Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
CAGL0B00418g1.9ON74374337550.0
SAKL0C00550g1.9ON73272623670.0
Kpol_2002.121.9ON73970023130.0
TPHA0E039701.9ON74774823100.0
NCAS0B090701.9ON73073722950.0
KAFR0D001801.9ON72373622860.0
TBLA0A075601.9ON74168722820.0
KLLA0C00572g1.9ON71267822710.0
ZYRO0F18392g1.9ON72572922720.0
KNAG0C002601.9ON74468822620.0
YCL057W (PRD1)1.9ON71269821260.0
NDAI0A001801.9ON74070221290.0
Suva_3.1561.9ON71269620840.0
Skud_3.71.9ON71271620800.0
Smik_3.181.9ON71267920780.0
Ecym_1011na 1ON71668419820.0
AGR406C1.9ON68368417230.0
AGR405Cna 1ON71768315800.0
ABR185WsingletonON4574169011e-113
NDAI0E020102.432ON7784714179e-42
Kpol_297.82.432ON7874964124e-41
Skud_11.932.432ON7724873875e-38
TBLA0I007102.432ON7734663867e-38
ZYRO0G20130g2.432ON7864763803e-37
Kwal_26.76162.432ON7705253795e-37
KAFR0D029502.432ON7774683733e-36
SAKL0E03938g2.432ON7675093715e-36
Suva_11.912.432ON7754873681e-35
TPHA0G023902.432ON7954733681e-35
Smik_11.1022.432ON7725133671e-35
CAGL0D02112g2.432ON7614653635e-35
TDEL0A020802.432ON7875013627e-35
YKL134C (OCT1)2.432ON7725113592e-34
AFR198W2.432ON7764333511e-33
KLTH0D04730g2.432ON7725163441e-32
KNAG0A062002.432ON7895183441e-32
NCAS0A042802.432ON7734443431e-32
KLLA0B12397g2.432ON7794663271e-30
Ecym_60992.432ON7735003262e-30
ZYRO0G10076g4.107ON78241800.62
Ecym_35198.235ON1233173771.3
NDAI0A034408.227ON60859742.6
NCAS0D046006.341ON168329725.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0B00418g
         (743 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0B00418g Chr2 (26584..28815) [2232 bp, 743 aa] {ON} similar ...  1451   0.0  
SAKL0C00550g Chr3 (48410..50608) [2199 bp, 732 aa] {ON} highly s...   916   0.0  
Kpol_2002.12 s2002 (21544..23763) [2220 bp, 739 aa] {ON} (21544....   895   0.0  
TPHA0E03970 Chr5 complement(834023..836266) [2244 bp, 747 aa] {O...   894   0.0  
NCAS0B09070 Chr2 complement(1741718..1743910) [2193 bp, 730 aa] ...   888   0.0  
KAFR0D00180 Chr4 (18900..21071) [2172 bp, 723 aa] {ON} Anc_1.9 Y...   885   0.0  
TBLA0A07560 Chr1 complement(1871629..1873854) [2226 bp, 741 aa] ...   883   0.0  
KLLA0C00572g Chr3 (42069..44207) [2139 bp, 712 aa] {ON} similar ...   879   0.0  
ZYRO0F18392g Chr6 complement(1518902..1521079) [2178 bp, 725 aa]...   879   0.0  
KNAG0C00260 Chr3 (39428..41662) [2235 bp, 744 aa] {ON} Anc_1.9 Y...   875   0.0  
YCL057W Chr3 (24768..26906) [2139 bp, 712 aa] {ON}  PRD1Zinc met...   823   0.0  
NDAI0A00180 Chr1 (14692..16914) [2223 bp, 740 aa] {ON} Anc_1.9        824   0.0  
Suva_3.156 Chr3 (234520..236658) [2139 bp, 712 aa] {ON} YCL057W ...   807   0.0  
Skud_3.7 Chr3 (12763..14901) [2139 bp, 712 aa] {ON} YCL057W (REAL)    805   0.0  
Smik_3.18 Chr3 (26213..28351) [2139 bp, 712 aa] {ON} YCL057W (REAL)   805   0.0  
Ecym_1011 Chr1 (19924..22074) [2151 bp, 716 aa] {ON} similar to ...   768   0.0  
AGR406C Chr7 complement(1472496..1474547) [2052 bp, 683 aa] {ON}...   668   0.0  
AGR405C Chr7 complement(1469769..1471922) [2154 bp, 717 aa] {ON}...   613   0.0  
ABR185W Chr2 (758126..758380,758380..758709,758709..759029,75903...   351   e-113
NDAI0E02010 Chr5 complement(404579..406915) [2337 bp, 778 aa] {O...   165   9e-42
Kpol_297.8 s297 complement(11648..14011) [2364 bp, 787 aa] {ON} ...   163   4e-41
Skud_11.93 Chr11 complement(175243..177561) [2319 bp, 772 aa] {O...   153   5e-38
TBLA0I00710 Chr9 (128272..130593) [2322 bp, 773 aa] {ON} Anc_2.4...   153   7e-38
ZYRO0G20130g Chr7 (1666665..1669025) [2361 bp, 786 aa] {ON} simi...   150   3e-37
Kwal_26.7616 s26 (444266..446578) [2313 bp, 770 aa] {ON} YKL134C...   150   5e-37
KAFR0D02950 Chr4 complement(581305..583638) [2334 bp, 777 aa] {O...   148   3e-36
SAKL0E03938g Chr5 (317017..319320) [2304 bp, 767 aa] {ON} simila...   147   5e-36
Suva_11.91 Chr11 complement(175327..177654) [2328 bp, 775 aa] {O...   146   1e-35
TPHA0G02390 Chr7 complement(486025..488412) [2388 bp, 795 aa] {O...   146   1e-35
Smik_11.102 Chr11 complement(175013..177331) [2319 bp, 772 aa] {...   145   1e-35
CAGL0D02112g Chr4 complement(216204..218489) [2286 bp, 761 aa] {...   144   5e-35
TDEL0A02080 Chr1 complement(373425..375788) [2364 bp, 787 aa] {O...   144   7e-35
YKL134C Chr11 complement(189124..191442) [2319 bp, 772 aa] {ON} ...   142   2e-34
AFR198W Chr6 (797448..799778) [2331 bp, 776 aa] {ON} Syntenic ho...   139   1e-33
KLTH0D04730g Chr4 (432572..434890) [2319 bp, 772 aa] {ON} simila...   137   1e-32
KNAG0A06200 Chr1 complement(937577..939946) [2370 bp, 789 aa] {O...   137   1e-32
NCAS0A04280 Chr1 complement(864327..866648) [2322 bp, 773 aa] {O...   136   1e-32
KLLA0B12397g Chr2 complement(1084129..1086468) [2340 bp, 779 aa]...   130   1e-30
Ecym_6099 Chr6 complement(186647..188968) [2322 bp, 773 aa] {ON}...   130   2e-30
ZYRO0G10076g Chr7 (805645..807993) [2349 bp, 782 aa] {ON} highly...    35   0.62 
Ecym_3519 Chr3 (976242..979943) [3702 bp, 1233 aa] {ON} similar ...    34   1.3  
NDAI0A03440 Chr1 (789010..790836) [1827 bp, 608 aa] {ON} Anc_8.2...    33   2.6  
NCAS0D04600 Chr4 (875553..880604) [5052 bp, 1683 aa] {ON} Anc_6....    32   5.3  

>CAGL0B00418g Chr2 (26584..28815) [2232 bp, 743 aa] {ON} similar to
           uniprot|P25375 Saccharomyces cerevisiae YCL057w PRD1
           proteinase yscD
          Length = 743

 Score = 1451 bits (3755), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 709/743 (95%), Positives = 709/743 (95%)

Query: 1   MFSRSLSIIGRRVGNTLFRSKKTTFALIALPLFVSYRGIHLNNTYTSSIRNYSQLANTRF 60
           MFSRSLSIIGRRVGNTLFRSKKTTFALIALPLFVSYRGIHLNNTYTSSIRNYSQLANTRF
Sbjct: 1   MFSRSLSIIGRRVGNTLFRSKKTTFALIALPLFVSYRGIHLNNTYTSSIRNYSQLANTRF 60

Query: 61  TNMPSLTPPQYPPSWEFKPEDILSQTKEFIANTKLFYDDLVAIDNPTIENLIVPYINHXX 120
           TNMPSLTPPQYPPSWEFKPEDILSQTKEFIANTKLFYDDLVAIDNPTIENLIVPYINH  
Sbjct: 61  TNMPSLTPPQYPPSWEFKPEDILSQTKEFIANTKLFYDDLVAIDNPTIENLIVPYINHEN 120

Query: 121 XXXXXXXXXTFLQHVSEDKTIRDASMEATMLLQDFEIESGSRVDLFKQFDLIWNQIKDKK 180
                    TFLQHVSEDKTIRDASMEATMLLQDFEIESGSRVDLFKQFDLIWNQIKDKK
Sbjct: 121 ENELLINQLTFLQHVSEDKTIRDASMEATMLLQDFEIESGSRVDLFKQFDLIWNQIKDKK 180

Query: 181 DEFEDFEIWRFVEKCHKDYVRAGLNLPADXXXXXXXXXXXXADNCLKFSKNLGEQKEYIL 240
           DEFEDFEIWRFVEKCHKDYVRAGLNLPAD            ADNCLKFSKNLGEQKEYIL
Sbjct: 181 DEFEDFEIWRFVEKCHKDYVRAGLNLPADKLEKVKEIKKKIADNCLKFSKNLGEQKEYIL 240

Query: 241 FTAEELKGVPESVIEQFEKVNDEFGIQKLKVTYKYPDIFPVLKNAQNPETRMKAFMGDQN 300
           FTAEELKGVPESVIEQFEKVNDEFGIQKLKVTYKYPDIFPVLKNAQNPETRMKAFMGDQN
Sbjct: 241 FTAEELKGVPESVIEQFEKVNDEFGIQKLKVTYKYPDIFPVLKNAQNPETRMKAFMGDQN 300

Query: 301 KVPENEHLFKDTLKLRNELALVLGYDTYANYNLDIKMAKNADTVLSFVNDLIVKLQDPAK 360
           KVPENEHLFKDTLKLRNELALVLGYDTYANYNLDIKMAKNADTVLSFVNDLIVKLQDPAK
Sbjct: 301 KVPENEHLFKDTLKLRNELALVLGYDTYANYNLDIKMAKNADTVLSFVNDLIVKLQDPAK 360

Query: 361 KELDILKNLKKQEFENEFNMVYDGDYYIWDHRYYDNKYLKENFNVDEEKIAEYYPLESTI 420
           KELDILKNLKKQEFENEFNMVYDGDYYIWDHRYYDNKYLKENFNVDEEKIAEYYPLESTI
Sbjct: 361 KELDILKNLKKQEFENEFNMVYDGDYYIWDHRYYDNKYLKENFNVDEEKIAEYYPLESTI 420

Query: 421 DGMLKIYETLLKLKFVEVKENKKTWHDDVKQLAVWKLDTPENPEFVGWIFFDLHPRDGKY 480
           DGMLKIYETLLKLKFVEVKENKKTWHDDVKQLAVWKLDTPENPEFVGWIFFDLHPRDGKY
Sbjct: 421 DGMLKIYETLLKLKFVEVKENKKTWHDDVKQLAVWKLDTPENPEFVGWIFFDLHPRDGKY 480

Query: 481 GHAANFGLSSSYISANGTRSYPITALVCNFSKSTKDKPSLLKHSEITTFFHELGHGIHDL 540
           GHAANFGLSSSYISANGTRSYPITALVCNFSKSTKDKPSLLKHSEITTFFHELGHGIHDL
Sbjct: 481 GHAANFGLSSSYISANGTRSYPITALVCNFSKSTKDKPSLLKHSEITTFFHELGHGIHDL 540

Query: 541 VGNNRIGRFNGPGAVPWDFVEAPSQMLEFWTWNTKELLSLSQNYKDNAKIDTKLLESLIK 600
           VGNNRIGRFNGPGAVPWDFVEAPSQMLEFWTWNTKELLSLSQNYKDNAKIDTKLLESLIK
Sbjct: 541 VGNNRIGRFNGPGAVPWDFVEAPSQMLEFWTWNTKELLSLSQNYKDNAKIDTKLLESLIK 600

Query: 601 TKHVNGALFALRQLHFGLFDMKVHMMSAEELDKLDIKKLWNDLREKICLISNGDQPTTGY 660
           TKHVNGALFALRQLHFGLFDMKVHMMSAEELDKLDIKKLWNDLREKICLISNGDQPTTGY
Sbjct: 601 TKHVNGALFALRQLHFGLFDMKVHMMSAEELDKLDIKKLWNDLREKICLISNGDQPTTGY 660

Query: 661 NSFGHIMXXXXXXXXXXXMWAEVFATDMYYTKFKADPLNPEVGVKYRDIVLARGGLYEID 720
           NSFGHIM           MWAEVFATDMYYTKFKADPLNPEVGVKYRDIVLARGGLYEID
Sbjct: 661 NSFGHIMSGSYSAGYYGYMWAEVFATDMYYTKFKADPLNPEVGVKYRDIVLARGGLYEID 720

Query: 721 DNLEEFLGRKPAKDAFLEELGLH 743
           DNLEEFLGRKPAKDAFLEELGLH
Sbjct: 721 DNLEEFLGRKPAKDAFLEELGLH 743

>SAKL0C00550g Chr3 (48410..50608) [2199 bp, 732 aa] {ON} highly
           similar to gnl|GLV|KLLA0C00572g Kluyveromyces lactis
           KLLA0C00572g and similar to YCL057W uniprot|P25375
           Saccharomyces cerevisiae YCL057W PRD1 Zinc
           metalloendopeptidase found in the cytoplasm and
           intermembrane space of mitochondria
          Length = 732

 Score =  916 bits (2367), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 453/726 (62%), Positives = 552/726 (76%), Gaps = 13/726 (1%)

Query: 23  TTFALIALPL--FVSYRGIH-LNNTYTSSIRNYSQLANTRFTNMPSLTPPQYPPSWEFKP 79
           TT +L+A+P   F +Y  +H  N T      NYS ++ T      +L PPQ  PSW++ P
Sbjct: 13  TTTSLLAIPALAFGAYSLLHSTNRTLRIPKSNYSTMSATM---SATLVPPQAAPSWKYSP 69

Query: 80  EDILSQTKEFIANTKLFYDDLVAIDNPTIENLIVPYINHXXXXXXXXXXXTFLQHVSEDK 139
           EDIL  T E IA+T   +D L  ++NPT+E+L+ P++ H           TFLQHVS DK
Sbjct: 70  EDILQLTNETIASTSALHDALAGVENPTVESLVKPFLEHENTTQPLINQLTFLQHVSADK 129

Query: 140 TIRDASMEATMLLQDFEIESGSRVDLFKQFDLIWNQIKD-KKDEFEDFEIWRFVEKCHKD 198
            +RDAS +AT LLQDFEIE+  R DLF QFD +W   KD  K + E FE+++FVEKCHKD
Sbjct: 130 EVRDASTKATELLQDFEIEASLRHDLFVQFDKVWQACKDDAKFKKEHFELYKFVEKCHKD 189

Query: 199 YVRAGLNLPADXXXXXXXXXXXXADNCLKFSKNLGEQKEYILFTAEELKGVPESVIEQFE 258
           YVRAGLNLP +            ++N L+FSKNLGEQKE++ FT EEL GV  SV++QFE
Sbjct: 190 YVRAGLNLPEEKRNEVKELQKKISNNSLQFSKNLGEQKEFVAFTTEELDGVSASVMDQFE 249

Query: 259 KVNDEFGIQKLKVTYKYPDIFPVLKNAQNPETRMKAFMGDQNKVPENEHLFKDTLKLRNE 318
           K  D  G++K KV++KYPDI PVLK A+NPETR +AF GDQNKVP+NE LF +TL+LR+E
Sbjct: 250 KFTDTDGVEKHKVSFKYPDILPVLKTAKNPETRKRAFGGDQNKVPQNEVLFLETLRLRDE 309

