   SL  +I G++ + S + +   ED++C  LC+     +  K   +L+KNG++  W
Sbjct: 84  KKPLHLSLNEIIRGDRKWQSDYILNFGEDDQCHILCTRKTTKEGMKEAQELVKNGYVVQW 143

Query: 143 LIDG-LPAARKLHDSRTNTEFYGQGFELGFVE 173
           LID  LPA      +  + ++Y  GF LGFV+
Sbjct: 144 LIDDELPAVTTFISTTDHKKYYASGFPLGFVD 175

>KNAG0C03430 Chr3 (674411..676453) [2043 bp, 680 aa] {ON} Anc_7.411
           YER113C
          Length = 680

 Score =  122 bits (305), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 124/507 (24%), Positives = 227/507 (44%), Gaps = 68/507 (13%)

Query: 243 NHFDIEVEYHDRGNGDFRVVGVIVNPVSLDNYKSRSCALA-NQHKLHLDE--NKDNEVMF 299
           NH  + + YH   + +F +VG  + P S+ +Y     +   +Q+++ + E  N+D  + F
Sbjct: 176 NHVMMVIRYHAIDDYNFTIVGFEIYPKSVSDYHCPGASKDYDQYEVVVPEIANEDTFIPF 235

Query: 300 TYSVKFTPS-DTPWATRWDKYLHIYD------PKIQWFSLINFSVIVLLLSSVA--IHSL 350
           TYSV +    D  W  R++ +    +       K  W SL N + I  L++ +   I   
Sbjct: 236 TYSVYWREEFDVEWKDRYNLFFDSGELSGSVSRKFHWISLANSASIAFLMTFIVSLIFIK 295

Query: 351 LRALKSDISRYNEFNLGDEFEEDSGWKLVHGDVFRTPKNSMLLSVLVGSGXXXXXXXXXX 410
           +  + + +    E      F     W   + D    P    L   +V  G          
Sbjct: 296 ITGIPNRLETKKESPKASIFVIARNW--FYDD---RPVMPHLFICIVSMGVHFLFTVIGS 350

Query: 411 XXXXXXXXXXXXXRGSLPTAMFMFYAIFGFVGSYTSMGIYK------FFKGPYWK--ANM 462
                        R S+ T   +F+ +  F+ S+    +          +G      +N+
Sbjct: 351 LTISCSLNSLHTIRNSVLTMALLFFVLGAFMASFVGGTLLIENNKLIMRRGSLKNVFSNI 410

Query: 463 ILTPV----LLPGIIFLTVIFMNVLLYFVGSSNVIPLATLVFMVFLWILFSIPLAFAGSL 518
           +L  V    LLPG++ LT I +N +++   S+NV+P AT++ ++F++ +  IPL+  G  
Sbjct: 411 LLFSVVCGSLLPGMVILTAIILNCIIWLHTSTNVLPFATIMKLLFIYFIVCIPLSVLGGS 470

Query: 519 IS-------YKKCNWDE----HPTKTNEI-----------PRQIPFQ-PWFLK------- 548
           I+       Y +   D       T+ N+I            R++ ++  W LK       
Sbjct: 471 IAANKDSEEYSRLRSDSIKRISRTRANKIMDEDQGTDVRTTRKLKYKVRWQLKKMMLDTV 530

Query: 549 TVPATLIGGLVSFGSIAVELYFIYSSLWFNKI--FYMFGFLLFSIVLFSFTTGLINVIIT 606
           TV + L  G+  F  I VEL F+Y S+W+ K   +Y +GFLL +I+L       I +I +
Sbjct: 531 TVVSLLASGIFPFIMIYVELQFVYKSVWYEKTTFYYYYGFLLANIILLCLVICDIAIICS 590

Query: 607 YRALC----SENWTWQWRSFFIGGLGCSIYIFIHSI--LFTQFKLGGFATIVLYVGYSFL 660
           Y  +       + +W+W++F +    C+ Y+  +SI  +F    +  F++I++ V YS L
Sbjct: 591 YLMMTVSSKDNSDSWKWKTFQLSS-SCAWYMEAYSIYYVFKVLNMRDFSSILISVCYSLL 649

Query: 661 ISFLTCIVTGAIGFICSMFFVRRIFAS 687
            + L  +  G+IG++ S++FV+R++ S
Sbjct: 650 FNALCGLAMGSIGYLASLWFVKRVYRS 676

 Score = 77.0 bits (188), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 46/153 (30%), Positives = 75/153 (49%), Gaps = 23/153 (15%)

Query: 24  APRTYKQGDAIPLLVNHLTPSLNFQHVDDDGNEIKGDKARMLYPYDYYNEKLHFCQPEKI 83
            P  Y+ GD + ++VN                +I+ D  ++  PY YY+  L F  P  +
Sbjct: 34  TPTIYRHGDPVEIIVN----------------KIESDATQL--PYGYYD--LPFTCPPTV 73

Query: 84  EKQPE--SLGSVIFGEKIYNSPFNVKMLEDNECVQLCSTTIPGKDAKFINKLIKNGFMQN 141
           +K+P   SL  VI G++ + S + ++  +D EC  LC+        + ++K IK  ++  
Sbjct: 74  DKKPLHLSLNEVIRGDRKWQSNYELEFGKDTECTVLCARKTNPDGMRSLDKFIKQEYVVQ 133

Query: 142 WLIDG-LPAARKLHDSRTNTEFYGQGFELGFVE 173
           W ID  LPAA     +    ++YG GF LGFV+
Sbjct: 134 WFIDKELPAATTFISTVDQKKYYGSGFPLGFVD 166

>SAKL0F12914g Chr6 complement(1013914..1016037) [2124 bp, 707 aa]
           {ON} similar to uniprot|P40071 Saccharomyces cerevisiae
           YER113C Hypothetical ORF
          Length = 707

 Score =  113 bits (282), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 131/534 (24%), Positives = 224/534 (41%), Gaps = 114/534 (21%)

Query: 243 NHFDIEVEYHDRGNGDFRVVGVIVNPVSLDNYKSRSCALANQHKLHLDENKDNE----VM 298
           NH  + + YH      F +VG+ V P S+ +Y    C  A+++  H + N +      + 
Sbjct: 199 NHVMLVIRYHTVDINKFTIVGLEVYPKSVSDYH---CPGASKNFDHYEVNTEETETTYIP 255

Query: 299 FTYSVKFTPS-DTPWATRWDKYLHIYD------PKIQWFSLINFSVIVLLLSSVAIHSLL 351
           FTYS+ +    +  W  RW+ +++  +       +  W SL N  VIV L++ V    L 
Sbjct: 256 FTYSIYWREEFNVDWTNRWNFFINSGEISQEKSSQFHWISLANSVVIVTLMTLVVALILA 315

Query: 352 RALKSDIS-RYNEFNLGDEFEEDSGWKLVHGDVFRTPKNSMLLSVLVGSGXXXXXXXXXX 410
           +++ +D +   +   +  ++     + L H +VF       L ++L GS           
Sbjct: 316 KSVSTDETVSTSTSQVASQWVVQHSYLLNHLNVFTAMGVQFLFTIL-GS----------- 363

Query: 411 XXXXXXXXXXXXXRGSLPTAMFMFYAIFGFVGSYTSMGIYKFFKGPYWKANM-------I 463
                        R S+ T   M +      G+YTS      F G    AN        I
Sbjct: 364 LIISCSMNKLHNIRNSVLTMALMCF----ISGAYTSS-----FVGALLSANHNTTIKISI 414

Query: 464 LTPVLLPGIIFLTVIFMNVLLYFVGSSNVIPLATLVFMVFLWILFSIPLAFAGSL---IS 520
                LPG     V+ +N +++   S++ +P  T+V ++ ++ +  IPL+  G +    +
Sbjct: 415 ACGSALPGFTLCVVLILNCIIWAKDSTHALPFGTIVLLITVYFIVCIPLSILGGVSATYT 474

Query: 521 YKKC-----------------NWDEHPTKTNEI--PR-----QIPFQPWFLKTVPATLIG 556
            +KC                 ++D+ P   N++  PR     ++P      + V  T+I 
Sbjct: 475 RRKCLSLDPRSIINRFFLLNIHYDDQPVVENKVHLPRISGNSKLPLM--LRQPVLLTVIS 532

Query: 557 GLVSFGSIAVELYFIYSSLWFNKI--FYMFGFLLFSIVLFSFTTGLINVIITYRAL---- 610
           G+V F  I VEL F+Y SLW  K   +Y++GFLL +IVL       I++I  Y  L    
Sbjct: 533 GIVPFIVIYVELLFVYKSLWLEKTTFYYLYGFLLANIVLLCVVVCEISIIGCYLTLIHVS 592

Query: 611 ------------------------------CSENWT---WQWRSFFIGGLGCSIYIFIHS 637
                                         C+       W+W+SF IGG   + Y+  +S
Sbjct: 593 PDEFIPIATPEQAMHSPMLKQVRVQAMNFVCAIGLAMTQWRWKSFQIGG-SVAWYLEAYS 651

Query: 638 ILF--TQFKLGGFATIVLYVGYSFLISFLTCIVTGAIGFICSMFFVRRIFASIK 689
           + +  T  K+  F++I+L+  YS L +FL     GA+G++   +FV RI  + K
Sbjct: 652 LYYFLTVLKIRDFSSILLFFCYSALFNFLCWCSFGALGYLSCCWFVNRIHTNSK 705

 Score = 69.7 bits (169), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 42/151 (27%), Positives = 74/151 (49%), Gaps = 21/151 (13%)

Query: 25  PRTYKQGDAIPLLVNHLTPSLNFQHVDDDGNEIKGDKARMLYPYDYYNEKLHFCQPEKIE 84
           P  Y++ D + ++VN                +I+ D  +  +PY YY E    C P  ++
Sbjct: 58  PNVYEENDPVEIIVN----------------KIESDLTQ--FPYAYY-ELPFTCPPTNVK 98

Query: 85  KQPE-SLGSVIFGEKIYNSPFNVKMLEDNECVQLCSTTIPGKDAKFINKLIKNGFMQNWL 143
           K    SL  +I G++ + S + +   +D  C++LC         +  ++LIK G++  WL
Sbjct: 99  KPLHLSLNEIIRGDRKWQSDYLLHFKKDEHCLRLCDRKTSPDALRKAHELIKQGYVVQWL 158

Query: 144 IDG-LPAARKLHDSRTNTEFYGQGFELGFVE 173
           ID  LPAA     ++ + ++Y  GF LGF++
Sbjct: 159 IDDELPAATTFISTKDHKKYYASGFPLGFMD 189

>Smik_5.258 Chr5 complement(396781..398901) [2121 bp, 706 aa] {ON}
           YER113C (REAL)
          Length = 706

 Score =  112 bits (280), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 122/518 (23%), Positives = 229/518 (44%), Gaps = 76/518 (14%)

Query: 243 NHFDIEVEYHDRGNGDFRVVGVIVNPVSLDNYKSRSCALA-NQHKLHL--DENKDNEVMF 299
           NH  + + +H   NG   +VG  V P S+ +Y     +    Q+++ +  DEN+   + F
Sbjct: 195 NHVMLVIRFHSGDNGKNTIVGFEVYPRSVSDYHCPGASKTYEQYEITIPEDENELTYLPF 254

Query: 300 TYSVKFTPS-DTPWATRWDKYLHIYD------PKIQWFSLINFSVIVLLLSSVAIHSLLR 352
           TYSV +    +  W  RWD +L+  +       +  W S  N  +IVL +S + +   + 
Sbjct: 255 TYSVYWREEFEVDWNHRWDYFLNSGELSDEQSSQFHWMSFANSVIIVLSISLITLIIYIG 314

Query: 353 ALKSDIS--RYNEFNLG------------DEFEEDSGWKLVHGDVFRTPKNSML----LS 394
            + +D +    N+F +             D++ ++S + +V  D  +  K  +     L 
Sbjct: 315 VMHTDKNNPHSNKFMINIEGIGAEDVLNNDKYSKNSVY-MVAKDWIQNGKPDLFSLKGLI 373

Query: 395 VLVGSGXXXXXXXXXXXXXXXXXXXXXXXRGSLPTAMFMFYAIFGFVGSYTSMGIYKFFK 454
           VLV  G                       R S+ T   + + I  F+ S+    +    K
Sbjct: 374 VLVSFGVQFLFTVIGSLTISCSMNKLHNVRNSVLTMAILCFVIGAFMASFVGTRLSIVSK 433

Query: 455 GPYWKANMI-----------LTPVL-------LPGIIFLTVIFMNVLLYFVGSSNVIPLA 496
              + AN              +P+        LPG+I ++   +N +++   S+N +P  
Sbjct: 434 TRRFNANYFGDNKNFKCREKFSPIFAIICGSSLPGMIMISTFLLNSIVWAHDSTNALPFK 493

Query: 497 TLVFMVFLWILFSIPLAFAGSLIS---------YKKCNWDEHPTKTNEIPRQIPFQPWFL 547
           T+VF + ++ +  IPL+  G +++               DE  +K N++   +P  P   
Sbjct: 494 TIVFFISVYFIVCIPLSLFGGIVANNIPLPQYWLSGITIDESDSKNNKL--FLPKSP--N 549

Query: 548 KTVPATLIG----GLVSFGSIAVELYFIYSSLWFNKI--FYMFGFLLFSIVLFSFTTGLI 601
           K  P    G    G+     I VE+ ++Y SLW  K   +Y +GFL  SI+L    T  I
Sbjct: 550 KFNPLVNCGIYLCGVFPLLVIYVEMQYVYKSLWLEKTTFYYFYGFLFLSIILLCVLTMEI 609

Query: 602 NVIITYRAL--CSENW----TWQWRSFFIGGLGCSIYIFIHSI--LFTQFKLGGFATIVL 653
           +VI +Y  +  C E+      W+W+ F +G  G  +Y+ ++S+  +F    + GF++I++
Sbjct: 610 SVIGSYLLMRFCFEDKVVRNNWRWKCFEMGFSG-GVYMELYSLYYIFAVLNIHGFSSILI 668

Query: 654 YVGYSFLISFLTCIVTGAIGFICSMFFVRRIFASIKVD 691
            + YS L + +  +  GA+ ++ + +F+ +I+  +KV+
Sbjct: 669 SICYSLLFNIMCGLGLGALSYLTASWFINKIY-HVKVN 705

 Score = 77.8 bits (190), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 52/174 (29%), Positives = 83/174 (47%), Gaps = 23/174 (13%)

Query: 3   RQLLVLSLFVASTLGFYLPGAAPRTYKQGDAIPLLVNHLTPSLNFQHVDDDGNEIKGDKA 62
           RQ    S+  +S    Y     P  YK GD + L+VN                +++ D  
Sbjct: 32  RQQGQNSIIYSSQSNLYDGWITPNFYKNGDPLELIVN----------------KVESDLT 75

Query: 63  RMLYPYDYYNEKLHFCQPEKIEKQPE--SLGSVIFGEKIYNSPFNVKMLEDNECVQLCST 120
           ++  PY YY+  L F  P  + K P   SL  +I G++ + S + +   EDN C  LC+ 
Sbjct: 76  QL--PYAYYD--LPFTCPPTMHKTPLHLSLNEIIRGDRKWESDYKLTFGEDNPCEVLCAR 131

Query: 121 TIPGKDAKFINKLIKNGFMQNWLIDG-LPAARKLHDSRTNTEFYGQGFELGFVE 173
               +  + ++KLI+ G++  WLID  LPAA     +  + ++Y  GF LGF++
Sbjct: 132 KTTKEGMQTLDKLIREGYVVQWLIDDELPAATTFISTTDHKKYYASGFPLGFMD 185

>CAGL0G03487g Chr7 complement(337133..339247) [2115 bp, 704 aa] {ON}
           similar to uniprot|P40071 Saccharomyces cerevisiae
           YER113c
          Length = 704

 Score =  111 bits (277), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 135/522 (25%), Positives = 227/522 (43%), Gaps = 87/522 (16%)

Query: 243 NHFDIEVEYHDRGNGDFRVVGVIVNPVSLDNYKSRSCALANQHKLHLD---ENKDNEVMF 299
           NH  + + YH     +F +VG  V P S+ +Y    C  AN++    +     KD+E+ F
Sbjct: 194 NHVMLVIRYHPVSEEEFTIVGFEVYPKSVSDYH---CPGANKNHDKYEIIVPEKDDELTF 250

Query: 300 ---TYSVKFTPS-DTPWATRWDKYLHIYD------PKIQWFSLINFSVIVLLLSSVAIHS 349
              TYSV +    +  W  RW+ +L+  +       +  W S +N SV +  +++  +  
Sbjct: 251 IPFTYSVYWREEFEVDWNHRWNYFLNNGELSNSKANQFHWMSFLN-SVGIASMTTTIVSI 309

Query: 350 LLRALKSDISRYNE-----FNLGDEFEEDSGWKLVHGDVFRTPKNSML---------LSV 395
           +L  + S   R +       NLG + E+D+  K + G VF   K  +          L  
Sbjct: 310 ILLKIFSKKERESRNINTSTNLGQDNEDDNDDK-ISGSVFVNAKTWITVGKIPYWKALIC 368

Query: 396 LVGSGXXXXXXXXXXXXXXXXXXXXXXXRGSLPTAMFMFY----AIFGFVGSYTSMGIYK 451
           L   G                       R ++ T   + +    AI G++GS   +  Y+
Sbjct: 369 LTSMGIQFSFTILGSLIISCSLSKLHNIRFTVLTMSLICFICGAAISGYIGSRLYIE-YQ 427

Query: 452 FFKGPYWKANMILTPVL---------LPGIIFLTVIFMNVLLYFVGSSNVIPLATLVFMV 502
             KG Y +  +  T V          LPG++ +    +N ++    S+N +P  T VF+V
Sbjct: 428 ILKG-YLRNEVNRTKVYKFSVVCGSSLPGLLMVISFSLNCIILAHDSTNALPFKTEVFLV 486

Query: 503 FLWILFSIPLAFAGSLISYKKCNWDEHPT-------KTNEIPRQIPFQPWFLKTVP---- 551
            ++ +  IPL+  G +++   C  D + T       + N I R+   +  F K V     
Sbjct: 487 SIYFVTCIPLSLLGGVLAL-NCKVDSYNTLKRITSLRRNTISRKS--RSDFTKKVSLYQR 543

Query: 552 -------------ATLIGGLVSFGSIAVELYFIYSSLWFNKI--FYMFGFLLFSIVLFSF 596
                          L GG  SF  I VEL ++Y S+W  K   +Y +GFLL +I++ S 
Sbjct: 544 LVFDIKHDSFTTFGALAGGFFSFIIIWVELQYVYKSVWLEKTSFYYYYGFLLANILILSI 603

Query: 597 TTGLINVIITYRALCSEN-----WTWQWRSFFIGGLGCSIYIFIHSILFTQFKLG--GFA 649
            T  I +I  Y  L ++N      TW W+SF +G   C+ Y+ ++S+ +  F L   GF+
Sbjct: 604 VTIEIAIIGCYVMLKAKNDRYLRHTWGWKSFLMGS-SCAWYMELYSLYYIFFVLNMQGFS 662

Query: 650 TIVLYVGYSFLISFLTCIVTGAIGFICSMFFVRRIFASIKVD 691
           +I + V YS L + +     G++ ++ S   V +I+   KVD
Sbjct: 663 SIFISVCYSLLFNGMCGWALGSLSYLTSYMLVTQIY---KVD 701

 Score = 67.4 bits (163), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 49/176 (27%), Positives = 82/176 (46%), Gaps = 24/176 (13%)

Query: 6   LVLSLFVASTLGFYLPG-AAPRTYKQGDAIPLLVNHLTPSLNFQHVDDDGNEIKGDKARM 64
           ++ S+  A TL +   G   P  YK GD + L+VN                +++ D  ++
Sbjct: 33  IIPSVLSAITLNYNSHGWVNPNLYKIGDHVELIVN----------------KVESDLTQL 76

Query: 65  LYPYDYYNEKLHFCQPEKIEKQPE--SLGSVIFGEKIYNSPFNVKMLEDNECVQLCSTTI 122
             PY YY+  L F  P   EK+P   SL  +  G++ + S + +    D+ C  LC+   
Sbjct: 77  --PYAYYD--LPFICPPTKEKKPLHLSLDEIFRGDRKWQSDYKLSFGIDSPCEILCARKT 132

Query: 123 PGKDAKFINKLIKNGFMQNWLID-GLPAARKLHDSRTNTEFYGQGFELGFVEVRQA 177
             +      +L++ G++  WLID  LPAA     S  + ++Y  GF +G+V+ R  
Sbjct: 133 KKEGMIKAKELVQQGYVTQWLIDESLPAATTFISSTNHNKYYAAGFPVGYVDDRTG 188

>TDEL0C02710 Chr3 complement(474759..476795) [2037 bp, 678 aa] {ON}
           Anc_7.411 YER113C
          Length = 678

 Score =  108 bits (269), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 115/504 (22%), Positives = 211/504 (41%), Gaps = 57/504 (11%)

Query: 235 NVEVPVFANHFDIEVEYHDRGNGDFRVVGVIVNPVSLDNYKSRSCALA-NQHKLHLDENK 293
           + E      H  + + Y+      F +VG  V P S+ +Y     +    Q++L + EN+
Sbjct: 176 DTEKTYLNTHVMMVIRYNAIDPETFTIVGFEVYPKSVSDYHCPGASKGYEQYELIVPENE 235