Query: 319 LALVLGYDTYANYNLDIKMAKNADTVLSFVNDLIVKLQDPAKKELDILKNLKKQEFENEF 378
           LA +LGY TYANYNLDIKMAK  +TVL+F+ DL  KL+    KE++ LK+LK+++ + E 
Sbjct: 310 LAGLLGYSTYANYNLDIKMAKKQETVLAFLEDLKNKLKPLGVKEIEALKSLKEKDCK-EL 368

Query: 379 NMVYDGDYYIWDHRYYDNKYLKENFNVDEEKIAEYYPLESTIDGMLKIYETLLKLKFVEV 438
            + +D  YYIWD+RYYDNKYLKEN+NVDEEKI+EY+PLE TI GMLKIYET+LKLKFVE 
Sbjct: 369 AIPFDNHYYIWDNRYYDNKYLKENYNVDEEKISEYFPLEPTIGGMLKIYETVLKLKFVEE 428

Query: 439 --KENKKTWHDDVKQLAVWKLDTPENPEFVGWIFFDLHPRDGKYGHAANFGLSSSYISAN 496
              E K+ WH+DVKQLAVWK+D  E+PEFVGWI+FDLHPRDGKYGHAANFG++SSY+  +
Sbjct: 429 TDAEKKQVWHEDVKQLAVWKVDKAESPEFVGWIYFDLHPRDGKYGHAANFGIASSYVR-D 487

Query: 497 GTRSYPITALVCNFSKSTKDKPSLLKHSEITTFFHELGHGIHDLVGNNRIGRFNGPGAVP 556
           G RS+P+TALVCNFSK +  KP+LLKHSEITTFFHELGHGIHDLVG N IGRFNGPGA P
Sbjct: 488 GARSHPVTALVCNFSKPSAKKPALLKHSEITTFFHELGHGIHDLVGGNHIGRFNGPGATP 547

Query: 557 WDFVEAPSQMLEFWTWNTKELLSLSQNYKDNAKIDTKLLESLIKTKHVNGALFALRQLHF 616
           WDFVEAPSQMLEFWTWN  EL +LSQ+Y+   KI  +LL+SLI TKHVNGALFALRQL F
Sbjct: 548 WDFVEAPSQMLEFWTWNKNELSTLSQHYETGEKIPEQLLDSLIATKHVNGALFALRQLTF 607

Query: 617 GLFDMKVHMMSAEELDKLDIKKLWNDLREKICLISNGDQPTTGYNSFGHIMXXXXXXXXX 676
           GLFDM VH  + ++L+ LD+  LWNDLR+++ L+ NGDQ T G+NSFGHIM         
Sbjct: 608 GLFDMTVH--TCKDLESLDVTSLWNDLRQEVSLVENGDQVTKGFNSFGHIMSGAYSAGYY 665

Query: 677 XXMWAEVFATDMYYTKFKADPLNPEVGVKYRDIVLARGGLYEIDDNLEEFLGRKPAKDAF 736
             MWAEVFA DMY+TKF ADPLN +VGV+YRDIVL+RGGLYEIDDNL EFLGR+P  +AF
Sbjct: 666 GYMWAEVFAADMYHTKFAADPLNGDVGVRYRDIVLSRGGLYEIDDNLREFLGREPNNEAF 725

Query: 737 LEELGL 742
           L+ELGL
Sbjct: 726 LKELGL 731

>Kpol_2002.12 s2002 (21544..23763) [2220 bp, 739 aa] {ON}
           (21544..23763) [2220 nt, 740 aa]
          Length = 739

 Score =  895 bits (2313), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 432/700 (61%), Positives = 534/700 (76%), Gaps = 11/700 (1%)

Query: 52  YSQLANTRFTNMPSLTPPQYPPSWEFKPEDILSQTKEFIANTKLFYDDLVAIDNPTIENL 111
           ++ L  +  TN   L  PQ  P+W + PE I+   +  I ++   +D+L AI +PT+EN 
Sbjct: 43  FTILKYSTMTNSSLLIAPQPAPTWNWTPEGIVKDAESLIKDSNRIFDNLAAISSPTVENF 102

Query: 112 IVPYINHXXXXXXXXXXXTFLQHVSEDKTIRDASMEATMLLQDFEIESGSRVDLFKQFDL 171
           IVPY+NH           TFLQHVS DK IRD+SM+AT L+Q+FEIE+  R DLF QFD 
Sbjct: 103 IVPYMNHENKVSPLINQLTFLQHVSADKDIRDSSMKATELIQNFEIEASLRKDLFIQFDK 162

Query: 172 IWNQIKD-----KKDEFEDFEIWRFVEKCHKDYVRAGLNLPADXXXXXXXXXXXXADNCL 226
           IW  +KD     +K + +++E +RF+EKCHKD++R+GLNL  +            A N L
Sbjct: 163 IWTDVKDNSEFNEKSDSKNYESYRFIEKCHKDFIRSGLNLSDEKREIVKDIQKKIASNSL 222

Query: 227 KFSKNLGEQKEYILFTAEELKGVPESVIEQFEKVNDE-FGIQKLKVTYKYPDIFPVLKNA 285
            FSKNLGEQKE+I FT EEL GV ++V+EQFEK  DE  G +K KVT+KYPDI PVLK+A
Sbjct: 223 NFSKNLGEQKEFIAFTKEELDGVSDAVMEQFEKFKDEKTGEEKFKVTFKYPDILPVLKSA 282

Query: 286 QNPETRMKAFMGDQNKVPENEHLFKDTLKLRNELALVLGYDTYANYNLDIKMAKNADTVL 345
           +NP TR  AF  DQNKVPENE LF DTLKLRN+L+ VL Y  YANYNL++KMAKN +TV 
Sbjct: 283 KNPNTRKLAFNADQNKVPENEALFVDTLKLRNDLSTVLDYSNYANYNLEMKMAKNEETVF 342

Query: 346 SFVNDLIVKLQDPAKKELDILKNLKKQEFENEFNMVYDGDYYIWDHRYYDNKYLKENFNV 405
           +F++DL  KL+    KE++ILK LK+++ + E N+ YD  YYIWDHRYYDNKYLK+NFNV
Sbjct: 343 NFLDDLKTKLRPLGLKEIEILKQLKEKDMK-ELNLPYDNHYYIWDHRYYDNKYLKDNFNV 401

Query: 406 DEEKIAEYYPLESTIDGMLKIYETLLKLKFVEVKENKK--TWHDDVKQLAVWKLDTPENP 463
           D EKI+EYYP+ES+IDGMLKIYET++KLKFVE  +  K   WH+DVKQL+VWK+D P+ P
Sbjct: 402 DLEKISEYYPIESSIDGMLKIYETVMKLKFVEETDPAKRNVWHEDVKQLSVWKMDNPDAP 461

Query: 464 EFVGWIFFDLHPRDGKYGHAANFGLSSSYISANGTRSYPITALVCNFSKSTKDKPSLLKH 523
           EF+GWI+FDLHPRDGKYGHAANFG+SSSY+  N  RSYP+TALVCNFSK T DKPSLLKH
Sbjct: 462 EFIGWIYFDLHPRDGKYGHAANFGISSSYVDENDKRSYPVTALVCNFSKPTSDKPSLLKH 521

Query: 524 SEITTFFHELGHGIHDLVGNNRIGRFNGPGAVPWDFVEAPSQMLEFWTWNTKELLSLSQN 583
           +E+TTFFHELGHGIHDLVG NR  R NGPG+VPWDFVEAPSQMLEFWTWN  EL+SLS++
Sbjct: 522 NELTTFFHELGHGIHDLVGANRCSRLNGPGSVPWDFVEAPSQMLEFWTWNKNELISLSKH 581

Query: 584 YKDNAKIDTKLLESLIKTKHVNGALFALRQLHFGLFDMKVHMMSAEELDKLDIKKLWNDL 643
           YK   KI   L+ESL+ TKHVNGALFALRQLHF  FDM+VH  +AE++ KL++ +LWN L
Sbjct: 582 YKTGEKIPESLIESLVSTKHVNGALFALRQLHFSTFDMEVH--TAEDVSKLNLLELWNGL 639

Query: 644 REKICLISNGDQPTTGYNSFGHIMXXXXXXXXXXXMWAEVFATDMYYTKFKADPLNPEVG 703
           RE+ICL+ NGD+ + GY+SFGHIM           MWAEVFATDMYYTKF ADPLN + G
Sbjct: 640 REQICLVENGDEMSKGYDSFGHIMSGAYSAGYYGYMWAEVFATDMYYTKFAADPLNSKSG 699

Query: 704 VKYRDIVLARGGLYEIDDNLEEFLGRKPAKDAFLEELGLH 743
           V+YRDI+L+RGG+YE++DNLEEFLGR+P   AFL+E+GL+
Sbjct: 700 VEYRDIILSRGGIYEVNDNLEEFLGREPNNSAFLKEMGLN 739

>TPHA0E03970 Chr5 complement(834023..836266) [2244 bp, 747 aa] {ON}
           Anc_1.9 YCL057W
          Length = 747

 Score =  894 bits (2310), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 453/748 (60%), Positives = 552/748 (73%), Gaps = 20/748 (2%)

Query: 8   IIGRRVGNTLFRSKKTTFALIALPLFVSYRGIHLNNTYTSSIRNYSQLANTRFTNMPSLT 67
           II   +G + F++K    +L+A+P  V+    H NN     +R Y+  A+    N  +  
Sbjct: 8   IIKSGIGKS-FKNKSILLSLVAIPA-VAIGIYHQNN---QGLRFYT--ASQVKMNEAAFI 60

Query: 68  PPQYPPSWEFKPEDILSQTKEFIANTKLFYDDLVAIDNPTIENLIVPYINHXXXXXXXXX 127
            PQ  P W+F PE ILS  K+ I  +  FY+ +VAI+NP+IEN ++P IN          
Sbjct: 61  APQLSPKWDFSPERILSDAKKIIDTSNDFYNAMVAIENPSIENFVIPSINFENENSLAIN 120

Query: 128 XXTFLQHVSEDKTIRDASMEATMLLQDFEIESGSRVDLFKQFDLIWNQIKDKKD------ 181
             TFLQHVS+DK IRDAS+EAT L+ +F+IE   R D+FKQFD I+N +KD K       
Sbjct: 121 QLTFLQHVSKDKLIRDASLEATELITNFDIEISLRYDMFKQFDKIFNDLKDNKKYNDLKT 180

Query: 182 -EFEDFEIWRFVEKCHKDYVRAGLNLPADXXXXXXXXXXXXADNCLKFSKNLGEQKEYIL 240
              +D+EI+++VEKCHKDYVR+GLNL  +            A N L+FSKNLGEQ E++ 
Sbjct: 181 ATPKDYEIFKYVEKCHKDYVRSGLNLSEEKRNEIKEIKKRIALNSLQFSKNLGEQNEFVA 240

Query: 241 FTAEELKGVPESVIEQFEKVNDE-FGIQKLKVTYKYPDIFPVLKNAQNPETRMKAFMGDQ 299
           FT EEL+GV + V++QFE   DE  G QK KVT+KYPDIFPVLK A+NP TR  AF  DQ
Sbjct: 241 FTKEELEGVSDDVMKQFETYTDEQTGEQKFKVTFKYPDIFPVLKTAKNPNTRKIAFNADQ 300

Query: 300 NKVPENEHLFKDTLKLRNELALVLGYDTYANYNLDIKMAKNADTVLSFVNDLIVKLQDPA 359
           NKVPENE LF DTLKLR +L  +LGYDTYANYNLDIKMAKN +TV+ F+ DL  KL+  A
Sbjct: 301 NKVPENEKLFIDTLKLRYQLGKILGYDTYANYNLDIKMAKNQETVMEFLVDLKDKLKPLA 360

Query: 360 KKELDILKNLKKQEFENEFNMVYDGDYYIWDHRYYDNKYLKENFNVDEEKIAEYYPLEST 419
           +KE+++LK +KK E + E NM YD  YYIWDHRYYDNKYLK+ FNVD EKI+EYYP+EST
Sbjct: 361 EKEIEVLKAIKKTEAQ-ELNMAYDDHYYIWDHRYYDNKYLKDKFNVDLEKISEYYPVEST 419

Query: 420 IDGMLKIYETLLKLKFVEV--KENKKTWH-DDVKQLAVWKLDTPENPEFVGWIFFDLHPR 476
           I GMLKIYET++ LKF+E   K+ K TW  DDVKQLAVWK+D P  PEFVGWI+FDLHPR
Sbjct: 420 IQGMLKIYETVMNLKFIEETDKDLKSTWAGDDVKQLAVWKMDDPSKPEFVGWIYFDLHPR 479

Query: 477 DGKYGHAANFGLSSSYISANGTRSYPITALVCNFSKSTKDKPSLLKHSEITTFFHELGHG 536
           +GKYGHAANFG++ SYI  +  R YP+TALVCNFS +T DKP+LLKH+EITTFFHELGHG
Sbjct: 480 EGKYGHAANFGMAPSYIDKDSKRIYPVTALVCNFSAATADKPALLKHNEITTFFHELGHG 539

Query: 537 IHDLVGNNRIGRFNGPGAVPWDFVEAPSQMLEFWTWNTKELLSLSQNYKDNAKIDTKLLE 596
           IHDLVGNN IGRFNGPGAVPWDFVEAPSQMLEFWTWN  ELLSLS++YK   KI   LLE
Sbjct: 540 IHDLVGNNGIGRFNGPGAVPWDFVEAPSQMLEFWTWNKNELLSLSKHYKTGEKIPESLLE 599

Query: 597 SLIKTKHVNGALFALRQLHFGLFDMKVHMMSAE-ELDKLDIKKLWNDLREKICLISNGDQ 655
           SLI TKHVNGALFALRQLHFGLFDMKVH  + + ++D +D+ +LWN LRE+I L+ NGD+
Sbjct: 600 SLIATKHVNGALFALRQLHFGLFDMKVHTTTDDNQIDNMDLVQLWNGLREEISLVENGDE 659

Query: 656 PTTGYNSFGHIMXXXXXXXXXXXMWAEVFATDMYYTKFKADPLNPEVGVKYRDIVLARGG 715
              GY+SFGHIM           MWAEVFATDMYY+KF  DPLN + G++YRDI+LARGG
Sbjct: 660 MNKGYDSFGHIMSDSYSAGYYGYMWAEVFATDMYYSKFAKDPLNTKSGIEYRDIILARGG 719

Query: 716 LYEIDDNLEEFLGRKPAKDAFLEELGLH 743
           + E +DNL+EFLGR+P+K+AFL+ELGL 
Sbjct: 720 IRETNDNLKEFLGREPSKEAFLKELGLQ 747

>NCAS0B09070 Chr2 complement(1741718..1743910) [2193 bp, 730 aa]
           {ON} Anc_1.9
          Length = 730

 Score =  888 bits (2295), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 452/737 (61%), Positives = 541/737 (73%), Gaps = 21/737 (2%)

Query: 12  RVGNTLFRSKKTTFALIALPLFVSYRGIHLNNTYTSSIRNYSQLANTRFTNMPSLTPPQ- 70
           R  +T   +KK   + I LP              T+ I        T  TN   L  P  
Sbjct: 9   RYSSTRIANKKLLISAIVLPA-------------TAFILTRKSFYMTLPTNNKLLVAPTG 55

Query: 71  YPPSWEFKPEDILSQTKEFIANTKLFYDDLVAIDNPTIENLIVPYINHXXXXXXXXXXXT 130
             P+W++ PE IL++TKE I N    YD L AI+ P++E+L+ PY+++           T
Sbjct: 56  TAPTWKWSPESILAKTKEVIDNATNLYDSLAAIEEPSVESLVKPYMHYENDEGLIVNQLT 115

Query: 131 FLQHVSEDKTIRDASMEATMLLQDFEIESGSRVDLFKQFDLIWNQIKDKKDEFED-FEIW 189
           FLQHVS DK IRDAS+EAT LLQDF IE+  R+DLF+QFD IWNQ+KD  D     FE +
Sbjct: 116 FLQHVSADKLIRDASVEATELLQDFSIEASMRLDLFQQFDKIWNQVKDDDDLKSKDFETY 175

Query: 190 RFVEKCHKDYVRAGLNLPADXXXXXXXXXXXXADNCLKFSKNLGEQKEYILFTAEELKGV 249
           +F+EK HKDYVR GLNLP +            A N L +SKNLGEQKEY+ FT E+LKGV
Sbjct: 176 KFIEKVHKDYVRNGLNLPEEKRNQVKDIKKKIASNSLNYSKNLGEQKEYVSFTKEQLKGV 235

Query: 250 PESVIEQFEK-VNDEFGIQKLKVTYKYPDIFPVLKNAQNPETRMKAFMGDQNKVPENEHL 308
            ESV+EQFEK V+ +   +K KVT+KYPDIFPVLK AQ P+TR  A++ DQNKVP+NE L
Sbjct: 236 SESVMEQFEKFVDPKTNEEKYKVTFKYPDIFPVLKTAQVPKTRKLAYISDQNKVPQNEAL 295

Query: 309 FKDTLKLRNELALVLGYDTYANYNLDIKMAKNADTVLSFVNDLIVKLQDPAKKELDILKN 368
           F +TLKLRN+LA +LGY TYANYNLDIKMAKN +TV  FVN+L  KL+   +KE++ LK 
Sbjct: 296 FVETLKLRNQLAQLLGYSTYANYNLDIKMAKNQETVFDFVNNLKDKLKPLGQKEIETLKT 355

Query: 369 LKKQEFENEFNMVYDGDYYIWDHRYYDNKYLKENFNVDEEKIAEYYPLESTIDGMLKIYE 428
           LKK++ E E  + YD  YYIWDHRYYDNK+LK+N+NVD E+I+EYYPLESTI GML IYE
Sbjct: 356 LKKKDCE-ELGLAYDDHYYIWDHRYYDNKFLKDNYNVDLEQISEYYPLESTIKGMLGIYE 414

Query: 429 TLLKLKFVEVK--ENKKTWHDDVKQLAVWKLDTPENPEFVGWIFFDLHPRDGKYGHAANF 486
           TLLKLKFV+    + K  WH+DVKQLAVWK+D  +NPEF+GWI+FDLHPRDGKY HAANF
Sbjct: 415 TLLKLKFVDETNPKIKDVWHEDVKQLAVWKMDDEKNPEFIGWIYFDLHPRDGKYSHAANF 474

Query: 487 GLSSSYISANGTRSYPITALVCNFSKSTKDKPSLLKHSEITTFFHELGHGIHDLVGNNRI 546
           G+SSSYI+ +G RS+P+TALVCNFSKST  KPSLLKH+EITTFFHELGHGIHDLVG N+ 
Sbjct: 475 GISSSYITQDGDRSFPVTALVCNFSKSTDKKPSLLKHNEITTFFHELGHGIHDLVGKNKC 534

Query: 547 GRFNGPGAVPWDFVEAPSQMLEFWTWNTKELLSLSQNYKDNAKIDTKLLESLIKTKHVNG 606
            RFNGPGA PWDFVEAPSQMLEFWTWN  ELLSLS +Y+   KI   LL+SLI TKHVNG
Sbjct: 535 ARFNGPGATPWDFVEAPSQMLEFWTWNKNELLSLSGHYQTGEKISEDLLDSLIATKHVNG 594

Query: 607 ALFALRQLHFGLFDMKVHMMSAEELDKLDIKKLWNDLREKICLISNGDQPTTGYNSFGHI 666
           ALFALRQLHFGLFDM VH  + + ++ L++ KLWN+LREKICL+ NG++ T GY+SFGHI
Sbjct: 595 ALFALRQLHFGLFDMTVH--TTKNVEDLNLLKLWNELREKICLVENGNELTKGYDSFGHI 652

Query: 667 MXXXXXXXXXXXMWAEVFATDMYYTKFKADPLNPEVGVKYRDIVLARGGLYEIDDNLEEF 726
           M           MWAEVFA DMYYTKF +DPLN + GV+YRDIVLA GGLYEI D L+EF
Sbjct: 653 MSDSYSAGYYGYMWAEVFAADMYYTKFASDPLNSQAGVQYRDIVLANGGLYEIADKLKEF 712

Query: 727 LGRKPAKDAFLEELGLH 743
           LGR+P  DAFL+ELGLH
Sbjct: 713 LGREPTNDAFLKELGLH 729

>KAFR0D00180 Chr4 (18900..21071) [2172 bp, 723 aa] {ON} Anc_1.9
           YCL057W
          Length = 723

 Score =  885 bits (2286), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 444/736 (60%), Positives = 536/736 (72%), Gaps = 24/736 (3%)

Query: 12  RVGNTLFRSKKTTFALIALPLFVSYRGIHLNNTYTSSIRNYSQLANTRFTNMPSLTPPQY 71
           R+   +  S+K+  +L+ +P            +Y    R YS +  + F        PQ 
Sbjct: 4   RLSRLVIPSRKSFLSLVCIPA----------TSYLVYNRLYSNMTISAFI------APQA 47

Query: 72  PPSWEFKPEDILSQTKEFIANTKLFYDDLVAIDNPTIENLIVPYINHXXXXXXXXXXXTF 131
            PSW + P  +L   +  I N+   YD+L ++  PT+ENL+ PY+ H            F
Sbjct: 48  APSWNWNPSRLLFDAECVIDNSNRLYDELSSLKKPTVENLVRPYMIHENKISPLINKLCF 107

Query: 132 LQHVSEDKTIRDASMEATMLLQDFEIESGSRVDLFKQFDLIWNQIKDKKDEF---EDFEI 188
           LQHVSED  IR+AS++AT LLQ FEIE+  R DLF QFD IW +I +KKD+F    DFE 
Sbjct: 108 LQHVSEDPKIREASLKATELLQKFEIEASLRHDLFLQFDKIWQEISEKKDDFVKEYDFET 167

Query: 189 WRFVEKCHKDYVRAGLNLPADXXXXXXXXXXXXADNCLKFSKNLGEQKEYILFTAEELKG 248
           W+F+EK HKDYVR+GLNLP D             +N L++SKNLGEQKE I FT EEL G
Sbjct: 168 WKFIEKVHKDYVRSGLNLPEDKREKIKEIKIKIGNNSLQYSKNLGEQKELIAFTREELDG 227

Query: 249 VPESVIEQFEK-VNDEFGIQKLKVTYKYPDIFPVLKNAQNPETRMKAFMGDQNKVPENEH 307
           V ++V EQFEK +++E G +K KVT+KYPDIFPVLK A+NPETR KAF+ DQNKVP+NE 
Sbjct: 228 VSDAVFEQFEKFIDEETGEEKFKVTFKYPDIFPVLKTAKNPETRRKAFLADQNKVPQNED 287

Query: 308 LFKDTLKLRNELALVLGYDTYANYNLDIKMAKNADTVLSFVNDLIVKLQDPAKKELDILK 367
           LF +TLKLRNELA  L Y TYANYNL+ KMAK  +TVL F+NDL  +L+  A KE+ ILK
Sbjct: 288 LFVETLKLRNELATTLNYSTYANYNLEEKMAKRQETVLDFLNDLKYRLKPLAMKEISILK 347

Query: 368 NLKKQEFENEFNMVYDGDYYIWDHRYYDNKYLKENFNVDEEKIAEYYPLESTIDGMLKIY 427
           ++K++E + E N  YD  YYI+DHRYYDNKYLK+NFNVD E I+EYYPLE TI+GMLKIY
Sbjct: 348 DIKQKECK-ELNREYDSHYYIYDHRYYDNKYLKDNFNVDLEAISEYYPLEHTINGMLKIY 406

Query: 428 ETLLKLKFVEVKENKKTWHDDVKQLAVWKLDTPENPEFVGWIFFDLHPRDGKYGHAANFG 487
           E L KLKF E  +NK  WH+DVKQLAVWK+D PE PEFVGWI+FDLHPRDGKYGHAANFG
Sbjct: 407 EELFKLKFNEETKNKSVWHEDVKQLAVWKMDNPEKPEFVGWIYFDLHPRDGKYGHAANFG 466

Query: 488 LSSSYIS-ANGTRSYPITALVCNFSKSTKDKPSLLKHSEITTFFHELGHGIHDLVGNNRI 546
           +SSSY+    G RSYP+TALVCNFSKST  +PSLLKH+EITTFFHELGHGIHDLVG N++
Sbjct: 467 ISSSYVDIETGKRSYPVTALVCNFSKSTATRPSLLKHNEITTFFHELGHGIHDLVGKNKL 526

Query: 547 GRFNGPGAVPWDFVEAPSQMLEFWTWNTKELLSLSQNYKDNAKIDTKLLESLIKTKHVNG 606
            RFNGPGA PWDFVEAPSQMLEFWTWN  EL SLS +Y+ N KI   LL SLIKTKHVNG
Sbjct: 527 SRFNGPGATPWDFVEAPSQMLEFWTWNANELKSLSCHYESNEKIPDDLLTSLIKTKHVNG 586

Query: 607 ALFALRQLHFGLFDMKVHMMSAEELDKLDIKKLWNDLREKICLISNGDQPTTGYNSFGHI 666
           ALFALRQLHFGLFDM VH  +   ++ L++ KLWN+LRE+ICL+  G + + GY+SFGHI
Sbjct: 587 ALFALRQLHFGLFDMTVH--TTNNVESLNLLKLWNELREEICLVETGHELSKGYDSFGHI 644

Query: 667 MXXXXXXXXXXXMWAEVFATDMYYTKFKADPLNPEVGVKYRDIVLARGGLYEIDDNLEEF 726
           M           MWAEVFA DMY+TKF  +PL+ EVGV+YRDIVLA GGLYEI DNL +F
Sbjct: 645 MSDSYSAGYYGYMWAEVFAADMYHTKFSPNPLDSEVGVQYRDIVLANGGLYEIADNLRDF 704

Query: 727 LGRKPAKDAFLEELGL 742
           LGR+P+K+AFL+ELGL
Sbjct: 705 LGREPSKNAFLKELGL 720

>TBLA0A07560 Chr1 complement(1871629..1873854) [2226 bp, 741 aa]
           {ON} Anc_1.9 YCL057W
          Length = 741

 Score =  883 bits (2282), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 437/687 (63%), Positives = 524/687 (76%), Gaps = 11/687 (1%)

Query: 65  SLTPPQYPPSWEFKPEDILSQTKEFIANTKLFYDDLVAIDNPTIENLIVPYINHXXXXXX 124
           +L  PQ  P+W + P  ++   ++ I  +  FYD L  + +P   N +VPY+N+      
Sbjct: 58  NLNAPQAAPTWNWTPSQLVKDAEDLIDQSNHFYDALTNLKSPDFNNFLVPYMNYENKVGS 117

Query: 125 XXXXXTFLQHVSEDKTIRDASMEATMLLQDFEIESGSRVDLFKQFDLIWNQIKDKKDEFE 184
                TFLQHVS +K IRDAS +AT LLQ+FEIE+  R  LF QFD IWNQIKD KD++E
Sbjct: 118 LINQLTFLQHVSSEKDIRDASFKATDLLQNFEIETSLRYGLFLQFDKIWNQIKDSKDKYE 177

Query: 185 ----DFEIWRFVEKCHKDYVRAGLNLPADXXXXXXXXXXXXADNCLKFSKNLGEQKEYIL 240
               D E + FV K H+D+VRAGLNL               A+N LKF+ NLGEQ E++ 
Sbjct: 178 KDPKDLENYEFVRKVHRDFVRAGLNLDESKREKIKEIKKAIANNSLKFATNLGEQTEFVA 237

Query: 241 FTAEELKGVPESVIEQFEKVNDE-FGIQKLKVTYKYPDIFPVLKNAQNPETRMKAFMGDQ 299
           FT EEL GV +SV+EQFEK NDE  G +  KVT+KYPDIFPVLK A+NPETR KAF GDQ
Sbjct: 238 FTKEELDGVSDSVMEQFEKFNDEKTGKEMYKVTFKYPDIFPVLKTARNPETRKKAFAGDQ 297

Query: 300 NKVPENEHLFKDTLKLRNELALVLGYDTYANYNLDIKMAKNADTVLSFVNDLIVKLQDPA 359
           NKV EN  LF +TLKLRN+LA +LGY TYANYNL++KMAK  D+V  F+ DLI +L+   
Sbjct: 298 NKVSENTVLFTNTLKLRNQLADILGYSTYANYNLELKMAKAQDSVFKFLEDLIDRLKPLG 357

Query: 360 KKELDILKNLKKQEFENEFNMVYDGDYYIWDHRYYDNKYLKENFNVDEEKIAEYYPLEST 419
            KE++ILK++K++EF+ E N+ +D  YY+WDHRYYDNKYLK+N+NVD EKI+EYYPL+ST
Sbjct: 358 SKEIEILKSIKEKEFK-ELNLPFDNHYYVWDHRYYDNKYLKDNYNVDLEKISEYYPLDST 416

Query: 420 IDGMLKIYETLLKLKFVEVKE---NKKTWHDDVKQLAVWKLDTPENPEFVGWIFFDLHPR 476
           I+GML IYETLL LKF+E K+   NK  WH +VKQLAVWK+D PENPEFVGWI+FDLHPR
Sbjct: 417 IEGMLNIYETLLNLKFIEEKDDSKNKNVWHKEVKQLAVWKMDNPENPEFVGWIYFDLHPR 476

Query: 477 DGKYGHAANFGLSSSYISANGTRSYPITALVCNFSKSTKDKPSLLKHSEITTFFHELGHG 536
           DGKYGHAANFG+SSSYI  N  RSYP+TALVCNFSK T DKP+LLKH+EITTFFHELGHG
Sbjct: 477 DGKYGHAANFGISSSYIKPNNERSYPVTALVCNFSKVTADKPALLKHNEITTFFHELGHG 536

Query: 537 IHDLVGNNRIGRFNGPGAVPWDFVEAPSQMLEFWTWNTKELLSLSQNYKDNAKIDTKLLE 596
           IHDLVG N   RFNGPGAVPWDFVEAPSQMLEFWTWN  ELLSLS++YK   KI T+LL 
Sbjct: 537 IHDLVGKNNNSRFNGPGAVPWDFVEAPSQMLEFWTWNKNELLSLSKHYKTGEKIPTELLN 596

Query: 597 SLIKTKHVNGALFALRQLHFGLFDMKVHMMSAEELDKLDIKKLWNDLREKICLISNGDQP 656
           SL+ TKHVNGALFALRQLHFGLFDMKVH  ++++L+ LD  KLWN+LRE++ L+ NGD  
Sbjct: 597 SLVATKHVNGALFALRQLHFGLFDMKVH--TSKDLENLDFLKLWNELREEVSLVENGDLF 654

Query: 657 TTGYNSFGHIMXXXXXXXXXXXMWAEVFATDMYYTKFKADPLNPEVGVKYRDIVLARGGL 716
           T GY+SFGHIM           MWAEVFATDMYYTKF A+PL  +VGV+YRD VLARGGL
Sbjct: 655 TKGYDSFGHIMSDSYSAGYYGYMWAEVFATDMYYTKFAANPLETKVGVEYRDWVLARGGL 714

Query: 717 YEIDDNLEEFLGRKPAKDAFLEELGLH 743
           YEI+DNL +FLGRKP+ +AFL+ELGL+
Sbjct: 715 YEIEDNLIQFLGRKPSNEAFLKELGLN 741

>KLLA0C00572g Chr3 (42069..44207) [2139 bp, 712 aa] {ON} similar to
           uniprot|P25375 Saccharomyces cerevisiae YCL057W PRD1
           Zinc metalloendopeptidase found in the cytoplasm and
           intermembrane space of mitochondria
          Length = 712

 Score =  879 bits (2271), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 430/678 (63%), Positives = 530/678 (78%), Gaps = 13/678 (1%)

Query: 69  PQYPPSWEFKPEDILSQTKEFIANTKLFYDDLVAIDNPTIENLIVPYINHXXXXXXXXXX 128
           PQ  PSW +  E++L QT E I ++    D L +I NP++EN + PY++H          
Sbjct: 44  PQAAPSWNYTTEELLKQTHEAIDSSNELLDSLESISNPSVENFVTPYLHHENTISPLFNQ 103