Query: 294 D--NEVMFTYSVKFTPS-DTPWATRWDKYLH------IYDPKIQWFSLINFSVIVLLLSS 344
           D    + FTYSV +       W+ RW+ +L+          +  W +L N   I  LL  
Sbjct: 236 DELTYIPFTYSVYWREEFKVDWSHRWNFFLNSGEMSEASSRRFHWMTLGNSVGISFLLML 295

Query: 345 VAIHSLLRALKSDISRYNE---FNLGDEFEEDSGWKLVHGDVFRTPKNSM---LLSVLVG 398
           + I +L R ++      +E   F   +  E DS + +    + +T  +S+   +L++ V 
Sbjct: 296 IVIANLYRIVRVGHEAGSEEFQFTFDENEEADSIYGVAKTWLAQTDSSSISFKILTIFVS 355

Query: 399 SGXXXXXXXXXXXXXXXXXXXXXXXRGSLPTAMFMF-----YAIFGFVGSYTSMGIYKFF 453
            G                       R S+ +    F     Y    FVG++  +      
Sbjct: 356 IGVQFLFTIIGSLAFSCSLNKLHNIRNSVLSVASFFLCHWSYLWHLFVGTWLHIDHRTTN 415

Query: 454 KGPYWKANM--ILTPVLLPGIIFLTVIFMNVLLYFVGSSNVIPLATLVFMVFLWILFSIP 511
            G   +     IL    LPG++ ++   +N +++   SS+ +P  T+V  V ++ +  IP
Sbjct: 416 DGSAGRCRTFSILCGSALPGLVMISTQMLNWIVWANESSHALPFRTIVLFVSIYFVICIP 475

Query: 512 LAFAGSLISYKKCNWDEHPTKTNEIPRQIPFQPWFLK--TVPATL--------------- 554
           L+  G  +S++      H  +    P         +K    P TL               
Sbjct: 476 LSLLGEEVSHRV-----HRKQAQNFPILSSLGARSIKPCRAPTTLAPRKISERLTFDFAT 530

Query: 555 --IGGLVSFGSIAVELYFIYSSLWFNKI--FYMFGFLLFSIVLFSFTTGLINVIITYRAL 610
             I G + F  I VEL +IY S+W  K   +Y++GFLL +I+L       ++ +  Y  +
Sbjct: 531 FAICGFLPFAVIYVELQYIYKSVWLEKTDFYYLYGFLLANIILLCIVVCEVSFLGCYVMM 590

Query: 611 CSENW-----TWQWRSFFIGGLGCSIYIFIHSI--LFTQFKLGGFATIVLYVGYSFLISF 663
                     +W+W+ F +G   C+ Y+ ++S+  +F   K+ GF +I + V YS + + 
Sbjct: 591 RKHKRVATFDSWRWKCFMMGT-SCAWYMELYSLYYIFHTLKMTGFPSIFISVSYSLIFNI 649

Query: 664 LTCIVTGAIGFICSMFFVRRIFAS 687
           +     G++G++ S + V R+F +
Sbjct: 650 MCGCGMGSLGYLTSCWLVNRVFCT 673

 Score = 71.6 bits (174), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 45/152 (29%), Positives = 71/152 (46%), Gaps = 23/152 (15%)

Query: 25  PRTYKQGDAIPLLVNHLTPSLNFQHVDDDGNEIKGDKARMLYPYDYYNEKLHFCQPEKIE 84
           P  Y+ GD + LLVN +   L                    +PY YY+  L F  P   +
Sbjct: 43  PNVYRWGDHVELLVNKVESDLT------------------QFPYGYYD--LPFTCPPTED 82

Query: 85  KQPE--SLGSVIFGEKIYNSPFNVKMLEDNECVQLCSTTIPGKDAKFINKLIKNGFMQNW 142
           K+P   SL  +I G++ + S + +K  +D  C  LC+        +   +L++ G++  W
Sbjct: 83  KKPLHLSLNEIIRGDRKWESDYKLKFGQDASCEALCARKTKPAGMRRAQELVRQGYVVQW 142

Query: 143 LIDG-LPAARKLHDSRTNTEFYGQGFELGFVE 173
           LID  LPAA     +  + ++Y  GF LGFV+
Sbjct: 143 LIDQELPAATTFISTIDHKKYYVSGFPLGFVD 174

>KAFR0K01950 Chr11 complement(401168..403162) [1995 bp, 664 aa] {ON}
           Anc_7.411 YER113C
          Length = 664

 Score =  104 bits (259), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 129/500 (25%), Positives = 213/500 (42%), Gaps = 64/500 (12%)

Query: 235 NVEVPVFANHFDIEVEYHDRGNGDFRVVGVIVNPVSLDNYKSRSCALANQHKLHLDENKD 294
           + E     NH  + + YH   +  F +VG+ V P S+ +Y     A  N  +  L  N D
Sbjct: 172 DTETAYLNNHVMLVIRYHAIDDEHFTIVGLEVYPKSVSDYHCPG-ASRNYEQFELVANDD 230

Query: 295 NEVM---FTYSVKFTPS-DTPWATRWDKYLH-------IYDPKIQWFSLINFSVIVLLLS 343
            EV    FTYSV +    D  W  R+  + +       I D K +W  L N S + L +S
Sbjct: 231 EEVTYIPFTYSVYWREEFDVEWKDRYSFFSNSGELSKEITD-KFRWILLANSSGLALFIS 289

Query: 344 SVAIHSLLRALKSDISRYNEFNLGDEFEEDSG------WKLVHGDVFRTPKNSMLLSVLV 397
            +     LR     IS+ N+ N     E   G       K +  D  RT   + L+ VLV
Sbjct: 290 MIVSVIFLR-----ISKKNK-NENSAIESKKGSMDVIARKWLRND--RTIHFNFLI-VLV 340

Query: 398 GSGXXXXXXXXXXXXXXXXXXXXXXXRGSLPTAMFMFYAIFGFVGSYTSMGIYKFFKGPY 457
             G                       R S+ T + +F+ + GF+ S+    +        
Sbjct: 341 SFGVHFAFTLLGSLAISCSLQKFDNIRNSVLTLVLLFFVLGGFMASFVGTCLIMQKNKTM 400

Query: 458 WKANM----------ILTPVLLPGIIFLTVIFMNVLLYFVGSSNVIPLATLVFMVFLWIL 507
           +K ++          +    LLP +I +  IF+N +++  GSS  +PL T++F++ ++ +
Sbjct: 401 YKGSLKRLHYSPLFAMCCGSLLPAVIMIITIFLNNIVWAHGSSRALPLKTILFLISIYFI 460

Query: 508 FSIPLAFAGSLISYKKCNWDEHPTKTNEIPRQIPF---QPWFLKTVPATL---------- 554
             IPL+  G   +   C   +   +    P Q           +T+ +            
Sbjct: 461 VCIPLSLLGGSYASDICQ--KRTLRAFSSPAQQKLAVTNSNLARTIKSIFDDPFSGLLAS 518

Query: 555 IGGLVSFGSIAVELYFIYSSLWFNK--IFYMFGFLLFSIVLFSFTTGLINVIITYRALCS 612
           IGGL  F  I VEL  +Y  +W  K   +Y+  FL  +I++       I +I  Y  + S
Sbjct: 519 IGGLFPFFIIYVELQHVYKFVWLEKASFYYLRWFLFANIIILCIVVVEIAIISAYIMMHS 578

Query: 613 -----ENWTWQWRSFFIGGLGCSIYIFIHSILFTQFKLG--GFATIVLYVGYSFLISFLT 665
                EN +W+WRSF I    C+ Y+ ++S+ +  + L   GF++I+L V  S L + L 
Sbjct: 579 SRSSLEN-SWRWRSFQISS-SCAWYMELYSLYYIFYVLNTTGFSSILLSVCSSALFNGLC 636

Query: 666 CIVTGAIGFICSMFFVRRIF 685
               G+IG++ + +FV R++
Sbjct: 637 GCALGSIGYLATCWFVGRVY 656

 Score = 69.3 bits (168), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 47/154 (30%), Positives = 78/154 (50%), Gaps = 25/154 (16%)

Query: 24  APRTYKQGDAIPLLVNHLTPSLNFQHVDDDGNEIKGDKARMLYPYDYYNEKLHFCQPEKI 83
            P  Y++GD + L+VN                +I+ D  ++  PY YY+  L F  P   
Sbjct: 38  TPNIYRKGDDVELIVN----------------KIESDLTKL--PYGYYD--LPFICPPTN 77

Query: 84  EKQP--ESLGSVIFGEKIYNSPFNVKMLEDNECVQLCS-TTIPGKDAKFINKLIKNGFMQ 140
           +++P   SL  ++ G++ + S +++   +DN+C  LC+  T P    K IN L+K  ++ 
Sbjct: 78  QRKPLHMSLTEILRGDRKWQSDYSLTFGKDNDCAVLCARKTTPEGIQKAIN-LVKKDYIV 136

Query: 141 NWLIDG-LPAARKLHDSRTNTEFYGQGFELGFVE 173
            W ID  LPA+     +  N ++Y  GF LGFV+
Sbjct: 137 QWSIDNDLPASTTFISTSENRKYYIPGFSLGFVD 170

>KLLA0E20835g Chr5 complement(1857426..1859456) [2031 bp, 676 aa]
           {ON} similar to uniprot|P40071 Saccharomyces cerevisiae
           YER113C Hypothetical ORF
          Length = 676

 Score =  102 bits (254), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 157/721 (21%), Positives = 278/721 (38%), Gaps = 169/721 (23%)

Query: 24  APRTYKQGDAIPLLVNHLTPSLNFQHVDDDGNEIKGDKARMLYPYDYYNEKLHF-CQP-E 81
           +P  Y+ GD + + VN +   L                    + Y YY+  LHF C P +
Sbjct: 58  SPNFYEYGDKVDITVNKVESDLTH------------------FSYGYYD--LHFTCPPSQ 97

Query: 82  KIEKQPESLGSVIFGEKIYNSPFNVKMLEDNECVQLCSTTIPGKDAKFINKLIKNGFMQN 141
            ++  P +   +++G K + S + +   +D +CV+LC                       
Sbjct: 98  DMKPLPLTFSDILYGNKKWQSDYQLTFGKDEDCVRLC----------------------- 134

Query: 142 WLIDGLPAARKLHDSRTNTEFYGQGFELGFVEVRQAVGGKIVSESE---KELQLSERDAK 198
                        D +TN E   Q +EL    ++Q    + +++ +       L+ +D K
Sbjct: 135 -------------DRKTNGEGKKQAYEL----IKQNYVVQWLADDDLPGATTYLNTKDKK 177

Query: 199 NIIDFTDIEIRSPKNLVDLSNLEVREAKNVVDNIVTNVEVPVFANHFDIEVEYHDRGNGD 258
                              S   + +     D    N       NH  I + YH    G 
Sbjct: 178 KYYS---------------SGFPLGQYDPETDEAYIN-------NHVMIVIRYHTIDQGK 215