Query: 129 XTFLQHVSEDKTIRDASMEATMLLQDFEIESGSRVDLFKQFDLIWNQIKD----KKDEFE 184
            TFLQHVS DK +RD S + T L+++F IES  R  LF+QFD++WNQ+KD    KKD FE
Sbjct: 104 LTFLQHVSSDKELRDTSTKVTELIENFGIESSLRFKLFRQFDIVWNQLKDDAQFKKDHFE 163

Query: 185 DFEIWRFVEKCHKDYVRAGLNLPADXXXXXXXXXXXXADNCLKFSKNLGEQKEYILFTAE 244
              I++FVEKCHKD++R+GLNLP +            ++N L+FSKNLGEQ E+I FT E
Sbjct: 164 ---IYKFVEKCHKDFLRSGLNLPEEQRDKVKEIKKKISNNSLQFSKNLGEQNEFITFTKE 220

Query: 245 ELKGVPESVIEQFEKVNDEFGIQKLKVTYKYPDIFPVLKNAQNPETRMKAFMGDQNKVPE 304
           EL GV E+V++QFE V DE GI K KVT+KYPDIFPVLK+A+N ETR +AF+GDQNKVP+
Sbjct: 221 ELIGVSENVMKQFETV-DEDGITKYKVTFKYPDIFPVLKSAKNAETRKRAFIGDQNKVPQ 279

Query: 305 NEHLFKDTLKLRNELALVLGYDTYANYNLDIKMAKNADTVLSFVNDLIVKLQDPAKKELD 364
           NE LF +TL+LRN+LA +L YD+YA+YNLDIKMAK  + VL+F+NDL  KL+   +KEL 
Sbjct: 280 NEALFLETLQLRNDLAELLNYDSYADYNLDIKMAKKEEAVLTFLNDLKNKLKPLGEKELT 339

Query: 365 ILKNLKKQEFENEFNMVYDGDYYIWDHRYYDNKYLKENFNVDEEKIAEYYPLESTIDGML 424
            LKNLK++E + E N  YD  YYIWD+RYYDN+YLK+NF +DEEKIAEY+PLESTI GML
Sbjct: 340 KLKNLKEEECK-ELNTPYDRRYYIWDNRYYDNQYLKKNFQIDEEKIAEYFPLESTIKGML 398

Query: 425 KIYETLLKLKFVEVKENKKTWHDDVKQLAVWKLDTPENPEFVGWIFFDLHPRDGKYGHAA 484
           +IYET+LKLKF+E ++N  TWH DVK+L+VWK+D    P FVGWI+FDLHPR+GKYGHAA
Sbjct: 399 QIYETVLKLKFIE-EDNGDTWHPDVKKLSVWKMDD-NFPSFVGWIYFDLHPREGKYGHAA 456

Query: 485 NFGLSSSYISANGTRSYPITALVCNFSKSTKDKPSLLKHSEITTFFHELGHGIHDLVGNN 544
           NFG+SSS++ ++G+RSYP+TALVCNFSK TKDKP+LLKHSE+TTFFHELGHGIHDLVG N
Sbjct: 457 NFGISSSFLKSDGSRSYPVTALVCNFSKPTKDKPALLKHSELTTFFHELGHGIHDLVGGN 516

Query: 545 RIGRFNGPGAVPWDFVEAPSQMLEFWTWNTKELLSLSQNYKDNAKIDTKLLESLIKTKHV 604
            IGRFNGP A PWDFVEAPSQMLEFWTWN KEL SLS++Y+   KI   LL+SL++TKH+
Sbjct: 517 DIGRFNGPSATPWDFVEAPSQMLEFWTWNKKELKSLSKHYQTEEKIPDSLLDSLVRTKHI 576

Query: 605 NGALFALRQLHFGLFDMKVHMMSAEELDKLDIKKLWNDLREKICLISNGDQPTTGYNSFG 664
           NGALFALRQLHFGLFDMKVH  + +++ KL++ +LWN LRE+ICLI NGD  T G+NSFG
Sbjct: 577 NGALFALRQLHFGLFDMKVH--TTKDISKLNVTELWNSLREEICLIDNGDIQTKGFNSFG 634

Query: 665 HIMXXXXXXXXXXXMWAEVFATDMYYTKFKADPLNPEVGVKYRDIVLARGGLYEIDDNLE 724
           HIM           MWA+VFA+DMYYTKF  DPLN +VGV+YRDI+LARGGLYEI+DNL 
Sbjct: 635 HIMSDSYSAGYYGYMWADVFASDMYYTKFLEDPLNSDVGVQYRDIILARGGLYEIEDNLT 694

Query: 725 EFLGRKPAKDAFLEELGL 742
           EFLGRKP   AFL+ELGL
Sbjct: 695 EFLGRKPNNKAFLKELGL 712

>ZYRO0F18392g Chr6 complement(1518902..1521079) [2178 bp, 725 aa]
           {ON} similar to uniprot|P25375 Saccharomyces cerevisiae
           YCL057W PRD1 Zinc metalloendopeptidase found in the
           cytoplasm and intermembrane space of mitochondria
          Length = 725

 Score =  879 bits (2272), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 436/729 (59%), Positives = 539/729 (73%), Gaps = 21/729 (2%)

Query: 20  SKKTTFALIALPLFVSYRGIHLNNTYTSSIRNYSQLANTRFTNMPSL-TPPQYPPSWEFK 78
           ++K+ F+++A+P      GI     Y  S   YS +++      P+L   PQ  PSW F 
Sbjct: 13  TRKSIFSVVAVPALAI--GI-----YRVSKFQYSTMSS------PNLFIAPQSAPSWAFT 59

Query: 79  PEDILSQTKEFIANTKLFYDDLVAIDNPTIENLIVPYINHXXXXXXXXXXXTFLQHVSED 138
           P+ +L +T   I ++K FYD L  + NPT+ENL+ PY++H           TF Q VS D
Sbjct: 60  PQSLLDETHRLIESSKQFYDSLAQLSNPTVENLVKPYMHHENGVGLIESQLTFPQQVSAD 119

Query: 139 KTIRDASMEATMLLQDFEIESGSRVDLFKQFDLIWNQIKDKKDE--FEDFEIWRFVEKCH 196
           K IRDAS++AT  LQ+F IE   R DLF QFD IWN++KDK  E   +++EI+++VEK H
Sbjct: 120 KEIRDASVQATEFLQNFGIEQSLRHDLFLQFDKIWNELKDKSFEQGSQEYEIYKYVEKIH 179

Query: 197 KDYVRAGLNLPADXXXXXXXXXXXXADNCLKFSKNLGEQKEYILFTAEELKGVPESVIEQ 256
           +DY R GL LP D            A N L+FSKNLGEQKE++ FT EEL GV ESV++Q
Sbjct: 180 RDYTRDGLQLPEDKRDKVKQLKIKIAANSLEFSKNLGEQKEFVAFTKEELDGVSESVMDQ 239

Query: 257 FEKVNDEFGIQKLKVTYKYPDIFPVLKNAQNPETRMKAFMGDQNKVPENEHLFKDTLKLR 316
           FE+  DE G  K KVT+KYPDIFPVLK A+NP+TR  AF  DQ+KVP+NE LF +TL+LR
Sbjct: 240 FEQFKDENGTTKYKVTFKYPDIFPVLKTAKNPKTRKLAFARDQDKVPQNEKLFVETLQLR 299

Query: 317 NELALVLGYDTYANYNLDIKMAKNADTVLSFVNDLIVKLQDPAKKELDILKNLKKQEFEN 376
           NELA +LGY TYANYNL++KMAKN D V  F+N+L  KL+    KE + LK +K++E E+
Sbjct: 300 NELADILGYSTYANYNLELKMAKNQDNVWKFLNELKDKLKPLGLKEAENLKQIKQKECES 359

Query: 377 EFNMVYDGDYYIWDHRYYDNKYLKENFNVDEEKIAEYYPLESTIDGMLKIYETLLKLKFV 436
              + YDG YY+WDHRYYDNKYLK+N+NVD EKI+EYYP+ESTI GML IYETLLKLKFV
Sbjct: 360 -LGLPYDGHYYVWDHRYYDNKYLKDNYNVDLEKISEYYPIESTISGMLSIYETLLKLKFV 418

Query: 437 EVK--ENKKTWHDDVKQLAVWKLDTPENPEFVGWIFFDLHPRDGKYGHAANFGLSSSYIS 494
           E    E +  WH+DVKQLAVWK+D P  PEFVGWI+FDLHPRDGKYGHAANFG+S+SY+ 
Sbjct: 419 EETDPEKRSVWHEDVKQLAVWKMDNPSKPEFVGWIYFDLHPRDGKYGHAANFGISASYVK 478

Query: 495 ANGTRSYPITALVCNFSKSTKDKPSLLKHSEITTFFHELGHGIHDLVGNNRIGRFNGPGA 554
            +GTRSYP+TALVCNFSK +  KPSLLKH+EI+TFFHELGHGIHDLVG NR+  FNGPGA
Sbjct: 479 EDGTRSYPVTALVCNFSKPSAKKPSLLKHNEISTFFHELGHGIHDLVGENRLTTFNGPGA 538

Query: 555 VPWDFVEAPSQMLEFWTWNTKELLSLSQNYKDNAKIDTKLLESLIKTKHVNGALFALRQL 614
           VPWDFVEAPSQMLEFWTWN +EL  LS +Y+   KI   LL+SLI TKHV+GALFALRQL
Sbjct: 539 VPWDFVEAPSQMLEFWTWNERELHELSSHYESGEKIPKDLLQSLISTKHVDGALFALRQL 598

Query: 615 HFGLFDMKVHMMSAEELDKLDIKKLWNDLREKICLISNGDQPTTGYNSFGHIMXXXXXXX 674
           HFGLFDM VH  +++ + KLD+ KLWN+LRE++ L+ NGD  T GY+SFGHIM       
Sbjct: 599 HFGLFDMYVH--TSKNVAKLDLLKLWNELREEVSLVENGDTFTKGYDSFGHIMSDSYSAG 656

Query: 675 XXXXMWAEVFATDMYYTKFKADPLNPEVGVKYRDIVLARGGLYEIDDNLEEFLGRKPAKD 734
               MWAEVFA DMY+T+F ADPL+ + GV+YRDIVL RGGLYE +DNL EFLGR+P+++
Sbjct: 657 YYGYMWAEVFAADMYHTRFAADPLDSKAGVQYRDIVLGRGGLYETNDNLREFLGREPSEE 716

Query: 735 AFLEELGLH 743
           AFL+ELGL+
Sbjct: 717 AFLKELGLN 725

>KNAG0C00260 Chr3 (39428..41662) [2235 bp, 744 aa] {ON} Anc_1.9
           YCL057W
          Length = 744

 Score =  875 bits (2262), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 435/688 (63%), Positives = 522/688 (75%), Gaps = 11/688 (1%)

Query: 64  PSLTPPQYP-PSWEFKPEDILSQTKEFIANTKLFYDDLVAIDNPTIENLIVPYINHXXXX 122
           P L PP    P WEF    I  +    I +T  FYD+LV I NP+I+NL+ PY+NH    
Sbjct: 59  PQLVPPAGALPRWEFPSAKIGEEATRIIESTNKFYDELVEISNPSIDNLVKPYMNHENSI 118

Query: 123 XXXXXXXTFLQHVSEDKTIRDASMEATMLLQDFEIESGSRVDLFKQFDLIWNQIKDKKDE 182
                   FLQHVS DK IR+AS +AT LLQ+FEIE+  R DLF QFD IW ++K +K+E
Sbjct: 119 GLMVNQLCFLQHVSSDKEIREASNKATELLQNFEIETSLRHDLFLQFDKIWKELKPRKEE 178

Query: 183 F----EDFEIWRFVEKCHKDYVRAGLNLPADXXXXXXXXXXXXADNCLKFSKNLGEQKEY 238
           F    E FEI++FVEKCHKD+VRAGLNL  +            A N L+FSKNLGEQKE+
Sbjct: 179 FSHDEEQFEIYKFVEKCHKDFVRAGLNLSEEDRNKVKDIKIKIASNSLEFSKNLGEQKEF 238

Query: 239 ILFTAEELKGVPESVIEQFEKVNDEFGIQ-KLKVTYKYPDIFPVLKNAQNPETRMKAFMG 297
           +LF+ E+L GV ++V+EQFE+V DE   +   KVT+KYPDIFPVLK A+N ETR  AF G
Sbjct: 239 LLFSKEQLDGVSDTVMEQFEQVKDETTNETNYKVTFKYPDIFPVLKMAKNAETRKTAFCG 298

Query: 298 DQNKVPENEHLFKDTLKLRNELALVLGYDTYANYNLDIKMAKNADTVLSFVNDLIVKLQD 357
           DQNKVP+NE LF  TLKLR+ELA +LGYDTYANYNL+IKMAK   TV  F+NDL  KL+ 
Sbjct: 299 DQNKVPQNEELFVATLKLRDELATLLGYDTYANYNLEIKMAKKQSTVFKFLNDLKDKLKP 358

Query: 358 PAKKELDILKNLKKQEFENEFNMVYDGDYYIWDHRYYDNKYLKENFNVDEEKIAEYYPLE 417
             +KE+ ILK++K+ E + E  + +DG YYIWDHRYYD KYLK+NFNVD E IAEYYP++
Sbjct: 359 LGEKEIGILKSIKEAECK-ELGVPFDGRYYIWDHRYYDTKYLKDNFNVDHEAIAEYYPID 417

Query: 418 STIDGMLKIYETLLKLKFVEVKENKK--TWHDDVKQLAVWKLDTPENPEFVGWIFFDLHP 475
           STI+GMLKIYET+ KLKFVE K+  K   W++DVKQ+AVWK+D  + P FVGWI+FDLHP
Sbjct: 418 STIEGMLKIYETVFKLKFVEEKDTAKKNVWNEDVKQIAVWKMDNVKTPVFVGWIYFDLHP 477

Query: 476 RDGKYGHAANFGLSSSYISANGTRSYPITALVCNFSKSTKDKPSLLKHSEITTFFHELGH 535
           RDGKYGHAANFG++SSYI  +G+RSYP+TALVCNFSKS+  KPSLLKH+EITTFFHELGH
Sbjct: 478 RDGKYGHAANFGIASSYIREDGSRSYPVTALVCNFSKSSATKPSLLKHNEITTFFHELGH 537

Query: 536 GIHDLVGNNRIGRFNGPGAVPWDFVEAPSQMLEFWTWNTKELLSLSQNYKDNAKIDTKLL 595
           GIHDLVG NR  RFNGPGA PWDFVEAPSQMLEF+TW+   L SLS++YK   +I  KLL
Sbjct: 538 GIHDLVGKNRAARFNGPGATPWDFVEAPSQMLEFYTWDKNALQSLSKHYKTGEQIPEKLL 597

Query: 596 ESLIKTKHVNGALFALRQLHFGLFDMKVHMMSAEELDKLDIKKLWNDLREKICLISNGDQ 655
           +SLI TKHVNGALFALRQLHFGLFDM VH  +++++  LD+ KLW DLR++I L+ NG Q
Sbjct: 598 DSLIATKHVNGALFALRQLHFGLFDMTVH--TSKDVASLDLLKLWGDLRQEISLVENGGQ 655

Query: 656 PTTGYNSFGHIMXXXXXXXXXXXMWAEVFATDMYYTKFKADPLNPEVGVKYRDIVLARGG 715
            T GY+SFGHIM           MWAEVFATDMY TKF  +PL+  VG+KYRDIVLA GG
Sbjct: 656 YTKGYDSFGHIMSDSYSAGYYGYMWAEVFATDMYRTKFAPNPLDSSVGMKYRDIVLANGG 715

Query: 716 LYEIDDNLEEFLGRKPAKDAFLEELGLH 743
           LYEIDDNL+EFLGR+P+KDAFL+ELGL 
Sbjct: 716 LYEIDDNLKEFLGREPSKDAFLKELGLQ 743

>YCL057W Chr3 (24768..26906) [2139 bp, 712 aa] {ON}  PRD1Zinc
           metalloendopeptidase, found in the cytoplasm and
           intermembrane space of mitochondria; with Cym1p,
           involved in degradation of mitochondrial proteins and of
           presequence peptides cleaved from imported proteins
          Length = 712