Query: 259 FRVVGVIVNPVSLDNYKSRSCALANQHKLHLDENKDNE----VMFTYSVKFTPS-DTPWA 313
             +VG  V P S+ ++    C  A++       +  NE    + FTY+V +       W 
Sbjct: 216 NTIVGFEVYPKSVSDHH---CPGASKDYTPYKIDPTNEDIEFISFTYAVYWREDFKVDWK 272

Query: 314 TRWDKYLHIYDPK------IQWFSLINFSVIVLLLSSVAIHSLLRALKSDISRYNEFNLG 367
            RW+ +++  + K        W +  N  ++   L  + I ++L+  ++D S   +    
Sbjct: 273 NRWNFFINGGELKESTSNQFHWITFANGIIVTSCLLLIVI-AILKRQETDGSITTQL--- 328

Query: 368 DEFEEDSGWKLVHGDVFRTPKNSMLLSVLVGSGXXXXXXXXXXXXXXXXXXXXXXXRGS- 426
                 + W      +F        L++LV  G                         S 
Sbjct: 329 -----AAEWSKARVPLF------FQLNLLVSMGIHFLFTTLGTLIISCSLNHTHRIGSSV 377

Query: 427 LPTAMFMFYAIFGFVGSYTSMGIYKFFKGPYWK---ANMILTPVLLPGIIFLTVIFMNVL 483
           L  A+F+F +     GS+TS  I    +G   +    N I+    LPGI  + V+ +N +
Sbjct: 378 LTCAVFLFIS-----GSFTSSFIGALLEGQMSQHKLVNSIIFGSTLPGITLVIVLLLNYI 432

Query: 484 LYFVGSSNVIPLATLVFMVFLWILFSIPLAFAGS---------------LISYKKCNWDE 528
           L    ++N +P  T+  +   + +  +P++  G                L S+     ++
Sbjct: 433 LKANNAANTLPHGTVALLFGAYFIVCVPISIIGGKCADRFLKVNSTNTLLNSFALAEVNK 492

Query: 529 HPTKT--NEIPRQIPFQPWFLKT-VPATLIGGLVSFGSIAVELYFIYSSLWFNK--IFYM 583
           H T+    E    IPF    LK  +  TL  GL+ F  I VEL F Y SLW  K  ++Y+
Sbjct: 493 HDTRPLYVESKNSIPF---VLKNPIAITLTFGLIPFALIYVELLFAYKSLWLQKTTLYYL 549

Query: 584 FGFLLFSIVLFSFTTGLINVIITYRALCSEN------W------------TWQWRSFFIG 625
           +GFLL +IV+      L+++I  Y  L   N      W            +W+W++F +G
Sbjct: 550 YGFLLSNIVIVCICICLLSIIGCYIHLNYGNDSLNFKWDNVIGRVLEACHSWRWKAFHMG 609

Query: 626 GLGCSIYIFIHSILFTQF--KLGGFATIVLYVGYSFLISFLTCIVTGAIGFICSMFFVRR 683
           G   + Y+  +SIL+  F  +   F +  L+V YS L + L     G++ ++ S++F+ +
Sbjct: 610 G-AVAWYMEAYSILYLIFVARYRDFISSFLFVCYSTLFNILCWTAFGSLSYLSSLWFIGK 668

Query: 684 I 684
           +
Sbjct: 669 L 669

>Suva_5.234 Chr5 complement(363605..365725) [2121 bp, 706 aa] {ON}
           YER113C (REAL)
          Length = 706

 Score =  101 bits (252), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 120/513 (23%), Positives = 220/513 (42%), Gaps = 73/513 (14%)

Query: 243 NHFDIEVEYHDRGNGDFRVVGVIVNPVSLDNYKSRSCALANQHKLHL----DENKDNEVM 298
           NH  + + +H   N    +VG  V P S+ +Y     A  N  +  +    DEN+   + 
Sbjct: 195 NHVMLVIRFHSGDNDQNTIVGFEVYPRSVSDYHCPG-ASKNYEQYEIVVPEDENELTYLP 253

Query: 299 FTYSVKFTPS-DTPWATRWDKYLHIYD------PKIQWFSLINFSVIVLLLSSVA----I 347
           FTYSV +    +  W  RWD +L+  +       +  W S  N   IVL +S +     I
Sbjct: 254 FTYSVYWREEFEVDWNHRWDYFLNSGELSNEKSAQFHWMSFANSMGIVLSISFITAVIYI 313

Query: 348 HSLLRALK-SDISRY--------NEFNLGDEFEEDSGWKLVHGDVFRTPKNSM----LLS 394
             + R  K +D ++Y         E NL D+    +   +V  D  +  + +M    +L 
Sbjct: 314 QVMHRDKKNTDSTKYLINIEGAEVEDNLDDDKYGKNSVYMVTKDWIQNGRPNMFGLKVLI 373

Query: 395 VLVGSGXXXXXXXXXXXXXXXXXXXXXXXRGSLPTAMFMFYAIFGFVGSYTSMGIYKFFK 454
           VLV  G                       R S+ T   + + +  F+ S+    +    K
Sbjct: 374 VLVSFGVQFLFTVIGSLTISCSMNKLHNVRNSVITMAILCFVLGAFMASFVGTRLSIVTK 433

Query: 455 GPYWKANMI-----------LTPVL-------LPGIIFLTVIFMNVLLYFVGSSNVIPLA 496
               + N +            +PV        LPG++ ++   +N +++   S+N +P  
Sbjct: 434 RRSIEINYLDDSKNFNNCNKFSPVFAIICGSSLPGLVMVSTFLLNSIVWAHDSTNALPFR 493

Query: 497 TLVFMVFLWILFSIPLAFAGSLISYK---KCNWDEHPTKTNE--------IPR-QIPFQP 544
           T+VF + ++ +  IPL+  G  ++       +W    TK           +PR +  F P
Sbjct: 494 TIVFFISVYFIVCIPLSLFGGTVANNIPLPRHWLSGITKDETCGNSSRLFVPRSRTKFNP 553

Query: 545 WFLKTVPATLIGGLVSFGSIAVELYFIYSSLWFNKI--FYMFGFLLFSIVLFSFTTGLIN 602
                +    + GL  F  I VEL ++Y S+W  K   +Y +GFLL +I+L    T  I+
Sbjct: 554 LVYCGI---YLCGLFPFLVIYVELQYVYKSVWLEKTTFYYFYGFLLLNIILLCVLTMEIS 610

Query: 603 VIITYRAL--CSENW----TWQWRSFFIGGLGCSIYIFIHSI--LFTQFKLGGFATIVLY 654
           +I +Y  +  C E+      W+W+ F +G  G  +Y+ ++S+  +F    + GF++ ++ 
Sbjct: 611 IIGSYSLMRFCFEDKDVRNNWRWKCFEMGFSG-GVYMELYSLYYIFAVLNIHGFSSTLIS 669

Query: 655 VGYSFLISFLTCIVTGAIGFICSMFFVRRIFAS 687
           + YS L + +  +  G + ++ + +F+ +I+ S
Sbjct: 670 ICYSLLFNIMCGLGLGGLSYLTASWFINKIYHS 702

 Score = 78.2 bits (191), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 51/174 (29%), Positives = 84/174 (48%), Gaps = 23/174 (13%)

Query: 3   RQLLVLSLFVASTLGFYLPGAAPRTYKQGDAIPLLVNHLTPSLNFQHVDDDGNEIKGDKA 62
           RQ     +F      +Y     P  YK+GD + L+VN                +++ D  
Sbjct: 32  RQQNQEPVFSGQDNTYYDGWITPNFYKKGDPLELIVN----------------KVESDLT 75

Query: 63  RMLYPYDYYNEKLHFCQPEKIEKQPE--SLGSVIFGEKIYNSPFNVKMLEDNECVQLCST 120
           ++  PY YY+  L F  P  + K+P   SL  +I G++ + S + +   EDN C  LC+ 
Sbjct: 76  QL--PYAYYD--LPFTCPPTMHKKPLHLSLNEIIRGDRKWESDYILAFGEDNACQTLCAR 131

Query: 121 TIPGKDAKFINKLIKNGFMQNWLIDG-LPAARKLHDSRTNTEFYGQGFELGFVE 173
               +  + ++KL++ G++  WLID  LPAA     +  + ++Y  GF LGFV+
Sbjct: 132 KTTKEGMQSLDKLVREGYVVQWLIDDKLPAATTFISTTDHKKYYASGFPLGFVD 185

>ZYRO0B03784g Chr2 complement(314902..316878) [1977 bp, 658 aa] {ON}
           similar to uniprot|P40071 Saccharomyces cerevisiae
           YER113C Hypothetical ORF
          Length = 658

 Score = 95.1 bits (235), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 113/481 (23%), Positives = 209/481 (43%), Gaps = 49/481 (10%)

Query: 241 FANHFDIEVEYHDRGNGDFRVVGVIVNPVSLDNYKSRSCALANQHKLHLDENKDNEVMF- 299
           F NH  + + Y+   +    +VG    P S+ +Y     A  +     + +    E+++ 
Sbjct: 182 FNNHVMLVIRYNLVDSDKVTIVGFEAYPKSVSDYHCPG-ASKDFKPFEITDPPLEEIVYI 240

Query: 300 --TYSVKFTP-SDTPWATRWDKYL---HIYDPK---IQWFSLINFSVIVLLLSSVAIHSL 350
             TYSV +   ++  W+ RW  Y+    + D       W +L N   IVL ++ + I +L
Sbjct: 241 PVTYSVYWREDAEIDWSDRWSLYINRAQLADSSSSTFHWMALANSVGIVLFVTFIVIVNL 300

Query: 351 LRALKSDISRYNEFNLGDEFEEDSGWKLVHGDVFRTPKNSML--LSVLVGSGXXXXXXXX 408
           +   ++     NE     E E+ S    V  +  R  +   L  L V V  G        
Sbjct: 301 IMIFRNP----NEQLESKENEDSSDIFNVANNWLRARQGFQLNRLIVCVSMGIQVMFMIL 356

Query: 409 XXXXXXXXXXXXXXXRGSLPT-AMFMFYA---IFGFVGSYTSM----GIYKFFKGPYWKA 460
                          + S+ T A   F A   +  FVG++  M      Y F+   +   
Sbjct: 357 GPLAISLSLTRLHNIKNSVLTIAALCFVAGAFMASFVGTWLKMDQNISAYTFYNPVF--- 413

Query: 461 NMILTPVLLPGIIFLTVIFMNVLLYFVGSSNVIPLATLVFMVFLWILFSIPLAFAGSLIS 520
             +L    LPG I +  + +N +++   S+  +P  T+V  V  + +  I ++  G  ++
Sbjct: 414 -AVLCGSALPGSIMVLTLSLNCIIWIWDSTKALPFGTMVVFVSWYFVVCIVVSLLGGAVA 472