 Score =  823 bits (2126), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 409/698 (58%), Positives = 514/698 (73%), Gaps = 12/698 (1%)

Query: 50  RNYSQLANTRFTNMPSLTPPQYPPSWEFKPEDILSQTKEFIANTKLFYDDLVAIDNPTIE 109
           R+   +ANT  T+ P    PQ PP+W F P DI  +T E I N+  FYD +  +++P++ 
Sbjct: 22  RSLYSMANT--TSFP--IAPQAPPNWSFTPSDISGKTNEIINNSNNFYDSMSKVESPSVS 77

Query: 110 NLIVPYINHXXXXXXXXXXXTFLQHVSEDKTIRDASMEATMLLQDFEIESGSRVDLFKQF 169
           N + P++             TFLQHVS DK IRDAS+ ++M L +  I+   R D+F QF
Sbjct: 78  NFVEPFMKFENELGPIINQLTFLQHVSSDKEIRDASVNSSMKLDELNIDLSLRHDIFLQF 137

Query: 170 DLIWNQIKDKKDEFEDFEIWRFVEKCHKDYVRAGLNLPADXXXXXXXXXXXXADNCLKFS 229
             +W  ++ K D  E  E +++VEK +KDY+ +GL L               + N + FS
Sbjct: 138 ARVWQDVQSKADSVER-ETFKYVEKSYKDYIHSGLELDEGNRLKIKEIKKKISVNSINFS 196

Query: 230 KNLGEQKEYILFTAEELKGVPESVIEQFEKV-NDEFGIQKL-KVTYKYPDIFPVLKNAQN 287
           KNLGEQKEYI FT E+L+GVP+S++ QFE + +D+   + L KVT+KYPDIFPV+K A +
Sbjct: 197 KNLGEQKEYITFTKEQLEGVPDSILTQFETIKSDKDSNETLYKVTFKYPDIFPVMKLASS 256

Query: 288 PETRMKAFMGDQNKVPENEHLFKDTLKLRNELALVLGYDTYANYNLDIKMAKNADTVLSF 347
            +TR +AF+ DQNKVPENE +  DTLKLR+ELA +LGYDTYANYNL  KMA+++ TV++F
Sbjct: 257 AQTRKQAFLADQNKVPENEAILLDTLKLRDELASLLGYDTYANYNLYDKMAEDSTTVMNF 316

Query: 348 VNDLIVKLQDPAKKELDILKNLKKQEFENEFNMVYDGDYYIWDHRYYDNKYLKENFNVDE 407
           +NDL  KL    +KEL +L+++K ++ + + N   D +YYIWDHRYYDNKYL ENFNVD 
Sbjct: 317 LNDLKDKLIPLGRKELQVLQDMKAEDVK-KLNQGADPNYYIWDHRYYDNKYLLENFNVDL 375

Query: 408 EKIAEYYPLESTIDGMLKIYETLLKLKFVEVK--ENKKTWHDDVKQLAVWKLDTPENPEF 465
           EKI+EY+PLE+TI GML+IYETL  LKF+E K  +NK  WHDDVKQ+AVW +D P++P F
Sbjct: 376 EKISEYFPLEATITGMLEIYETLFNLKFIETKDSQNKSVWHDDVKQIAVWNMDDPKSPNF 435

Query: 466 VGWIFFDLHPRDGKYGHAANFGLSSSYISANGTRSYPITALVCNFSKSTKDKPSLLKHSE 525
           VGWI+FDLHPRDGKYGHAANFGLSSS++  + TRSYP+TALVCNFSKSTKDKPSLLKH+E
Sbjct: 436 VGWIYFDLHPRDGKYGHAANFGLSSSFMIDDTTRSYPVTALVCNFSKSTKDKPSLLKHNE 495

Query: 526 ITTFFHELGHGIHDLVGNNRIGRFNGPGAVPWDFVEAPSQMLEFWTWNTKELLSLSQNYK 585
           I TFFHELGHGIHDLVG N+  RFNGPG+VPWDFVEAPSQMLEFWTWN  EL++LS +YK
Sbjct: 496 IVTFFHELGHGIHDLVGQNKESRFNGPGSVPWDFVEAPSQMLEFWTWNKNELINLSSHYK 555

Query: 586 DNAKIDTKLLESLIKTKHVNGALFALRQLHFGLFDMKVHMMSAEELDKLDIKKLWNDLRE 645
              KI   L+ SLIKTKHVNGALF LRQLHFGLFDMKVH  + ++L  L I   WN LR+
Sbjct: 556 TGEKIPESLINSLIKTKHVNGALFTLRQLHFGLFDMKVH--TCKDLQNLSICDTWNQLRQ 613

Query: 646 KICLISNGDQPTTGYNSFGHIMXXXXXXXXXXXMWAEVFATDMYYTKFKADPLNPEVGVK 705
            I LISNG   + GY+SFGHIM           +WAEVFATDMY+TKF  DPLN + G++
Sbjct: 614 DISLISNGGTLSKGYDSFGHIMSDSYSAGYYGYLWAEVFATDMYHTKFAKDPLNAKNGIQ 673

Query: 706 YRDIVLARGGLYEIDDNLEEFLGRKPAKDAFLEELGLH 743
           YRDIVLARGGLY+I+DNL+EFLGR+P+KDAFL+ELGL 
Sbjct: 674 YRDIVLARGGLYDINDNLKEFLGREPSKDAFLKELGLQ 711

>NDAI0A00180 Chr1 (14692..16914) [2223 bp, 740 aa] {ON} Anc_1.9
          Length = 740

 Score =  824 bits (2129), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 420/702 (59%), Positives = 520/702 (74%), Gaps = 10/702 (1%)

Query: 46  TSSIRNYSQLANTRFTNMPSLTPPQYPPSWEFKPEDILSQTKEFIANTKLFYDDLVAIDN 105
           T S  N     NT       + P    P W + P+ IL +TK +I  T  +Y+ +  I++
Sbjct: 44  TYSPNNIIMTNNTVNNKHGFIAPANTVPDWTWTPKQILDETKSYIEKTNKYYNSISEIES 103

Query: 106 PTIENLIVPYINHXXXXXXXXXXXTFLQHVSEDKTIRDASMEATMLLQDFEIESGSRVDL 165
           P+IENLI+PY+N+           TFLQHVS DK IRDAS+EAT LL+D +I +  R ++
Sbjct: 104 PSIENLIIPYMNYENKMGLLINQLTFLQHVSADKKIRDASLEATRLLEDHDILTSLRWEI 163

Query: 166 FKQFDLIWNQIKDKKDEFED--FEIWRFVEKCHKDYVRAGLNLPADXXXXXXXXXXXXAD 223
           ++QF+ +W  +++  D  ++  FE ++F+EK HKD +R GL   ++            + 
Sbjct: 164 WEQFEKVWETVQNDDDFLKNHQFETYKFIEKIHKDSLRNGLK--SERNYQLKYIKGKISA 221

Query: 224 NCLKFSKNLGEQKEYILFTAEELKGVPESVIEQFEK-VNDEFGIQKLKVTYKYPDIFPVL 282
           + L FS NLGEQ EY+ FT EEL GV E+V++QFEK ++ +   +K KVT+KYPDIFPVL
Sbjct: 222 DALTFSSNLGEQNEYVSFTKEELDGVSETVMDQFEKFIDPKTNEKKYKVTFKYPDIFPVL 281

Query: 283 KNAQNPETRMKAFMGDQNKVPENEHLFKDTLKLRNELALVLGYDTYANYNLDIKMAKNAD 342
           K A+NP+TR  AF+GDQNKVPENE L  + LKLR ELA  LGY TYANYNLDIKMAKN +
Sbjct: 282 KTAKNPKTRKIAFLGDQNKVPENEKLLCNVLKLRKELANTLGYSTYANYNLDIKMAKNQE 341

Query: 343 TVLSFVNDLIVKLQDPAKKELDILKNLKKQEFENEFNMVYDGDYYIWDHRYYDNKYLKEN 402
           TVL F+NDL  KL+  A+KE+ ILK+LKK+E E E  + YDG YYIWDHRYYDNKYLK+N
Sbjct: 342 TVLKFLNDLKEKLKPLAEKEIKILKDLKKKECE-ELGIPYDGHYYIWDHRYYDNKYLKDN 400

Query: 403 FNVDEEKIAEYYPLESTIDGMLKIYETLLKLKFVEVKE--NKKTWHDDVKQLAVWKLDTP 460
           FNVD EKI+EYYPLESTIDGMLKIYET+L LKF+E  +   K  WH DVKQL+VW +D  
Sbjct: 401 FNVDIEKISEYYPLESTIDGMLKIYETVLNLKFIEETDPLAKNVWHPDVKQLSVWNMDDR 460

Query: 461 ENPEFVGWIFFDLHPRDGKYGHAANFGLSSSYISANGTRSYPITALVCNFSKSTKDKPSL 520
            NP FVGWI+FDL+PRDGKYGHAANFG++SSYI+    RSYP+TALVCNFSK TK+KP+L
Sbjct: 461 ANPAFVGWIYFDLYPRDGKYGHAANFGIASSYITEENKRSYPVTALVCNFSKPTKNKPAL 520

Query: 521 LKHSEITTFFHELGHGIHDLVGNNRIGRFNGPGAVPWDFVEAPSQMLEFWTWNTKELLSL 580
           LKHSEITTFFHELGHGIHDLVG N+  RFNGPG+VPWDFVEAPSQMLEFWTWN  ELLSL
Sbjct: 521 LKHSEITTFFHELGHGIHDLVGQNKAARFNGPGSVPWDFVEAPSQMLEFWTWNKNELLSL 580

Query: 581 SQNYKDNAKIDTKLLESLIKTKHVNGALFALRQLHFGLFDMKVHMMSAEELDKLDIKKLW 640
           S++YK   KI   LL+SLI TKHVNGALFALRQLHFGLFDM VH  + ++++ LD+ KLW
Sbjct: 581 SKHYKTGEKIPEDLLDSLISTKHVNGALFALRQLHFGLFDMTVH--TTKDIENLDLLKLW 638

Query: 641 NDLREKICLISNGDQPTTGYNSFGHIMXXXXXXXXXXXMWAEVFATDMYYTKFKADPLNP 700
           N+ RE+ICL+ NG+  T GYNSFGHI+           MWAEVFA DMY+TKF  +PL+ 
Sbjct: 639 NESREEICLVENGENFTKGYNSFGHIISDSYSAGYYGYMWAEVFAADMYHTKFAPNPLDV 698

Query: 701 EVGVKYRDIVLARGGLYEIDDNLEEFLGRKPAKDAFLEELGL 742
            VG+KYRD++LA+GGLYEI+DNL EFLGR+P+   FL+ELGL
Sbjct: 699 SVGIKYRDLILAKGGLYEINDNLLEFLGREPSNKPFLKELGL 740

>Suva_3.156 Chr3 (234520..236658) [2139 bp, 712 aa] {ON} YCL057W
           (REAL)
          Length = 712

 Score =  807 bits (2084), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 398/696 (57%), Positives = 501/696 (71%), Gaps = 8/696 (1%)

Query: 52  YSQLANTRFTNMPSLTPPQYPPSWEFKPEDILSQTKEFIANTKLFYDDLVAIDNPTIENL 111
           Y++  ++  T     T PQ PPSW F P DI  +TKE I  +  FYD +  +++P + N 
Sbjct: 20  YTRFLSSMTTTASFPTAPQTPPSWSFTPNDISGRTKEIIEKSNKFYDSMSQVESPAVTNF 79

Query: 112 IVPYINHXXXXXXXXXXXTFLQHVSEDKTIRDASMEATMLLQDFEIESGSRVDLFKQFDL 171
           + P++             TFLQHVS DK IRDAS++++M L +  I+   R D+F QF  
Sbjct: 80  VEPFMKFENELGPIINQLTFLQHVSSDKEIRDASVDSSMKLDELNIDLSLRHDVFLQFAR 139

Query: 172 IWNQIKDKKDEFEDFEIWRFVEKCHKDYVRAGLNLPADXXXXXXXXXXXXADNCLKFSKN 231
           +W   + + D  E  E +R++EK +KDY+ +GL L               + N + FSKN
Sbjct: 140 VWQDAQSQADSIER-ETFRYIEKSYKDYIHSGLELDEPDRLKVKEIKKKISVNSINFSKN 198

Query: 232 LGEQKEYILFTAEELKGVPESVIEQFEKVND--EFGIQKLKVTYKYPDIFPVLKNAQNPE 289
           LGEQKE+I FT E+L+GVP+S++ QFE +    +      KVT+KYPDIFPV+K A + +
Sbjct: 199 LGEQKEFITFTKEQLEGVPDSILAQFETIESGKDSNETLYKVTFKYPDIFPVMKLASSSQ 258

Query: 290 TRMKAFMGDQNKVPENEHLFKDTLKLRNELALVLGYDTYANYNLDIKMAKNADTVLSFVN 349
           TR +AF+ DQNKV ENE +  DTLKLR+E+A +LGYDTYANYNL  KMAK++ TV+ F+N
Sbjct: 259 TRKQAFLADQNKVSENEAILLDTLKLRDEVASLLGYDTYANYNLYDKMAKDSTTVMDFLN 318

Query: 350 DLIVKLQDPAKKELDILKNLKKQEFENEFNMVYDGDYYIWDHRYYDNKYLKENFNVDEEK 409
           DL  KL    +KEL IL+++K ++ +   N   D +YYIWDHRYYDNKYL ENFNVD EK
Sbjct: 319 DLKKKLIPLGEKELQILQDMKAKDVKKR-NQDEDPNYYIWDHRYYDNKYLLENFNVDLEK 377

Query: 410 IAEYYPLESTIDGMLKIYETLLKLKFVEVK--ENKKTWHDDVKQLAVWKLDTPENPEFVG 467
           I+E++PLE+TI GML+IYETL  LKF+E K  + K  WH+DVKQLAVW +D P++P F+G
Sbjct: 378 ISEFFPLETTITGMLQIYETLFNLKFIETKNPQEKSVWHEDVKQLAVWNMDDPKSPRFIG 437

Query: 468 WIFFDLHPRDGKYGHAANFGLSSSYISANGTRSYPITALVCNFSKSTKDKPSLLKHSEIT 527
           WI+FDLHPRDGKYGHAANFGLSSS++  + TRSYP+TALVCNFSKSTKDKPSLLKH+EI 
Sbjct: 438 WIYFDLHPRDGKYGHAANFGLSSSFMVNDTTRSYPVTALVCNFSKSTKDKPSLLKHNEIV 497

Query: 528 TFFHELGHGIHDLVGNNRIGRFNGPGAVPWDFVEAPSQMLEFWTWNTKELLSLSQNYKDN 587
           TFFHELGHGIHDLVG N+  RFNGPG+VPWDFVEAPSQMLEFWTWN  EL+ LS +YK  
Sbjct: 498 TFFHELGHGIHDLVGQNKESRFNGPGSVPWDFVEAPSQMLEFWTWNKNELMHLSSHYKTG 557

Query: 588 AKIDTKLLESLIKTKHVNGALFALRQLHFGLFDMKVHMMSAEELDKLDIKKLWNDLREKI 647
            KI   L++SLIKTKHVNGALF LRQLHFGLFDMKVH  S ++L  L I   WN LR+ I
Sbjct: 558 EKIPEPLIDSLIKTKHVNGALFTLRQLHFGLFDMKVH--SCKDLQNLSICDTWNQLRQDI 615

Query: 648 CLISNGDQPTTGYNSFGHIMXXXXXXXXXXXMWAEVFATDMYYTKFKADPLNPEVGVKYR 707
            L+SNG   + GY SFGHIM           +WAEVFATDMY+TKF  DPLN + G++YR
Sbjct: 616 SLMSNGGTLSKGYASFGHIMSDSYSAGYYGYLWAEVFATDMYHTKFAKDPLNTKNGIQYR 675

Query: 708 DIVLARGGLYEIDDNLEEFLGRKPAKDAFLEELGLH 743
           DIVLARGGL +I+D+L+EFLGR+P+KDAFL+ELGL 
Sbjct: 676 DIVLARGGLRDINDSLKEFLGREPSKDAFLKELGLQ 711