Query: 521 ---YKKCNWDEHPTKT---NEIPRQIPFQPWFLKTVPATLIGGLVSFGSIAVELYFIYSS 574
              ++    D  P  T    ++ R+       L    A LI G + F  I VEL ++Y S
Sbjct: 473 AQMHRSVRHDAPPATTASDRKVLRRSRAISGKLVVFLAGLISGFLPFVIIYVELEYLYKS 532

Query: 575 LWFNK--IFYMFGFLLFSIVLFSFTTGLINVI-------ITYRALCSENWTWQWRSFFIG 625
           +W  K  ++Y++ FL  +++L       I+++       + ++ +  +NW  +WR F I 
Sbjct: 533 VWLEKTTLYYLYSFLFANVLLLCIVVCEISLLGCLVLMKLNHKFINDQNW--RWRCFVIS 590

Query: 626 GLGCSIYIFIHSILFTQF--KLGGFATIVLYVGYSFLISFLTCIVTGAIGFICSMFFVRR 683
             GCS Y+ I+S+ +  F   + G + + + V YSF+ + L  + TG++G++ S +FV++
Sbjct: 591 T-GCSWYMEIYSLYYIFFIIHMTGDSAVFISVCYSFIFNVLCGLATGSLGYLTSSWFVKK 649

Query: 684 I 684
           I
Sbjct: 650 I 650

 Score = 70.9 bits (172), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 48/156 (30%), Positives = 75/156 (48%), Gaps = 23/156 (14%)

Query: 25  PRTYKQGDAIPLLVNHLTPSLNFQHVDDDGNEIKGDKARMLYPYDYYNEKLHFCQPEKIE 84
           P  Y  GD + L+VN          V+ +  +I         P+ YY+  L F  P   E
Sbjct: 43  PNVYSIGDPLELVVNT---------VESEITDI---------PFGYYD--LPFTCPPTPE 82

Query: 85  KQPE--SLGSVIFGEKIYNSPFNVKMLEDNECVQLCSTTIPGKDAKFINKLIKNGFMQNW 142
           K+P   SL  +I G++ + S + + + +DN C  LC+     +  +    LIK+G+M  W
Sbjct: 83  KKPLHLSLNEIIKGDRKWESDYKLVVGQDNPCEILCARKTTREGLQTAKDLIKSGYMVQW 142

Query: 143 LI-DGLPAARKLHDSRTNTEFYGQGFELGFVEVRQA 177
           +I D LPAA     +  N ++Y  GF LG V+ R +
Sbjct: 143 MIDDDLPAATTYISTTDNLKYYAPGFPLGSVDPRSS 178

>Skud_5.266 Chr5 (431486..433609) [2124 bp, 707 aa] {ON} YER113C
           (REAL)
          Length = 707

 Score = 87.4 bits (215), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 116/511 (22%), Positives = 216/511 (42%), Gaps = 73/511 (14%)

Query: 243 NHFDIEVEYHDRGNGDFRVVGVIVNPVSLDNYKSRSCALANQHKLHL----DENKDNEVM 298
           NH  + + +H  G+    VVG  V P S+ +Y     A  N  +  +    DE+    + 
Sbjct: 196 NHVILVIRFHGGGDDKNTVVGFEVYPKSVSDYHCPG-ASKNYEQYEIVVPEDEHDLTYLP 254

Query: 299 FTYSVKFTPS-DTPWATRWDKYLHIYD------PKIQWFSLINFSVIVLLLSSVAIHSLL 351
           FTYSV +    +  W  RW+ +L+  +       +  W SL N   IVL +S +     +
Sbjct: 255 FTYSVYWREEFEVDWNHRWNYFLNAGELSDEQSAQFHWMSLANSLGIVLSISFITFVIYI 314

Query: 352 RALKSDISRYN-------------EFNLGDEFEEDSGWKLVHGDVFRTPKNSM----LLS 394
           R +++D    +             E +L D+    +   +V  D  +  K  +    +L 
Sbjct: 315 RVMRTDKKNTDSHKYLINTEGIEAEDSLDDDKYGKNSVYMVTKDWIQNGKPDLFGLKVLI 374

Query: 395 VLVGSGXXXXXXXXXXXXXXXXXXXXXXXRGSLPTAMFMFYAIFGFVGSY--TSMGIYKF 452
           VLV  G                       R S+ T   + + +  F+ S+  T +GI   
Sbjct: 375 VLVSFGVQFLFTIIGSLTISCSMNKLHNVRNSVLTMAILCFVLGAFMASFVGTRLGIVTK 434

Query: 453 FKG---------PYWKANMILTPVL-------LPGIIFLTVIFMNVLLYFVGSSNVIPLA 496
            +            +K     +P+        LPG++ +    +N ++    S+N +P  
Sbjct: 435 RRNINVNYLDHNKSFKNCREFSPIFAVICGSSLPGMVMIGTFLLNSVVGAHDSTNALPFR 494

Query: 497 TLVFMVFLWILFSIPLAFAGSLIS------------YKKCNWDEHPTKTNEIPRQIPFQP 544
           T+VF + ++ +  IPL+  G +++              K   D + +K  +   +  F P
Sbjct: 495 TIVFFISIYFVVCIPLSLFGGIVANNIPLPKYWLSGITKDETDGNGSKLFKPKSRTRFNP 554

Query: 545 WFLKTVPATLIGGLVSFGSIAVELYFIYSSLWFNKI--FYMFGFLLFSIVLFSFTTGLIN 602
                V    + G+     I VE+ ++Y SLW  K   ++ +GFL  SI+L    T  I+
Sbjct: 555 LVHCGV---YLCGIFPLLVIYVEMQYVYKSLWLEKTTFYFFYGFLFLSIILLCVLTMEIS 611

Query: 603 VIITYRAL--CSENW----TWQWRSFFIGGLGCSIYIFIHSI--LFTQFKLGGFATIVLY 654
           +I +Y  +  C ++      W+WR F +G  G  +Y+ ++S+  +F    + GF++I++ 
Sbjct: 612 IIGSYLLMRFCFDDKEVRNNWRWRCFEMGFSG-GVYMELYSLYYIFVVLNIHGFSSILIS 670

Query: 655 VGYSFLISFLTCIVTGAIGFICSMFFVRRIF 685
           + YS L + L  +  GA+  + + +F+ RI+
Sbjct: 671 ICYSLLFNILCGLGLGALSCLTASWFINRIY 701

 Score = 80.5 bits (197), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 53/176 (30%), Positives = 86/176 (48%), Gaps = 24/176 (13%)

Query: 2   VRQLLVLSLFVASTLGFYLPG-AAPRTYKQGDAIPLLVNHLTPSLNFQHVDDDGNEIKGD 60
            RQ     +F +S    Y  G   P  YK+ D + L+VN                +++ D
Sbjct: 31  TRQQEQKPVFSSSQNNLYYDGWITPNFYKKNDFLELIVN----------------KVESD 74

Query: 61  KARMLYPYDYYNEKLHFCQPEKIEKQPE--SLGSVIFGEKIYNSPFNVKMLEDNECVQLC 118
             ++  PY YY+  L F  P  + K+P   SL  +I G++ + S + ++  EDN C  LC
Sbjct: 75  LTQL--PYAYYD--LPFTCPPTMHKKPLHLSLNEIIRGDRKWESDYKLRFGEDNACETLC 130

Query: 119 STTIPGKDAKFINKLIKNGFMQNWLIDG-LPAARKLHDSRTNTEFYGQGFELGFVE 173
           +     K  + ++KL++ G++  WLID  LPAA     +  + ++Y  GF LGFV+
Sbjct: 131 ARKTDKKGMQTLDKLVREGYVVQWLIDDELPAATTFISTTDHKKYYASGFPLGFVD 186

>Kwal_27.10746 s27 (479237..481309) [2073 bp, 690 aa] {ON} YER113C -
           Hypothetical ORF [contig 33] FULL
          Length = 690

 Score = 81.3 bits (199), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 50/160 (31%), Positives = 83/160 (51%), Gaps = 26/160 (16%)

Query: 25  PRTYKQGDAIPLLVNHLTPSLNFQHVDDDGNEIKGDKARMLYPYDYYNEKLHFCQPEKIE 84
           P  YK+GD + +++N                ++  + AR  +PY YY+  L F  P   +
Sbjct: 42  PNVYKKGDKVDVIIN----------------KVVSETAR--FPYGYYD--LQFVCPPSDK 81

Query: 85  KQPE--SLGSVIFGEKIYNSPFNVKMLEDNECVQLCSTTIPGKDAKFINKLIKNGFMQNW 142
           K+P   SL  +I G++ + S +N+   E ++C++LC      +  K  + LI+ G++ +W
Sbjct: 82  KKPLHLSLNEIIRGDRKWESDYNLAFGERHDCLRLCDRKTKPEGLKQADALIRQGYVAHW 141

Query: 143 LI-DGLPAARKLHDSRTNTEFYGQGFELGFVEVRQAVGGK 181
           LI D LPAA     +++  +FY  GF LG V+   AV GK
Sbjct: 142 LIDDDLPAATTFAKTKSGKKFYTAGFPLGEVD---AVTGK 178

 Score = 67.0 bits (162), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 68/293 (23%), Positives = 122/293 (41%), Gaps = 76/293 (25%)

Query: 469 LPGIIFLTVIFMNVLLYFVGSSNVIPLATLVFMVFLWILFSIPLAFAGSLISYKKCNWDE 528
           LPG++  TV+ +N +++   SS+ IP  T+V  V  + + S PL+  G   + K  N   
Sbjct: 400 LPGLVLFTVLVLNGIVWLKDSSSAIPFGTVVVFVAGYFMISFPLSLLGGFSARKMKN-AA 458

Query: 529 HPTKTNEIPRQIPFQPWFLKTV-------PATLIG-----------------GLVSFGSI 564
                N I +  PF   FL T+       PAT +G                 G+  F  I
Sbjct: 459 KLAPANAISKS-PFS--FLLTLSYDTRSWPATALGKPFPIALSNPILLTILAGIAPFVVI 515

Query: 565 AVELYFIYSSLWFN--KIFYMFGFLLFSIVLFSFTTGLINVIITYRALC----------- 611
            VEL+++Y S+W      +Y++GFLL + +        +++++ Y  +            
Sbjct: 516 CVELFYVYKSMWLQTTNFYYLYGFLLVNFMFLCIIVCEVSLLVCYVLMVHNHSGQAPEIE 575

Query: 612 SENWT----------------------------------WQWRSFFIGG-LGCSIYIFIH 636
           S+ +T                                  W+W+SF  GG +   + ++  
Sbjct: 576 SDPYTKLSNSRRCSPITIVNKLKNVLASIAHHLKASFSSWRWKSFVAGGSVAWYLELYSL 635