>Skud_3.7 Chr3 (12763..14901) [2139 bp, 712 aa] {ON} YCL057W (REAL)
          Length = 712

 Score =  805 bits (2080), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 407/716 (56%), Positives = 513/716 (71%), Gaps = 15/716 (2%)

Query: 37  RGIHLNNTYTSSIRNYSQLANTR----FTNMPSL-TPPQYPPSWEFKPEDILSQTKEFIA 91
           R +   N +TS +   S L  TR     TN  S    PQ PP+W F P DI  +T E I 
Sbjct: 2   RLLLCKNWFTSPV--ISPLLYTRCLSAMTNAASFPIAPQAPPTWSFTPTDIGGKTTEIID 59

Query: 92  NTKLFYDDLVAIDNPTIENLIVPYINHXXXXXXXXXXXTFLQHVSEDKTIRDASMEATML 151
            +  FY+ +  +++P++ N I P++             TFLQHVS DK IRDAS++++M 
Sbjct: 60  KSNKFYELMSQVESPSVTNFIEPFMKFENELGPIINRLTFLQHVSSDKEIRDASVDSSMK 119

Query: 152 LQDFEIESGSRVDLFKQFDLIWNQIKDKKDEFEDFEIWRFVEKCHKDYVRAGLNLPADXX 211
           L +  I+   R D+F QF  +W   + K D  +  E ++++EK +KD++ +GL L     
Sbjct: 120 LDELNIDLSLRHDIFLQFARVWQDAQPKADSLKK-ETFKYIEKSYKDFIHSGLELDEANR 178

Query: 212 XXXXXXXXXXADNCLKFSKNLGEQKEYILFTAEELKGVPESVIEQFEKVNDEFGIQKL-- 269
                     + N + FSKNLGEQKEYI FT E+L+GVP+S++ QFE    E G +    
Sbjct: 179 LKIKEIKKKISMNSINFSKNLGEQKEYITFTKEQLEGVPDSILAQFETTKSEKGGEDTLY 238

Query: 270 KVTYKYPDIFPVLKNAQNPETRMKAFMGDQNKVPENEHLFKDTLKLRNELALVLGYDTYA 329
           KVT+KYPDIFPV+K A + +TR +AF+ DQNKVPENE +  DTLKLR+ELA +LGY+TYA
Sbjct: 239 KVTFKYPDIFPVMKLASSAQTRKQAFLADQNKVPENEAILLDTLKLRDELASLLGYNTYA 298

Query: 330 NYNLDIKMAKNADTVLSFVNDLIVKLQDPAKKELDILKNLKKQEFENEFNMVYDGDYYIW 389
           +YNL  KMAK++ TV+ F+NDL  KL    KKEL +L+++K ++ E       D +YYIW
Sbjct: 299 DYNLYDKMAKDSRTVMDFLNDLKGKLIPLGKKELQVLQDMKVKDVERS-KKDEDPNYYIW 357

Query: 390 DHRYYDNKYLKENFNVDEEKIAEYYPLESTIDGMLKIYETLLKLKFVEVKE--NKKTWHD 447
           DHRYYDNK+L ENFNVD EKI+EY+PLE+TI GML+IYETL  LKF+E KE  NK  WH+
Sbjct: 358 DHRYYDNKHLLENFNVDLEKISEYFPLETTITGMLQIYETLFNLKFIETKEPQNKSVWHE 417

Query: 448 DVKQLAVWKLDTPENPEFVGWIFFDLHPRDGKYGHAANFGLSSSYISANGTRSYPITALV 507
           DVKQLAVW +D P++P F+GWI+FDLHPRDGKYGHAANFGLSSS++  +  RSYP+TALV
Sbjct: 418 DVKQLAVWNMDDPKSPRFIGWIYFDLHPRDGKYGHAANFGLSSSFMINDSKRSYPVTALV 477

Query: 508 CNFSKSTKDKPSLLKHSEITTFFHELGHGIHDLVGNNRIGRFNGPGAVPWDFVEAPSQML 567
           CNFSKSTKDKPSLLKH+EI TFFHELGHGIHDLVG N+  RFNGPG+VPWDFVEAPSQML
Sbjct: 478 CNFSKSTKDKPSLLKHNEIVTFFHELGHGIHDLVGQNKESRFNGPGSVPWDFVEAPSQML 537

Query: 568 EFWTWNTKELLSLSQNYKDNAKIDTKLLESLIKTKHVNGALFALRQLHFGLFDMKVHMMS 627
           EFWTWN  EL+SLS +YK   +I   L++SLIKTKHVNGALF LRQLHFGLFDMKVH  +
Sbjct: 538 EFWTWNKNELVSLSSHYKTGERIPESLIDSLIKTKHVNGALFTLRQLHFGLFDMKVH--T 595

Query: 628 AEELDKLDIKKLWNDLREKICLISNGDQPTTGYNSFGHIMXXXXXXXXXXXMWAEVFATD 687
            ++L+ L I   WN LR++I L+ NG   + GY+SFGHIM           +WAEVFATD
Sbjct: 596 CKDLENLSICHTWNQLRQEISLMPNGGTLSKGYDSFGHIMSDSYSAGYYGYLWAEVFATD 655

Query: 688 MYYTKFKADPLNPEVGVKYRDIVLARGGLYEIDDNLEEFLGRKPAKDAFLEELGLH 743
           MY+TKF  DPLN + GV+YRDIVLARGGLY+I+DNL+EFLGR+P+KDAFL+ELGL 
Sbjct: 656 MYHTKFAKDPLNTKNGVQYRDIVLARGGLYDINDNLKEFLGREPSKDAFLKELGLQ 711

>Smik_3.18 Chr3 (26213..28351) [2139 bp, 712 aa] {ON} YCL057W (REAL)
          Length = 712

 Score =  805 bits (2078), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 395/679 (58%), Positives = 500/679 (73%), Gaps = 8/679 (1%)

Query: 69  PQYPPSWEFKPEDILSQTKEFIANTKLFYDDLVAIDNPTIENLIVPYINHXXXXXXXXXX 128
           PQ PP+W F P DI  +TKE I  +  FY+ +  ++ PT+ N + P++            
Sbjct: 37  PQAPPNWTFTPNDINGKTKEIIDKSNNFYESMSNVETPTVTNFVEPFMKFENELGPIINQ 96

Query: 129 XTFLQHVSEDKTIRDASMEATMLLQDFEIESGSRVDLFKQFDLIWNQIKDKKDEFEDFEI 188
            TFLQHVS DK IRDAS+ ++M L +  I+   R D++ QF  +W   + K D  E  E 
Sbjct: 97  LTFLQHVSSDKEIRDASVNSSMKLDELNIDLSLRHDIYLQFARVWQDAQSKSDSIER-ET 155

Query: 189 WRFVEKCHKDYVRAGLNLPADXXXXXXXXXXXXADNCLKFSKNLGEQKEYILFTAEELKG 248
           ++++EK +KDY+ +GL L               + N + FSKNLGEQKEYI FT E+L+G
Sbjct: 156 FKYIEKSYKDYIHSGLELDESNRLKIKDIKKKISVNSINFSKNLGEQKEYITFTKEQLEG 215

Query: 249 VPESVIEQFEKVNDEFGIQKL--KVTYKYPDIFPVLKNAQNPETRMKAFMGDQNKVPENE 306
           VP+SV+ QFE +  +    +   KVT+KYPDIFPV+K A + +TR +AF+ DQNKVPENE
Sbjct: 216 VPDSVLAQFETIKSDKDRNETLYKVTFKYPDIFPVMKLASSAQTRKEAFLADQNKVPENE 275

Query: 307 HLFKDTLKLRNELALVLGYDTYANYNLDIKMAKNADTVLSFVNDLIVKLQDPAKKELDIL 366
            +  DTL+LR++LA +LGYDTYANYNL  KMAK++ TV+ F+NDL  KL    KKEL++L
Sbjct: 276 AILLDTLELRDKLASLLGYDTYANYNLYDKMAKDSTTVMDFLNDLKDKLIPLGKKELELL 335

Query: 367 KNLKKQEFENEFNMVYDGDYYIWDHRYYDNKYLKENFNVDEEKIAEYYPLESTIDGMLKI 426
           + +K ++ + + N   D +YYIWDHRYYDNKYL ENFNVD EKI+EY+PLE+TI GML+I
Sbjct: 336 QEMKSKDVK-KLNQDEDPNYYIWDHRYYDNKYLLENFNVDLEKISEYFPLETTITGMLQI 394

Query: 427 YETLLKLKFVEVK--ENKKTWHDDVKQLAVWKLDTPENPEFVGWIFFDLHPRDGKYGHAA 484
           YETL  LKF+E+K  ++K  WHDDVKQLAVW +D P++P+FVGWI+FDLHPRDGKYGHAA
Sbjct: 395 YETLFNLKFIEIKDGQSKSVWHDDVKQLAVWNMDDPKSPKFVGWIYFDLHPRDGKYGHAA 454

Query: 485 NFGLSSSYISANGTRSYPITALVCNFSKSTKDKPSLLKHSEITTFFHELGHGIHDLVGNN 544
           NFGLSSS+++ +  RSYP+TALVCNFSKSTKDKPSLLKH+EI TFFHELGHGIHDLVG N
Sbjct: 455 NFGLSSSFMTNDSVRSYPVTALVCNFSKSTKDKPSLLKHNEIVTFFHELGHGIHDLVGQN 514

Query: 545 RIGRFNGPGAVPWDFVEAPSQMLEFWTWNTKELLSLSQNYKDNAKIDTKLLESLIKTKHV 604
           +  RFNGPG+VPWDFVEAPSQMLEFWTWN  EL+ LS +Y+   KI   L++SLIKTKHV
Sbjct: 515 KESRFNGPGSVPWDFVEAPSQMLEFWTWNKNELIDLSSHYETGEKIPESLIDSLIKTKHV 574

Query: 605 NGALFALRQLHFGLFDMKVHMMSAEELDKLDIKKLWNDLREKICLISNGDQPTTGYNSFG 664
           NGALF LRQLHFGLFDMKVH  + ++L  L I + WN LR+ I LISNG   + GY+SFG
Sbjct: 575 NGALFTLRQLHFGLFDMKVH--TCKDLQNLSICETWNQLRQDISLISNGGTLSKGYDSFG 632

Query: 665 HIMXXXXXXXXXXXMWAEVFATDMYYTKFKADPLNPEVGVKYRDIVLARGGLYEIDDNLE 724
           HIM           +WAEVFATDMY+TKF  DPLN + G++YRDIVLARGGL +I D+L+
Sbjct: 633 HIMSDSYSAGYYGYLWAEVFATDMYHTKFAKDPLNTKNGIQYRDIVLARGGLNDIGDDLK 692

Query: 725 EFLGRKPAKDAFLEELGLH 743
           +FLGR+P+KDAFL+ELGL 
Sbjct: 693 KFLGREPSKDAFLKELGLQ 711

>Ecym_1011 Chr1 (19924..22074) [2151 bp, 716 aa] {ON} similar to
           Ashbya gossypii AGR406C/ AGR405C
          Length = 716

 Score =  768 bits (1982), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 378/684 (55%), Positives = 495/684 (72%), Gaps = 9/684 (1%)

Query: 62  NMPSLTPPQYPPSWEFKPEDILSQTKEFIANTKLFYDDLVAIDNPTIENLIVPYINHXXX 121
           NM SL  P+  PSW+F  ++I+S  ++ I     FYD + +++ P +EN +V  I+H   
Sbjct: 39  NMSSLLSPKLAPSWDFAADEIVSLAQKAIDEGTKFYDSVASLETPDLENFVVAVIDHEDE 98

Query: 122 XXXXXXXXTFLQHVSEDKTIRDASMEATMLLQDFEIESGSRVDLFKQFDLIWNQIKDKKD 181
                   TFLQHVS DK +RDAS+EAT L+Q++ IE+ SR DL+ QF  +W Q KD ++
Sbjct: 99  TDGYMSQLTFLQHVSADKEVRDASIEATKLIQEWGIETSSRYDLYSQFSKVWEQYKDDEN 158

Query: 182 -EFEDFEIWRFVEKCHKDYVRAGLNLPADXXXXXXXXXXXXADNCLKFSKNLGEQKEYIL 240
            +  D E++ ++E  +KDY+ AG+ LP +            A+N L FS NLGEQ +YI 
Sbjct: 159 LKKNDPELYWYMENVNKDYIHAGMGLPEESRNKIKEIKKKLANNSLAFSNNLGEQNDYIA 218

Query: 241 FTAEELKGVPESVIEQFEKVNDEFGIQKLKVTYKYPDIFPVLKNAQNPETRMKAFMGDQN 300
           FT +EL GV E+ + QFEKV ++ G++K K+T+KYPDI PVL  A+NPETR +A++GDQN
Sbjct: 219 FTKDELVGVSETTLGQFEKVIED-GVEKYKMTFKYPDIHPVLNTAKNPETRKRAYIGDQN 277

Query: 301 KVPENEHLFKDTLKLRNELALVLGYDTYANYNLDIKMAKNADTVLSFVNDLIVKLQDPAK 360
           KVP+NE +  +TLKLRNELA + G+ TYA+Y L++KMAK  +TV +F+ DL  KL    K
Sbjct: 278 KVPQNEQILIETLKLRNELAEIHGHPTYASYQLEMKMAKKQETVFNFLYDLKDKLLPGGK 337

Query: 361 KELDILKNLKKQEFENEFNMVYDGDYYIWDHRYYDNKYLKENFNVDEEKIAEYYPLESTI 420
           K+L+ LK+LK+QE++ E  + Y+G +  WD+RYYD+KYLKENF+VDEE++A+Y+PL+ TI
Sbjct: 338 KDLENLKSLKEQEYK-ELGLPYNGSFNSWDYRYYDDKYLKENFDVDEEELAKYFPLQHTI 396

Query: 421 DGMLKIYETLLKLKFVEVKE--NKKTWHDDVKQLAVWKLDTPENPEFVGWIFFDLHPRDG 478
           DGML IY+ L  LKFVE      K  WH+DVKQ AVW LD   NPEFVGWI+FDLHPR+G
Sbjct: 397 DGMLNIYQKLFNLKFVEETRECGKNVWHEDVKQFAVWDLDKC-NPEFVGWIYFDLHPREG 455

Query: 479 KYGHAANFGLSSSYISANGTRSYPITALVCNFSKSTKDKPSLLKHSEITTFFHELGHGIH 538
           KYGHAANFGL S Y++  GTR YP+T LVCNFSK +  +P+LLKH E+ TFFHELGHGIH
Sbjct: 456 KYGHAANFGLYSPYVTEEGTRHYPVTVLVCNFSKPSSTRPALLKHGEVVTFFHELGHGIH 515

Query: 539 DLVGNNRIGRFNGPGAVPWDFVEAPSQMLEFWTWNTKELLSLSQNYKDNAKIDTKLLESL 598
            LVG +RIG  NGP ++PWDFVEAPSQMLEFW WN  ++L LS++Y+   +I  +L++SL
Sbjct: 516 ALVGKSRIGHLNGPSSIPWDFVEAPSQMLEFWPWNKDQILKLSKHYETGEQIPDELVDSL 575

Query: 599 IKTKHVNGALFALRQLHFGLFDMKVHMMSAEELDKLDIKKLWNDLREKICLISNGDQPTT 658
           IKTKHVN  L  LRQLHF LFDM VH  + +ELDKLDIK LWN+LRE++ LISNGD  T 
Sbjct: 576 IKTKHVNAGLSNLRQLHFSLFDMTVH--TDKELDKLDIKSLWNNLREEVTLISNGDVLTK 633

Query: 659 GYNSFGHIMXXXXXXXXXXXMWAEVFATDMYYTKFKADPLNPEVGVKYRDIVLARGGLYE 718
           GY+SF HIM           MW+EVFA DMY+T F  +PL+  VG +YRDI+LA+GGL +
Sbjct: 634 GYDSFSHIM-SGYSAGYYGYMWSEVFAADMYHTMFAPNPLDTSVGTRYRDIILAKGGLRD 692

Query: 719 IDDNLEEFLGRKPAKDAFLEELGL 742
           I+D+LEEFLGR+P   AFL+ELGL
Sbjct: 693 IEDSLEEFLGREPNNKAFLKELGL 716

>AGR406C Chr7 complement(1472496..1474547) [2052 bp, 683 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YCL057W
           (PRD1); Tandem gene duplication in this genome
          Length = 683

 Score =  668 bits (1723), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 339/684 (49%), Positives = 462/684 (67%), Gaps = 9/684 (1%)

Query: 62  NMPSLTPPQYPPSWEFKPEDILSQTKEFIANTKLFYDDLVAIDNPTIENLIVPYINHXXX 121
           ++ SL PPQ  PSW F  +D++S + + I  T+  Y +++    PTI+N I+P I H   
Sbjct: 3   DLASLVPPQAAPSWNFSAQDVISLSHQLINQTEAVYHNVLQEKPPTIDNYIMPLIYHEEE 62

Query: 122 XXXXXXXXTFLQHVSEDKTIRDASMEATMLLQDFEIESGSRVDLFKQFDLIWNQIKD-KK 180
                    FL++VS D  IR+AS  AT +L D+ I   S+ DL++ FD +W Q KD +K
Sbjct: 63  TDLLWNQLVFLRNVSPDPEIREASKNATSMLDDWIIGLTSKYDLYQHFDEVWAQYKDDEK 122

Query: 181 DEFEDFEIWRFVEKCHKDYVRAGLNLPADXXXXXXXXXXXXADNCLKFSKNLGEQKEYIL 240
            + E+FE++R++EK    Y R+G+ +P +            A   L+FS NLGE+ EYI 
Sbjct: 123 FKKENFELYRYMEKDADGYRRSGMKVPVENRKRLDEVKSKIAAAELEFSSNLGEEVEYIA 182

Query: 241 FTAEELKGVPESVIEQFEKVNDEFGIQKLKVTYKYPDIFPVLKNAQNPETRMKAFMGDQN 300
           FT EEL+GVP++V+ QFEK+  E G++K KVT+KYPDI PVL+ A NPETR +A M D+N
Sbjct: 183 FTKEELEGVPDTVLNQFEKII-EGGVEKFKVTFKYPDIGPVLRLASNPETRRRASMADEN 241

Query: 301 KVPENEHLFKDTLKLRNELALVLGYDTYANYNLDIKMAKNADTVLSFVNDLIVKLQDPAK 360
           +V  NE L  +TL+LR ELA +LG+  +A YNLD KMAKN +TVL F+NDL+ KL    K
Sbjct: 242 RVAANEPLLFETLELRRELADLLGFKNFAAYNLDDKMAKNEETVLKFLNDLVEKLLPVGK 301

Query: 361 KELDILKNLKKQEFENEFNMVYDGDYYIWDHRYYDNKYLKENFNVDEEKIAEYYPLESTI 420
            +L+ILK  K ++++++ N+ +DG++Y WD  YY NK L+E +NV+ + +A+Y+P+ES I
Sbjct: 302 NDLEILKKKKAEDYKSK-NLTFDGEFYSWDTGYYTNKILRERYNVNPDDLAQYFPVESAI 360

Query: 421 DGMLKIYETLLKLKFVEVKEN--KKTWHDDVKQLAVWKLDTPENPEFVGWIFFDLHPRDG 478
           +GML IY TL +LKFVE+ +   K  WH+DVKQ AVW +D  +NP+F GW++FDLHPRDG
Sbjct: 361 EGMLNIYTTLFRLKFVEITDECEKSVWHEDVKQFAVWNIDDEDNPKFQGWLYFDLHPRDG 420

Query: 479 KYGHAANFGLSSSYISANGTRSYPITALVCNFSKSTKDKPSLLKHSEITTFFHELGHGIH 538
           KYGHAANFG+ S+Y   +G++SYP+T LV NFSK T  +P+LLK  E+TTFFHELGHGIH
Sbjct: 421 KYGHAANFGMVSAYRKRDGSKSYPVTILVTNFSKPTPTRPALLKLGELTTFFHELGHGIH 480

Query: 539 DLVGNNRIGRFNGPGAVPWDFVEAPSQMLEFWTWNTKELLSLSQNYKDNAKIDTKLLESL 598
           DLVG+N +   NGPG+VPWDFVEAPSQMLE+WT     L  LS++Y+   KI   LL++ 
Sbjct: 481 DLVGSNDLESLNGPGSVPWDFVEAPSQMLEYWTARRDVLTMLSKHYETGEKIPKSLLDAW 540

Query: 599 IKTKHVNGALFALRQLHFGLFDMKVHMMSAEELDKLDIKKLWNDLREKICLISNGDQPTT 658
                +N  L  L QL  GLFDM VH     +    +++KLWNDL  +I L++  +  +T
Sbjct: 541 FSVGGLNSGLANLGQLKLGLFDMYVH---TRDYKGAEVRKLWNDLTREIGLMNLKNYTST 597

Query: 659 GYNSFGHIMXXXXXXXXXXXMWAEVFATDMYYTKFKADPLNPEVGVKYRDIVLARGGLYE 718
           GY+SFGHIM           +W++VFA DMY TKFK +P N  VGV+YRD +LA GGLY+
Sbjct: 598 GYDSFGHIM-AGYAAGYYGYLWSQVFAADMYDTKFKPNPFNATVGVEYRDTILATGGLYD 656

Query: 719 IDDNLEEFLGRKPAKDAFLEELGL 742
           + DNL +FLGR P   AFL  LGL
Sbjct: 657 MTDNLRKFLGRDPNNKAFLRGLGL 680

>AGR405C Chr7 complement(1469769..1471922) [2154 bp, 717 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YCL057W
           (PRD1); Tandem gene duplication in this genome
          Length = 717

 Score =  613 bits (1580), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 306/683 (44%), Positives = 441/683 (64%), Gaps = 9/683 (1%)

Query: 65  SLTPPQYPPSWEFKPEDILSQTKEFIANTKLFYDDLVAI-DNPTIENLIVPYINHXXXXX 123
           SL PPQ PP W +   +++         +   Y+ + +  D  T++N I P + +     
Sbjct: 11  SLVPPQPPPVWNYTATEVIDLAYGLAQKSDAVYESVFSQKDEFTLDNYIWPLLYNDQETD 70

Query: 124 XXXXXXTFLQHVSEDKTIRDASMEATMLLQDFEIESGSRVDLFKQFDLIWNQIKDKKD-E 182
                  FL++VS D  +R+AS+    +L  +     S+ DL+  F+ IW Q KD ++ +
Sbjct: 71  LLWNQLIFLRNVSPDPKVREASLSTGKILDQWVANISSKYDLYTNFEHIWTQYKDDEEFK 130

Query: 183 FEDFEIWRFVEKCHKDYVRAGLNLPADXXXXXXXXXXXXADNCLKFSKNLGEQKEYILFT 242
             ++E+++++EK    Y R   NL               + + L+FS NLGE+ EYI FT
Sbjct: 131 VTNYELYKYMEKDASYYNRNKRNLTNAESIELGQVTRKISVDTLQFSINLGEETEYITFT 190

Query: 243 AEELKGVPESVIEQFEKVNDEFGIQKLKVTYKYPDIFPVLKNAQNPETRMKAFMGDQNKV 302
            EEL+GV   V++QFE++  E G++KLKVT+KYPDI PVL+ A NPETR KA++ DQN+V
Sbjct: 191 EEELEGVSPLVLDQFERI-IEGGVKKLKVTFKYPDIGPVLRTATNPETRRKAYVADQNRV 249

Query: 303 PENEHLFKDTLKLRNELALVLGYDTYANYNLDIKMAKNADTVLSFVNDLIVKLQDPAKKE 362
             NE L  +TL LR  +A + GY  YA YNL  KMAKN +TV+ F+ DL+ +L    +K+
Sbjct: 250 AANEQLLFETLDLRRRMAQLRGYKNYAEYNLRDKMAKNEETVIPFLTDLVERLLPVGEKD 309

Query: 363 LDILKNLKKQEFENEFNMVYDGDYYIWDHRYYDNKYLKENFNVDEEKIAEYYPLESTIDG 422
            +ILK+ K ++++++ N+ +DG+ Y WD+ YY+NK L+E + +D E +A+Y+P+ES I+G
Sbjct: 310 REILKSKKAEDYKSK-NLTFDGEIYAWDNAYYNNKILQEKYQIDPEDMAQYFPIESVIEG 368

Query: 423 MLKIYETLLKLKFVEVKE--NKKTWHDDVKQLAVWKLDTPENPEFVGWIFFDLHPRDGKY 480
           ML  Y+TL +LKFVEV +   K  WH+DVKQ AVW +D  + PEF GWI+FDL+PRDGKY
Sbjct: 369 MLDTYQTLFRLKFVEVTDPSQKNVWHEDVKQFAVWNIDDEDCPEFQGWIYFDLYPRDGKY 428

Query: 481 GHAANFGLSSSYISANGTRSYPITALVCNFSKSTKDKPSLLKHSEITTFFHELGHGIHDL 540
            HAANFG++S++   +G++SYP+T LVCN +K T  + ++L+  EITT FHELGHGIH L
Sbjct: 429 SHAANFGMASAFRKKDGSQSYPVTVLVCNLTKPTPTRTAILRPGEITTLFHELGHGIHHL 488

Query: 541 VGNNRIGRFNGPGAVPWDFVEAPSQMLEFWTWNTKELLSLSQNYKDNAKIDTKLLESLIK 600
           V NN++   N  G+VPWDFVEAPSQMLE+WT     L  LS++Y+   KI   LL++   
Sbjct: 489 VANNKLAAHNSLGSVPWDFVEAPSQMLEYWTGRRDVLTMLSKHYETGEKIPPSLLDAWFN 548

Query: 601 TKHVNGALFALRQLHFGLFDMKVHMMSAEELDKLDIKKLWNDLREKICLISNGDQPTTGY 660
           +  +   L+ L QL  GLFDM VH     E   L+++KLWND+R +I LI++ +  +TGY
Sbjct: 549 SSGLGSGLYYLGQLRLGLFDMYVH---TREYHGLEVRKLWNDMRREISLINSQNYTSTGY 605

Query: 661 NSFGHIMXXXXXXXXXXXMWAEVFATDMYYTKFKADPLNPEVGVKYRDIVLARGGLYEID 720
           N+FGHIM           +W++VFA DMY TKFK++P N  VG +YRD +LA GGLY+++
Sbjct: 606 NTFGHIMTGSYSAGYYGYLWSQVFAADMYQTKFKSNPFNSTVGRQYRDTILAPGGLYDMN 665

Query: 721 DNLEEFLGRKPAKDAFLEELGLH 743
           DNL +FLGR+P   AFL  LG +
Sbjct: 666 DNLRKFLGREPNNRAFLRGLGFN 688

>ABR185W Chr2
           (758126..758380,758380..758709,758709..759029,
           759033..759122,759122..759499) [1374 bp, 457 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YCL057W
           (PRD1); 3-intron; artificial frameshift
          Length = 457

 Score =  351 bits (901), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 188/416 (45%), Positives = 260/416 (62%), Gaps = 10/416 (2%)

Query: 329 ANYNLDIKMAKNADTVLSFVNDLIVKLQDPAKKELDILKNLKKQEFENEFNMVYDGDYYI 388
           A Y L++K AKN D V SF+NDL  KL+  +      LK LK+QE + E    YDG+ Y 
Sbjct: 49  AAYVLEVKTAKNVDNVNSFLNDLREKLKPASADNWRPLKKLKEQECK-ELGNFYDGELYS 107

Query: 389 WDHRYYDNKYLKENFNVDEEKIAEYYPLESTIDGMLKIYETLLKLKFVEVKE--NKKTWH 446
            D  YY+ K L++NF+VDEE+ A+Y+PLE TI  ML  Y TL +  FVE  E   +  WH
Sbjct: 108 QDLCYYEQKLLRDNFSVDEEETAQYFPLEHTIKFMLDTYNTLFRHNFVEETEPATRNVWH 167

Query: 447 DDVKQLAVWKLDTPENPEFVGWIFFDLHPRDGKYGHAANFGLSSSYISANGTRSYPITAL 506
           +D KQ +VWK+D  + P+F GW++FDLHPRDGK+GH A F    + +S  G+R YP+T+L
Sbjct: 168 EDDKQYSVWKMDDWDAPQFTGWLYFDLHPRDGKFGHLACFDNVYTDMSEEGSRVYPVTSL 227

Query: 507 VCNFSKSTKDKPSLLKHSEITTFFHELGHGIHDLVGNNRIGRFNGPGAVPWDFVEAPSQM 566
           VCNFS  +K+KP+LLKH E+  FFHELGHG H L+    +        VP DF+EAPSQM
Sbjct: 228 VCNFSNPSKEKPALLKHYEVQAFFHELGHGSHKLLCAPELC--CSSSWVPRDFIEAPSQM 285

Query: 567 LEFWTWNTKELLSLSQNYKDNAKIDTKLLESLIKTKHVNGALFALRQLHFGLFDMKVHMM 626
           LE+W W    +  LS+ ++   +I   L++ ++K+K  N A+  L Q+   L DM VH  
Sbjct: 286 LEYWIWRKDVITDLSK-HETGERIPESLVDCMVKSKRANAAIDNLIQV-LALLDMAVHKH 343

Query: 627 SAEELDKLDIKKLWNDLREKICLISNGDQPTTGYNSFGHIMXXXXXXXXXXXMWAEVFAT 686
                + LD+  LWN+L E + LI N  +PT  Y SF HI+            W++VFA 
Sbjct: 344 VG-SYETLDLNALWNNLCEDVILIKNP-EPTRAYCSFSHIV-EGYAAGYYGYQWSKVFAA 400

Query: 687 DMYYTKFKADPLNPEVGVKYRDIVLARGGLYEIDDNLEEFLGRKPAKDAFLEELGL 742
           DMY+++F+   L+P +G  Y D ++ARGGLYE++DNL EFL R+P  +A+L + GL
Sbjct: 401 DMYFSRFEKAHLDPTLGKLYGDTIIARGGLYEMEDNLGEFLDREPNNEAYLRDQGL 456

>NDAI0E02010 Chr5 complement(404579..406915) [2337 bp, 778 aa] {ON}
           Anc_1.9 YCL057W
          Length = 778

 Score =  165 bits (417), Expect = 9e-42,   Method: Compositional matrix adjust.
 Identities = 125/471 (26%), Positives = 225/471 (47%), Gaps = 45/471 (9%)

Query: 279 FPVLKNAQNPETRMKAFMGDQNKVPENEHLFKDTLKLRNELALVLGYDTYANYNLDIKMA 338
           F +LK   +PE R K ++   +   +      + +K+R  LA  +G + YA Y +D KMA
Sbjct: 291 FLILKACTDPEIRKKIWVAMHDCSKQQIERLTNLVKIRAFLAHTMGRECYAAYAIDGKMA 350

Query: 339 KNADTVLSFVNDLIVKLQDPAKKEL----DILKNLKKQEFENEFNMV------YDGDYYI 388
           KN   V  F+  L+  L+  A KEL    D++ N K ++  ++ + +      +D +YY 
Sbjct: 351 KNPKDVDEFLKSLMDFLKPKAAKELKFISDLIHNEKGEKPSDDVDEILTAVRPWDREYYT 410

Query: 389 WDHRYYDNKYLKENFNVDEEKIAEYYPLESTIDGMLKIYETLLKLKFVEVKENK-KTWHD 447
             HR      L +++ +D      YYPL + I G+  I+E++  ++F      K +TW  
Sbjct: 411 AIHRNKQKHLLLDDYALD-----VYYPLGNVIQGLSDIFESIYGIRFEPAVAGKGETWSS 465

Query: 448 DVKQLAVWKLDTPENPEFVGWIFFDLHPRDGKYGHAANFGLSSSY--------------- 492
           DV++L V      E    +G I+ DL  R GK  +AA+F +  S                
Sbjct: 466 DVRRLNV----VSEKEGLIGIIYCDLFRRQGKTNNAAHFTICCSRQIYPHEDDFSTIQLG 521