Query: 637 SILFTQFKLGGFATIVLYVGYSFLISFLTCIVTGAIGFICSMFFVRRIFASIK 689
             L     L   ++I+L+V Y+ L +F+     GA+G++  ++F+  I +S K
Sbjct: 636 YYLIFVLHLRDLSSILLFVCYTALFNFMCWCAFGALGYLSCLWFLSHISSSSK 688

 Score = 39.3 bits (90), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 33/127 (25%), Positives = 61/127 (48%), Gaps = 16/127 (12%)

Query: 243 NHFDIEVEYHDRGNGDFRVVGVIVNPVSLDNYKSRSCALANQ----HKLHLDENKDNEVM 298
           NH  + V Y         ++G  V P S+ +     C  AN+    ++++ +E++   + 
Sbjct: 183 NHLMLVVRYQTVDVNKHTIIGFEVYPKSVSD---AHCPGANKDYQPYEINTEESEITYIP 239

Query: 299 FTYSVKF-TPSDTPWATRWDKYLH-------IYDPKIQWFSLINFSVIVLLLSSVAIHSL 350
           FTYS+ +   S+  W+ RW+ ++H              W SL N S IV++L S+ I ++
Sbjct: 240 FTYSIYWREESNIDWSHRWNFFIHDDTSSHSKRQSLFHWISLAN-SAIVVVLMSLFIATI 298

Query: 351 LRALKSD 357
              +K+D
Sbjct: 299 FVKIKND 305

>KLTH0C06226g Chr3 (541022..543106) [2085 bp, 694 aa] {ON} similar
           to uniprot|P40071 Saccharomyces cerevisiae YER113C
           Hypothetical ORF
          Length = 694

 Score = 73.9 bits (180), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 49/152 (32%), Positives = 73/152 (48%), Gaps = 23/152 (15%)

Query: 25  PRTYKQGDAIPLLVNHLTPSLNFQHVDDDGNEIKGDKARMLYPYDYYNEKLHFCQPEKIE 84
           P  YK+GD + L VN +             +EI         PY YY+  L F  P    
Sbjct: 46  PNVYKRGDKVDLTVNKVE------------SEITN------LPYGYYD--LRFVCPPSET 85

Query: 85  KQPE--SLGSVIFGEKIYNSPFNVKMLEDNECVQLCSTTIPGKDAKFINKLIKNGFMQNW 142
           K+P   SL  VI G++ + S +N++     +C +LC         +  ++LI+  +M +W
Sbjct: 86  KKPLHLSLDEVIRGDRKWESDYNLEFGVGQDCERLCDRKTMPDGLRQADRLIRENYMVHW 145

Query: 143 LIDG-LPAARKLHDSRTNTEFYGQGFELGFVE 173
           LIDG LPAA     +R+  +FY  GF LG V+
Sbjct: 146 LIDGDLPAATTFASTRSGKKFYTAGFPLGRVD 177

 Score = 64.3 bits (155), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 111/535 (20%), Positives = 209/535 (39%), Gaps = 117/535 (21%)

Query: 243 NHFDIEVEYHDRGNGDFRVVGVIVNPVSLDNYKSRSCALA-NQHKLHLDENKDNEVMFTY 301
           NH  + + Y       + +VG  V P S+ +Y+    + +   + ++ +E +   + FTY
Sbjct: 187 NHLMLVIRYQAFDFNRYAIVGFEVYPRSVSDYQCPGASKSFEPYVINTEETEVTYIPFTY 246

Query: 302 SVKF-TPSDTPWATRWDKYLH----IYDPKIQ---WFSLINFSVIVLLLSSVAIHSLLRA 353
           SV +   S+  W+ RW+ +      + +  +    W SL N +++V      A+ +L  A
Sbjct: 247 SVYWREESNIDWSHRWNLFFDGGSMLPNGNVSFFYWISLANSAIVV------ALMTLFIA 300

Query: 354 LKSDISRYNEF--NLGDEFEEDSGWKLVHGDVFRTPKNSMLLSVLVGSGXXXXXXXXXXX 411
           L     R ++F   L  E+     + L   ++  +     L S++  S            
Sbjct: 301 LIFLKIRADDFVGTLAFEWASQPVYYLTQLNLAASMGIQFLFSIIGSS-----------T 349

Query: 412 XXXXXXXXXXXXRGSLPTAMFMFYAIFGFVGSYTSMGIYKFFK-GPYWKANM---ILTPV 467
                          L TA   F      +G+YTS  +      GP  K N+   +L   
Sbjct: 350 ISCSLCKVHNIRSWELSTAAICF-----VLGAYTSSLVGSLLAPGP--KMNLGTSVLCGC 402

Query: 468 LLPGIIFLTVIFMNVLLYFVGSSNVIPLATLVFMVFLWILFSIPLAFAGSLISYKKCNWD 527
            LP +  + V   N +++   SS  +P  TL+ ++  + +  +PL+F G   S +K    
Sbjct: 403 TLPALALVVVAVFNSVVWIKDSSAALPFGTLLALLTSYFVICLPLSFLGGF-SARKLR-S 460

Query: 528 EHPTKTNEIPRQIPFQPWFL----------------KTVPA--------TLIGGLVSFGS 563
                 N    ++PF   FL                K +PA        T++ G   F  
Sbjct: 461 APANGLNYEQSKVPFS--FLLSIEYHEYNLLPAGQEKEIPAILSNPFLLTIVTGFPPFVV 518

Query: 564 IAVELYFIYSSLWFNK--IFYMFGFLLFSIVLFSFTTGLINVIIT--------------- 606
              EL F+Y SLW  K  ++ ++GFLL + +    T   +++++                
Sbjct: 519 TCTELLFVYRSLWLQKTNLYSLYGFLLVNFIFLCITVCEVSLVVCYVLMIYTQPGSTDRQ 578

Query: 607 -------------------------YRALCSENW-----TWQWRSFFIGGLGCSIYIFIH 636
                                    Y A  +  W     +W+W++ F+ G   + Y  ++
Sbjct: 579 ASNEGPDIRWSICRSPMTIVKSLKNYMASTARRWKASFSSWRWKA-FMAGASVAWYFELY 637

Query: 637 SILFTQF--KLGGFATIVLYVGYSFLISFLTCIVTGAIGFICSMFFVRRIFASIK 689
           S+ +  F   L  F++I+L+V Y+ L + +     GA+G++  ++F+  + A  K
Sbjct: 638 SLYYLIFVLHLRDFSSILLFVCYTSLFNLMCWCAFGALGYLTCLWFLNFVSAPHK 692

>TBLA0I00330 Chr9 (52200..54341) [2142 bp, 713 aa] {ON} Anc_7.411
           YER113C
          Length = 713

 Score = 54.3 bits (129), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 69/314 (21%), Positives = 126/314 (40%), Gaps = 45/314 (14%)

Query: 244 HFDIEVEYHDRGNGDFRVVGVIVNPVSLDNYKSRSCALANQHKLHLD----ENKDNEVM- 298
           H    V YH   +  F +VG+ V P S+ +Y   +C  A++  + L+    EN D+    
Sbjct: 207 HLMFVVRYHAVTSDTFTIVGLEVYPRSIVDY---NCPGASKDFIPLEVKVPENNDDPTYL 263

Query: 299 -FTYSVKFTPS-DTPWATRWDKY------LHIYDPKIQWFSLINFSVIVLLLSSVAIHSL 350
            F+YSV +    D PW  RWD +      L   D    W+SLIN + I   +  +    L
Sbjct: 264 PFSYSVYWREEFDLPWNQRWDLFKTADELLREKDLSFHWYSLINSNSIT--VGVITFLCL 321

Query: 351 LRALKSDISRYNEFNLGDEFEEDSGWK-----LVHGDVFRTPKNSMLLSVLVGSGXXXXX 405
           + ++      YN+            WK     +      R P    + ++ + SG     
Sbjct: 322 VISMNRMRILYNK-----------SWKKRQLSITTTTTTRYPN---IFTICITSGIQFFF 367

Query: 406 XXXXXXXXXXXXXXXXXXRGSLPTAMFMFYAIFG-----FVGSYTSMG-IYKFFKGPYWK 459
                             + ++  A  +F+  FG     F+G+      I   F   Y+ 
Sbjct: 368 LLISSVLITFQISKFHQIKDTIIVA--LFFIAFGIIVSVFIGTLIQRTFILTNFPDKYYL 425

Query: 460 ANMILTPVLLPGIIFLTVIFMNVLLYFVGSSNVIPLATLVFMVFLWILFSIPLAFAGSLI 519
            N IL    LP  I L++  +N ++Y    ++  P    ++    + + SIPL+    ++
Sbjct: 426 TNPILFGSTLPAFILLSMFIINSIIYLSEKNHAFPFKLSMYFFTSYFILSIPLSIISGVL 485

Query: 520 SYKKCNWDEHPTKT 533
           S +  ++ ++P+++
Sbjct: 486 STRFISFPKYPSRS 499

 Score = 50.1 bits (118), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 41/152 (26%), Positives = 62/152 (40%), Gaps = 20/152 (13%)

Query: 25  PRTYKQGDAIPLLVNHLTPSLNFQHVDDDGNEIKGDKARMLYPYDYYNEKLHFCQPEKIE 84
           P  YK GD + +  N   P       DD        +  + Y YD     L F  P    
Sbjct: 62  PNLYKVGDKVQITTNKALP-------DDPA----VSQPALCY-YD-----LPFVCPPSDT 104

Query: 85  KQP--ESLGSVIFGEKIYNSPFNVKMLEDNECVQLCSTTIPGKDAKFINKLIKNGFMQNW 142
           K+P   SL  +  G+ +  S + ++  +D  C  LCS     K  +    LIKN ++  W
Sbjct: 105 KRPIHNSLTELFNGDYLSESDYILEFAKDEPCHILCSRKTSKKGMQRAYDLIKNDYIVQW 164

Query: 143 LIDG-LPAARKLHDSRTNTEFYGQGFELGFVE 173
            +D  LP       ++ N + Y  GF LG+ +
Sbjct: 165 YVDNDLPVGTTYISNKVNKKQYLPGFSLGYFD 196

>Ecym_7143 Chr7 (290555..292585) [2031 bp, 676 aa] {ON} similar to
           Ashbya gossypii AGL295C
          Length = 676

 Score = 53.9 bits (128), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 57/269 (21%), Positives = 116/269 (43%), Gaps = 57/269 (21%)

Query: 469 LPGIIFLTVIFMNVLLYFVGSSNVIPLATLVFMVFLWILFSIPLAFAGSLISYKKCNWDE 528
           LP +    ++  N + + +     +P   +  ++ L+ + S+PL+  G   +  K   D+
Sbjct: 404 LPALTVAVLVLANSIAWIIERGKEMPFRDITLLLALYFMVSLPLSLLGGTSASYKLK-DQ 462

Query: 529 H----------------PTK----------TNEIP----RQIPFQPWFLKTVPATLIGGL 558
           H                P+K          T   P     QIP   W  K    T I G+
Sbjct: 463 HFQLYSLSTKYTGTPVSPSKPTFWFNFEYDTRGTPACAHEQIPM--WLSKPFLITSIIGI 520

Query: 559 VSFGSIAVELYFIYSSLWFNK--IFYMFGFLLFSIVLFSFTTGLINVIITYRAL------ 610
           + F +I +++ FI+  LW +   +F ++  L+  ++L S     I ++I Y  +      
Sbjct: 521 IPFLAIYLQMEFIWKPLWTHSKSLFQIYVSLIIGMILQSILVMEICILIMYVHMHHGDDS 580

Query: 611 --CSENW-----------TWQWRSFFIGGLGCSIYIFIHSILFTQF--KLGGFATIVLYV 655
             C ++            +W+W++F++GG   + Y   +S+ +  F  +L  F +I+LY+
Sbjct: 581 ECCFDDTCVTGRISNAVSSWRWKAFYMGG-AAAWYWEAYSLYYMIFILRLRNFGSILLYL 639

Query: 656 GYSFLISFLTCIVTGAIGFICSMFFVRRI 684
            Y  L++       G+IG++   +F+ ++
Sbjct: 640 SYGTLLNVFYFYSFGSIGYLACCWFLNKL 668

 Score = 53.1 bits (126), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 38/151 (25%), Positives = 64/151 (42%), Gaps = 21/151 (13%)

Query: 25  PRTYKQGDAIPLLVNHLTPSLNFQHVDDDGNEIKGDKARMLYPYDYYNEKLHFCQPEKIE 84
           PR Y+ G+ + +L+N                ++ G    +   Y YY+ +   C P K  
Sbjct: 42  PRIYQDGEEVEMLLN----------------QVVGKPGEL--SYGYYDLQFT-CTPTKSR 82

Query: 85  KQ-PESLGSVIFGEKIYNSPFNVKMLEDNECVQLCSTTIPGKDAKFINKLIKNGFMQNWL 143
           +    SL  V  G++ + S + +    +N+C  LC            + LI+  +    L
Sbjct: 83  RMVHHSLYEVFSGDRKWQSDYKLYFNRENKCSTLCFRKTQPSGLIEADSLIRQNYTVQLL 142

Query: 144 IDG-LPAARKLHDSRTNTEFYGQGFELGFVE 173
           ID  +PA++     R N  +Y  GF LGFV+
Sbjct: 143 IDEIMPASKTYVSMRDNKRYYVPGFPLGFVD 173

>TPHA0K00730 Chr11 (150877..153078) [2202 bp, 733 aa] {ON} Anc_7.411
           YER113C
          Length = 733

 Score = 53.1 bits (126), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 41/151 (27%), Positives = 66/151 (43%), Gaps = 14/151 (9%)

Query: 25  PRTYKQGDAIPLLVNHLTPSLNFQHVDDDGNEIKGDKARMLYPYDYYNEKLHFCQPEKIE 84
           P TY  GD + ++VN +      Q  D  G+  +G   +       Y++  + C P   +
Sbjct: 48  PNTYTFGDPVEVIVNKMV-----QEKDMLGDSNEGVSYK-------YHDLPYICPPTNTK 95

Query: 85  KQ-PESLGSVIFGEKIYNSPFNVKMLEDNECVQLCSTTIPGKDAKFINKLIKNGFMQNWL 143
           K    SL  +  G+    S + +K   DN+C  LC         +   ++I   ++ NW 
Sbjct: 96  KSIHNSLKELFNGDYNEQSDYILKFGVDNDCQALCLRKTYNAGIRKAKEMIDEDYIVNWF 155

Query: 144 IDG-LPAARKLHDSRTNTEFYGQGFELGFVE 173
           ID  LPAA     S T  + Y +GF LG+ +
Sbjct: 156 IDDYLPAATTYISSVTRKKKYFEGFSLGWKD 186

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 60/300 (20%), Positives = 122/300 (40%), Gaps = 22/300 (7%)

Query: 243 NHFDIEVEYHDRGNGDFRVVGVIVNPVSLDNYKSRSCALANQHKLHLDENKDNE---VMF 299
           NH  + + Y+   +  F +VG  V P S+ + +       + H    D   ++E   + F
Sbjct: 196 NHVMLVIRYNAVDDNKFNIVGFEVYPKSIPDLQCPGARRGHGHYELKDLENNDEFSLIPF 255

Query: 300 TYSVKFTPS-DTPWATRWDKY-------LHIYDPKIQWFSLINFSVIVLLLSSVAIHSL- 350
           +YSV +    +  W TRW  +       L   D  +Q   + N        ++V I ++ 
Sbjct: 256 SYSVYWREEFEYDWRTRWSLFVRPNYMDLDAEDESLQLGFISNLLHWYSPYTTVIIFTIL 315

Query: 351 ---LRALKSDISRYNEFNLGDEFEEDSGWKLVHGDVFRTPKNSMLLSVLVGSGXXXXXXX 407
              +  L  DI+ +    + +  +    W      + +T KN +LL++LV  G       
Sbjct: 316 LFLVSLLVLDINSHKLVFMSNP-KTVIAWATTANKLNKTWKN-ILLNILVSMGCQALFIF 373

Query: 408 XXXXXXXXXXXXXXXXRGSLPTAMFMFYA----IFGFVGSYTSMGIYKFFKGPYWKANM- 462
                              +   +  + +    +  FVG++  M +++    P +   M 
Sbjct: 374 MPVIVIQSSLWSLHNISNYVMLQIICWISASLLVGSFVGTWLRMYMFQKKMTPNYDPKMS 433

Query: 463 ILTPVLLPGIIFLTVIFMNVLLYFVGSSNVIPLATLVFMVFLWILFSIPLAFAGSLISYK 522
           I+   +LPG+    V   N + +F+  ++  P   L +++F++ +FSIP++  G  ++ K
Sbjct: 434 IVCGSILPGLTLAGVTVFNTVTWFLEGNSSYPFRKLSWLIFVYFIFSIPMSLIGGSLAVK 493

>AGL295C Chr7 complement(152197..154170) [1974 bp, 657 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YER113C
          Length = 657

 Score = 52.8 bits (125), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 39/151 (25%), Positives = 65/151 (43%), Gaps = 23/151 (15%)

Query: 25  PRTYKQGDAIPLLVNHLTPSLNFQHVDDDGNEIKGDKARMLYPYDYYNEKLHFCQPEKIE 84
           P  Y +G+ + LLV+++              E+ G           Y E L  C P    
Sbjct: 39  PSAYTRGERVQLLVDNIWTD----------REVWG-----------YYETLFTCPPPAEA 77

Query: 85  KQP-ESLGSVIFGEKIYNSPFNVKMLEDNECVQLCSTTIPGKDAKFINKLIKNGFMQNWL 143
           +    SLG V   E  + S + + +  + +C  LC   +     + + ++I++G    W 
Sbjct: 78  RAIYGSLGQVFRREMPWESNYVLHVRAETQCQPLCMRELRPDSHRRLIQMIRDGAQVRWT 137

Query: 144 IDGLPAARKLHDSRTNTEFYGQGFELGFVEV 174
           +DGLPAA    D R ++  Y  GF+LG V+ 
Sbjct: 138 LDGLPAATTYPD-RQSSYRYEAGFKLGEVDA 167

>Kpol_1045.28 s1045 (64235..66280) [2046 bp, 681 aa] {ON}
           (64237..66282) [2046 nt, 682 aa]
          Length = 681

 Score = 49.7 bits (117), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 96/502 (19%), Positives = 199/502 (39%), Gaps = 71/502 (14%)

Query: 243 NHFDIEVEYHDRGNGDFRVVGVIVNPVSLDNYKSRSCALA-NQHKLHLDENKDNE--VMF 299
           NH  + + Y+   +  F +VG  V   S+ +Y     +    +++L + EN D+   + F
Sbjct: 192 NHSMLVIRYNAIDDDKFTIVGFEVYLRSVSDYHCPGASKNYEEYELVIPENDDDLTFIPF 251

Query: 300 TYSVKFTPS-DTPWATRW---DKYLHIYDPKIQWFSLINFSVIV---------LLLSSVA 346
           TYSV +    D  W +RW   D  +   DPK     LIN S++          L L  + 
Sbjct: 252 TYSVYWREEFDIDWTSRWNLFDNDIEEEDPK-----LINKSMLSNIMQPTRTGLFLLPLI 306

Query: 347 IHSLLRALKSDISRYNEFNLGDEFEEDSGWKLVHGDVFRTPKNSMLLSVLVGSGXXXXXX 406
           I S++     +    N+F    +      W   +    ++  ++ +L++++  G      
Sbjct: 307 IFSIIIVKVVENGEKNKFTTEAQLASKC-WIESNNINLKSSFSASILTLVISMGVQSIFS 365

Query: 407 XXXXXXXXXXXXXXXXXRGSLPTAMFMFYA----IFGFVGSYTSMGIYKFFKGPYWKANM 462
                               +   +F+++        F+G++  M I       Y     
Sbjct: 366 LIGIIILKLSIYKLHDISNIVLLNIFIWFIEGILASSFLGTWLRMNILNKKSINYNPKFS 425

Query: 463 ILTPVLLPGIIFLTVIFMNVLLYFVGSSNVIPLATLVFMVFLWILFSIPLAFAGSLIS-- 520
           IL   LLP ++ + V  ++ +++ + SS+  P  TL  M+  + +  +P +  G  ++  
Sbjct: 426 ILCGSLLPFLLMIFVYPIHSIVWLIESSSRYPFKTLTMMISFFYIICVPFSIIGGGLAKK 485

Query: 521 YKKC----------------NWDEHPTKTNEIPRQIPFQPWFLKTVPATLIGGLVSFGSI 564
           Y+K                 N ++   K    P  I      L T+  +LI  +V F  I
Sbjct: 486 YRKHYKEMFGNITLDNENNDNDEKKRFKAQHRPSSINKNK--LGTLVYSLITAIVPFFII 543

Query: 565 AVELYFIYSSLWFNKIFYM---------FGFLLFSIVLFSFTTGLINVIITYRALCSENW 615
             ELY+I+++ W N   ++            ++ ++   S     +N+++T + +     
Sbjct: 544 KSELYWIFTNKWLNYTTFIKSFIFLIIKLFIIIITVSSTSLVGLFVNIMMTKKGIS---- 599

Query: 616 TWQWR--------SFFIGGLGCSIYIFIHSILF--TQFKLGGFATIVLYVGYSFLISFLT 665
             QWR        S F+          ++S+ +     ++ GF+  VL + Y+  ++ + 
Sbjct: 600 --QWRDDPISLRWSCFLNSFNICYLTGLYSLYYIIEVIRIHGFSMTVLTIFYTIALNVIL 657

Query: 666 CIVTGAIGFICSMFFVRRIFAS 687
            I  GAI ++   + + +++ +
Sbjct: 658 GISCGAIAYMTCYWLIIKLYKN 679

 Score = 47.0 bits (110), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 42/149 (28%), Positives = 60/149 (40%), Gaps = 21/149 (14%)

Query: 25  PRTYKQGDAIPLLVNHLTPSLNFQHVDDDGNEIKGDKARMLYPYDYYNEKLHFCQPEKIE 84
           P  YK GD + LLVN    +LN                  L PY Y++  L F  P    
Sbjct: 49  PNVYKVGDNVDLLVNKAISTLNAD----------------LKPYIYHD--LPFVCPPTSV 90

Query: 85  KQPESL--GSVIFGEKIYNSPFNVKMLEDNECVQLCSTTIPGKDAKFINKLIKNGFMQNW 142
           ++P  L   S+  G+ +  S + +K  +D EC  LC+             +IK  +   W
Sbjct: 91  RKPVHLEFDSLFRGDTLSESDYKLKFGDDYECEILCARKTNKNGVSKAIDMIKQDYQILW 150

Query: 143 LIDG-LPAARKLHDSRTNTEFYGQGFELG 170
            ID  LP +     + T  + Y  GF LG
Sbjct: 151 SIDDELPISMPYISTITQRKKYIPGFPLG 179

>Skud_2.367 Chr2 (655638..658979) [3342 bp, 1113 aa] {ON} YBR235W
           (REAL)
          Length = 1113

 Score = 33.5 bits (75), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 45/195 (23%), Positives = 80/195 (41%), Gaps = 29/195 (14%)

Query: 477 VIFMNVLLYFVGSSNVIPLATLVFMVFLWILFSIPLA------FAGSLISYKKCNWDE-- 528
           ++F+ + + FVGS  V     ++F+V    +FSIPL+      F    I+Y    W    
Sbjct: 203 ILFLCISVAFVGSQTVSRAGNILFLVLAASIFSIPLSALIKSPFVEGGITYTGPTWQTFY 262

Query: 529 -----HPTKTNE---IPRQIPFQPWFLKTVPATLIGGLVSFGSIAVELYFIYSSLWFNKI 580
                H TK      +  +  F   F    PAT   G+ +   ++ EL     S+    +
Sbjct: 263 SNLFPHLTKDAAGSLLKGKETFNDLFGVFFPAT--AGIFAGAGMSSELRKPSKSIPKGTL 320

Query: 581 F-YMFGFLLFSIVLFSF-----TTGLINVIITYRALCSENWTWQWRSFFIGGLGCSIYIF 634
           +  +F F+ +++V+F+       T L N +   +   S  W       F+G +  S++  
Sbjct: 321 WGLLFTFICYAVVVFTMGCSIPRTSLYNEVQIIQTTSSVQWI-----IFLGEMATSLFSI 375

Query: 635 IHSILFTQFKLGGFA 649
           I  +L   + L   A
Sbjct: 376 IVGMLGAAYVLEAIA 390

>Suva_4.492 Chr4 (857188..860520) [3333 bp, 1110 aa] {ON} YBR235W
           (REAL)
          Length = 1110

 Score = 33.1 bits (74), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 45/195 (23%), Positives = 79/195 (40%), Gaps = 29/195 (14%)

Query: 477 VIFMNVLLYFVGSSNVIPLATLVFMVFLWILFSIPLA------FAGSLISYKKCNWDE-- 528
           ++F+   + FVGS  V     ++F++    +FSIPL+      F    ISY    W    
Sbjct: 203 ILFLCFSVAFVGSQTVSRAGNILFLILAASIFSIPLSALIRSPFVEGGISYTGPTWQTFH 262

Query: 529 -----HPTKTNE---IPRQIPFQPWFLKTVPATLIGGLVSFGSIAVELYFIYSSLWFNKI 580
                H TK      +  +  F   F    PAT   G+ +   ++ EL     S+    +
Sbjct: 263 DNLFPHLTKGAAGSLLKGKETFNDLFGVFFPAT--AGIFAGAGMSSELRKPSKSIPKGTL 320

Query: 581 F-YMFGFLLFSIVLFSF-----TTGLINVIITYRALCSENWTWQWRSFFIGGLGCSIYIF 634
           +  +F F+ +++V+FS         L N +   + + S  W       F+G +  S++  
Sbjct: 321 WGLLFTFICYAVVVFSMGCSIPRASLHNEVQIIQTISSAQWV-----IFMGEMATSLFSI 375

Query: 635 IHSILFTQFKLGGFA 649
           I  +L   + L   A
Sbjct: 376 IVGMLGAAYVLEAIA 390

>Skud_13.321 Chr13 complement(547412..547834) [423 bp, 140 aa] {ON}
           YMR159C (REAL)
          Length = 140

 Score = 31.2 bits (69), Expect = 4.2,   Method: Composition-based stats.
 Identities = 29/99 (29%), Positives = 53/99 (53%), Gaps = 15/99 (15%)

Query: 139 MQNWLIDGLPAARKLHDSRTNTEFYGQGFELGFVEVRQAVGGKIVSESE---KELQLSER 195
           +Q   +DGL   R +   R N+E +    EL F +   AVGGK+V+  E   K L++ ++
Sbjct: 9   LQTGAMDGLLIGRLV--DRNNSEAHLS--EL-FQDSNDAVGGKVVNHDEALLKTLKILQQ 63

Query: 196 DAKNIIDFTDIEIRSPKNLVDLSNLEVREAKNVVDNIVT 234
           + K+     + EIR  K +++L N   + A+ + D +++
Sbjct: 64  ELKS----KEQEIRKLKEVIELKN---KNAERLNDELIS 95

>TPHA0N01150 Chr14 complement(241358..244675) [3318 bp, 1105 aa]
           {ON} Anc_6.146 YBR235W
          Length = 1105

 Score = 32.3 bits (72), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 47/208 (22%), Positives = 84/208 (40%), Gaps = 34/208 (16%)

Query: 476 TVIFMNVLLYFVGSSNVIPLATLVFMVFLWILFSIPLAFA-----GSLISYKKCNWDE-- 528
           T++F+ + +  VGS  V      +F + +  + SIPL+         +ISY   +WD   
Sbjct: 201 TILFLCITIALVGSQTVSRAGNFLFFILMSSIISIPLSLIFKSPFKDVISYSGPSWDTFK 260

Query: 529 -----HPTK---TNEIPRQIPFQPWFLKTVPATLIGGLVSFGSIAVELYFIYSSLWFNKI 580
                H TK    +    +  F   F    PAT   G+ +   ++ EL     S+    +
Sbjct: 261 ENLYPHLTKGAAGSMAKGKETFNDLFGVFFPAT--AGIFAGAGMSSELRKPSKSIPKGTL 318

Query: 581 F-YMFGFLLFSIVLFSFTTGL--------INVIITYRALCSENWTWQWRSFFIGGLGCSI 631
           +  +F FL +++V+ S    +        + +I +  AL S          F+G +  SI
Sbjct: 319 WGLLFTFLCYAVVVLSMGCSIPRKSLYEDVQIIQSVSALQS--------IIFLGEMATSI 370

Query: 632 YIFIHSILFTQFKLGGFATIVLYVGYSF 659
           +     +L   + L   A   ++ G SF
Sbjct: 371 FSITVGMLGAAYVLEAIARDSIFPGLSF 398

>TBLA0B02050 Chr2 (472955..474253) [1299 bp, 432 aa] {ON} Anc_1.500
           YML051W
          Length = 432

 Score = 32.0 bits (71), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 28/130 (21%), Positives = 61/130 (46%), Gaps = 9/130 (6%)

Query: 130 INKLIKNGFMQNWLID--GLPAARKLHDSRTNTEFYGQGFELGFVEVRQAV-GGKIVSES 186
           +N ++ N   + +++D  G+P  +KL  +  +   +    + G + V  ++ GGK   + 
Sbjct: 230 VNAMVFNNIPEQYVVDENGIPTGQKLPKNVPDHLLFQGTLQSGNIPVSCSIKGGKPTKKF 289

Query: 187 EKELQLSERDAKNIIDFTDIEIRSPKNLVDLSNLEVREAKNVVDNIVTNVEVPVFANHFD 246
            K L +     K      DI+I      +++SNL +  +   ++N+ TN + P+  ++ +
Sbjct: 290 TKNLVIDIHGTKG-----DIKIEGDAGFIEMSNLVLYYSGVKINNVPTN-DTPISNSNQN 343

Query: 247 IEVEYHDRGN 256
             +E H   N
Sbjct: 344 EVMEVHHLRN 353

>YBR235W Chr2 (686901..690263) [3363 bp, 1120 aa] {ON} Putative ion
           transporter, similar to mammalian electroneutral
           Na(+)-(K+)-C1- cotransporter family; YBR235W is not an
           essential gene
          Length = 1120

 Score = 32.0 bits (71), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 48/195 (24%), Positives = 81/195 (41%), Gaps = 29/195 (14%)

Query: 477 VIFMNVLLYFVGSSNVIPLATLVFMVFLWILFSIPLA------FAGSLISYKKCNWDE-- 528
           ++F+   + FVGS  V     ++F+V    +FSIPL+      F    ISY   +W    
Sbjct: 203 ILFLCFSVAFVGSQTVSRAGNILFLVLAASIFSIPLSALIRSPFTEGGISYTGPSWQTFH 262

Query: 529 -----HPTKTNE---IPRQIPFQPWFLKTVPATLIGGLVSFGSIAVELYFIYSSLWFNKI 580
                H TK      +  +  F   F    PAT   G+ +   ++ EL     S+    +
Sbjct: 263 DNLLPHLTKGAAGSLLKGKETFNDLFGVFFPAT--AGIFAGAGMSSELRKPSKSIPKGTL 320

Query: 581 F-YMFGFLLFSIVLFSFTTGLINVIITYRALCSENWTWQWRS-----FFIGGLGCSIYIF 634
           +  +F F+ +++V+FS     +   I  R+L  E    Q  S      F+G +  S++  
Sbjct: 321 WGLLFTFICYAVVVFS-----MGCSIPRRSLYDEVQIIQTISSVQWVIFMGEMATSLFSI 375

Query: 635 IHSILFTQFKLGGFA 649
           I  +L   + L   A
Sbjct: 376 IVGMLGAAYVLEAIA 390

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.326    0.142    0.440 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 74,270,496
Number of extensions: 3449796
Number of successful extensions: 12565
Number of sequences better than 10.0: 69
Number of HSP's gapped: 12697
Number of HSP's successfully gapped: 109
Length of query: 691
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 574
Effective length of database: 40,065,477
Effective search space: 22997583798
Effective search space used: 22997583798
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 69 (31.2 bits)