Query: 493 ISANGTR-SYPITALVCNFSK---STKDKPSLLKHSEITTFFHELGHGIHDLVGNNRIGR 548
            + +GT+   PI +L+CNF+    ++ +   LL  +EI T FHE+GH IH ++G  R+  
Sbjct: 522 TNVDGTKFQLPIISLLCNFNTRCLNSGETICLLALNEIETLFHEMGHAIHSMLGRTRLQN 581

Query: 549 FNGPGAVPWDFVEAPSQMLEFWTWNTKELLSLSQNYKDNAKIDTKLLESLIKTKHVNGAL 608
            +G      DFVE PS ++E +  +T+ L  +  +YK   ++   LL   ++        
Sbjct: 582 VSGT-RCSTDFVELPSVLMEHFARDTRVLKRIGHHYKTGDRVPATLLNRYLEKARFLKDC 640

Query: 609 FALRQLHFGLFDMKVHMMS-AEELDKLDIKKLWNDLREKICLISNGDQPTTGYNSFGHIM 667
               Q    + D +++  +  + +D +D+ K++++L +++ ++   D  +     FGH+ 
Sbjct: 641 ETFSQAKMAMLDQRLYDKNIVQNIDSVDVVKIYHELEKELEVLV--DDESNWCAKFGHLF 698

Query: 668 XXXXXXXXXXXMWAEVFATDMYYTKFKADPLNPEVGVKYRDIVLARGGLYE 718
                      ++    A+ ++   F+ DP +   G K+++ VL  GGL E
Sbjct: 699 --GYGATYYCYLFDRAIASKVWKKLFEKDPYSRSGGEKFKNDVLKWGGLRE 747

>Kpol_297.8 s297 complement(11648..14011) [2364 bp, 787 aa] {ON}
           complement(11648..14011) [2364 nt, 788 aa]
          Length = 787

 Score =  163 bits (412), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 137/496 (27%), Positives = 230/496 (46%), Gaps = 41/496 (8%)

Query: 248 GVPESVIEQFEKVNDEFGIQKLKVTYKYPDIFPVLKNAQNPETRMKAFMGDQNKVPENEH 307
           G+   ++ Q EK  D  G      TY Y   F +LK+  + E R K ++   N   E   
Sbjct: 271 GIDPELLSQIEK--DIAGKNYKIPTYGYIP-FALLKSCPSEEIREKIWVAVHNCSNEQIK 327

Query: 308 LFKDTLKLRNELALVLGYDTYANYNLDIKMAKNADTVLSFVNDLIVKLQDPAKKELDILK 367
              D +KLR  L+ +LG  +YA Y L+ KMAKN   V+ F+  L+   +  A KELD + 
Sbjct: 328 RLTDLVKLRAVLSQLLGKKSYAEYQLEGKMAKNPKEVIEFIKTLMDFTKPMAAKELDGIA 387

Query: 368 NLKKQEFENEFNM-VYDGDYYI--WDHRYYD----NKYLKENFNVDEEKIAEYYPLESTI 420
             K     N  N+ V D    +  WD  YY      +   +N    EE + +Y+ L + +
Sbjct: 388 EKKLTIKSNGSNLSVCDILKTVRPWDRDYYSAIEREQTSAKNLYGSEE-VLKYFTLGNVM 446

Query: 421 DGMLKIYETLLKLKF-VEVKENKKTWHDDVKQLAVWKLDTPENPEFVGWIFFDLHPRDGK 479
            G+  +++ +  +K  ++V +  +TW  +V+++ V      E+   +G I+ DL  R GK
Sbjct: 447 QGLSNLFQKIYGIKLELDVPKIGETWSPEVRKINV----ISEDEGLIGIIYCDLFERSGK 502

Query: 480 YGHAANFGLSSS---------------YISANGTR-SYPITALVCNFSK---STKDKPSL 520
             +AA+F +  S                I + GTR   PI +LVCNFSK   S  D    
Sbjct: 503 TSNAAHFTICCSRDISPYETEDSTTQIAIDSKGTRFQLPIISLVCNFSKTMISETDSVCF 562

Query: 521 LKHSEITTFFHELGHGIHDLVGNNRIGRFNGPGAVPWDFVEAPSQMLEFWTWNTKELLSL 580
           L   E+ T FHE+GH +H ++G  ++   +G      DFVE PS ++E++  + + L ++
Sbjct: 563 LHLPEVETLFHEMGHAMHSMLGRTKLQNISGTRCAT-DFVELPSILMEYFARDPRVLETI 621

Query: 581 SQNYKDNAKIDTKLLESLIKTKHVNGALFALRQLHFGLFDMKVHMMS-AEELDKLDIKKL 639
            ++Y     +  ++LE  ++            Q    + D  +H  + +  LD LD+ KL
Sbjct: 622 GKHYLTKETVKREMLEPHLQDLKYLQHCETYSQAKMAMLDQTLHGETISSHLDHLDVVKL 681

Query: 640 WNDLREKICLISNGDQPTTGYNSFGHIMXXXXXXXXXXXMWAEVFATDMYYTKFKADPLN 699
           + DL  ++ ++   D  +     FGH+            ++    A+ ++   F+ +P +
Sbjct: 682 YQDLERQLGVLV--DDKSNWCGKFGHLF--GYSAVYYSYLFDRAIASKIWGALFERNPFS 737

Query: 700 PEVGVKYRDIVLARGG 715
              G KYR+ VL  GG
Sbjct: 738 RASGDKYRNSVLQWGG 753

>Skud_11.93 Chr11 complement(175243..177561) [2319 bp, 772 aa] {ON}
           YKL134C (REAL)
          Length = 772

 Score =  153 bits (387), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 123/487 (25%), Positives = 225/487 (46%), Gaps = 37/487 (7%)

Query: 257 FEKVNDEFGIQKLKV-TYKYPDIFPVLKNAQNPETRMKAFMGDQNKVPENEHLFKDTLKL 315
            +++N +   Q  K+ T+ Y   + +LK+ +  E R K +    +   +        +KL
Sbjct: 263 LKQLNKDVKGQNYKIPTFGYA-AYALLKSCEKEEVRKKLWTALHSCSDKQIKRLSHLIKL 321

Query: 316 RNELALVLGYDTYANYNLDIKMAKNADTVLSFVNDLIVKLQDPAKKELDILKNLKKQEFE 375
           R  LA ++  ++YA Y L+ KMAKN   V  F+  L+    D    EL  +  LK ++ +
Sbjct: 322 RAILANLMNKESYAEYQLEGKMAKNPKDVQDFILTLMNGTIDKTANELKFIAELKTKDLK 381

Query: 376 NEFNMVYDGDYYI---WDHRYYDNKYLKENFN--VDEEKIAEYYPLESTIDGMLKIYETL 430
                  D    +   WD  YY  KYL+ N +   + ++I+ Y+ L + I+G+  +++ +
Sbjct: 382 KPLATKTDDILRLVRPWDRDYYTGKYLQLNPSDAPNAKEISYYFTLGNVIEGLSDLFQHI 441

Query: 431 LKLKF-VEVKENKKTWHDDVKQLAVWKLDTPENPEFVGWIFFDLHPRDGKYGHAANFGLS 489
             ++   E+ +  +TW  DV++L V      E    +G I+ DL  R+GK  + A+F + 
Sbjct: 442 YGIRLEPEIADEGETWSPDVRRLNV----ISEEEGIIGIIYCDLFERNGKTSNPAHFTVC 497

Query: 490 SS-------------YISANGTRSY---PITALVCNFSK---STKDKPSLLKHSEITTFF 530
            S              +  N   SY   P+ +LVCNF+    ++K     L+ SE+ T F
Sbjct: 498 CSRQIYPNETDFSTIQVGENPDGSYFQLPVISLVCNFAPIPIASKKTLCFLQLSEVETLF 557

Query: 531 HELGHGIHDLVGNNRIGRFNGPGAVPWDFVEAPSQMLEFWTWNTKELLSLSQNYKDNAKI 590
           HE+GH +H ++G   +   +G      DFVE PS ++E +  + + L  +S++Y+    I
Sbjct: 558 HEMGHAMHSMLGRTHMQNISGTRCAT-DFVELPSILMEHFAKDIRILTKISKHYETGETI 616

Query: 591 DTKLLESLIKTKHVNGALFALRQLHFGLFDMKVHMMS-AEELDKLDIKKLWNDLREKICL 649
              +L+S ++T +         Q    + D   H      ++D  DI K +  L  ++ +
Sbjct: 617 QAGMLQSFMRTTNFLQNCETYSQAKMAMLDQSFHDEEIISDIDNFDIVKNYQALERRLKV 676

Query: 650 ISNGDQPTTGYNSFGHIMXXXXXXXXXXXMWAEVFATDMYYTKFKADPLNPEVGVKYRDI 709
           +   D  +     FGH+            ++    A+ ++Y  F+ DP + + G K++  
Sbjct: 677 LV--DDQSNWCGRFGHLF--GYGATYYSYLFDRTIASKIWYALFEDDPYSRKNGDKFKKH 732

Query: 710 VLARGGL 716
           +L  GGL
Sbjct: 733 LLKWGGL 739

>TBLA0I00710 Chr9 (128272..130593) [2322 bp, 773 aa] {ON} Anc_2.432
           YKL134C
          Length = 773

 Score =  153 bits (386), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 122/466 (26%), Positives = 218/466 (46%), Gaps = 44/466 (9%)

Query: 279 FPVLKNAQNPETRMK---AFMGDQNKVPENEHLFKDTLKLRNELALVLGYDTYANYNLDI 335
           +  L   ++ E R K   AF    NK  E        +K R ELA +L   +Y+ Y L+ 
Sbjct: 289 YTALLKCKDEELRKKLWVAFHSCSNKQIER---LTKIIKHRIELAKLLSKSSYSEYTLEG 345

Query: 336 KMAKNADTVLSFVNDLIVKLQDPAKKELDILKNLKKQEFENEFNMVYDGDYYI-----WD 390
           KMAK    V +F+N L+  +     KEL+ + N  K+     F++       +     WD
Sbjct: 346 KMAKGPKEVNNFLNALLKSILPEVTKELEPISN--KKCLSEGFSLETSEQSILNNIKPWD 403

Query: 391 HRYYDNKYLKENFNVDEEKIAEYYPLESTIDGMLKIYETLLKLKFVEVK-ENKKTWHDDV 449
             YY N     +    +  I EY+ L + I G+  ++ ++  ++F   K E+ +TW  DV
Sbjct: 404 RDYY-NPIQATSEGAYQMLIMEYFTLGNIIHGLSNLFNSIYGIRFEPGKIEDGETWSKDV 462

Query: 450 KQLAVWKLDTPENPEFVGWIFFDLHPRDGKYGHAANFGLSSSY---------------IS 494
           ++L V      E+   +G I+ DL  R+GK    +++ +  S                ++
Sbjct: 463 RKLNV----ISEDEGLIGVIYCDLFEREGKSESPSHYTICCSREIYSEEHDLSTIQTGVN 518

Query: 495 ANGTRSY--PITALVCNFSKSTKDKP---SLLKHSEITTFFHELGHGIHDLVGNNRIGRF 549
               +++  PI +LVCNF  +   +      L+H EI T FHE+GH +H ++G  R    
Sbjct: 519 NKTGKNFQLPIVSLVCNFQVTNAKESRRICFLQHHEIETLFHEMGHAMHSMLGRTRFQTI 578

Query: 550 NGPGAVPWDFVEAPSQMLEFWTWNTKELLSLSQNYKDNAKIDTKLLESLIKTKHVNGALF 609
           +G   V  DFVE PS ++EF+  N K L+ +S++Y     ID ++L   ++      A  
Sbjct: 579 SGTRCVS-DFVEIPSILMEFFANNPKVLIDISRHYDSGESIDIEVLNKYLENTKQFKACE 637

Query: 610 ALRQLHFGLFDMKVHMMSAEELDKLDIKKLWNDLREKICLISNGDQPTTGYNSFGHIMXX 669
              Q    L D ++H  +A  LD +D+ +++++L +++ ++ + +    G   FGH+   
Sbjct: 638 TYSQGKMALLDQRLHAENANSLDNIDVVEIYHNLEKELSVLPDTESNWCG--RFGHLY-- 693

Query: 670 XXXXXXXXXMWAEVFATDMYYTKFKADPLNPEVGVKYRDIVLARGG 715
                    ++    AT ++ + F+ DP + + G  +++ +L  GG
Sbjct: 694 GYGALYYCYLFDRAIATKIWESLFQNDPFSRKGGNIFKEQLLKWGG 739

>ZYRO0G20130g Chr7 (1666665..1669025) [2361 bp, 786 aa] {ON} similar
           to uniprot|P35999 Saccharomyces cerevisiae YKL134C OCT1
           Mitochondrial intermediate peptidase cleaves N-terminal
           residues of a subset of proteins upon import after their
           cleavage by mitochondrial processing peptidase
           (Mas1p-Mas2p) may contribute to mitochondrial iron
           homeostasis
          Length = 786

 Score =  150 bits (380), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 121/476 (25%), Positives = 220/476 (46%), Gaps = 43/476 (9%)

Query: 273 YKYPD----IFPVLKNAQNPETRMKAFMGDQNKVPENEHLFKDTL-KLRNELALVLGYDT 327
           YK P      + VL+   +   R K +    +  P+ + +  D L +LR  LA ++G  +
Sbjct: 287 YKIPTHGYIAYSVLRACPDEIVRKKLWTA-MHSCPDKQIVRLDQLVRLRAVLAFLMGKKS 345

Query: 328 YANYNLDIKMAKNADTVLSFVNDLIVKLQDPAKKELDILKNLKKQEFENEFNMVYDGD-- 385
           YA Y L+ KMAK+ + V  F++ LI   Q  AK+EL  + +LK++  +   +   + D  
Sbjct: 346 YAEYQLEGKMAKSPEEVTDFIDSLIKVTQPKAKQELGFISDLKRKHMDLPPSETSNLDTL 405

Query: 386 --YYIWDHRYYDNKY---LKENFNVDEEKIAEYYPLESTIDGMLKIYETLLKLKFVEVKE 440
                WD  +Y   Y    +    +D+++I+ Y+ L + + G+  ++  +  ++   V  
Sbjct: 406 DIVRPWDRDFYHTIYSIQQRRQSPIDDQQISMYFTLGNVMQGLSDLFHQIYGIRLEPVIA 465

Query: 441 NK-KTWHDDVKQLAVWKLDTPENPEFVGWIFFDLHPRDGKYGHAANFG------------ 487
            K +TW  +V++L V      +    +G ++ DL  RDGK  + ++F             
Sbjct: 466 QKGETWSPEVRRLNV----VSDEEGVIGVVYCDLFERDGKTSNPSHFTVCCSRQIYPKEN 521

Query: 488 -LSSSYISAN--GTR-SYPITALVCNFSKST---KDKPSLLKHSEITTFFHELGHGIHDL 540
            LS+  I  N  GT+   PI +LVCNF+ S         LL  SEI T FHE+GH +H +
Sbjct: 522 DLSTIQIGTNKDGTKFQLPIISLVCNFASSVVSFGQSLCLLHISEIETLFHEMGHAMHSM 581

Query: 541 VGNNRIGRFNGPGAVPWDFVEAPSQMLEFWTWNTKELLSLSQNYKDNAKIDTKLLESLIK 600
           +G  R+   +G      DFVE PS ++E +  +T+ L  + ++      +   LL + ++
Sbjct: 582 LGRTRLQNLSGTRCAT-DFVELPSILMEHFARDTRVLRQIGKHCNTGEPVPESLLTNYLQ 640

Query: 601 TKHVNGALFALRQLHFGLFDMKVHMMS-AEELDKLDIKKLWNDLREKICLISNGDQPTTG 659
                       Q    + D ++H       +D LD+  L+ +L  ++ ++   D  +T 
Sbjct: 641 DLQYMQYCETFSQAKMAMLDQRLHGKEIITGMDTLDVVALYQNLERELRVLV--DDQSTW 698

Query: 660 YNSFGHIMXXXXXXXXXXXMWAEVFATDMYYTKFKADPLNPEVGVKYRDIVLARGG 715
              FGH+            ++    A+ ++ + F+ DP +   G ++++ VL  GG
Sbjct: 699 CGRFGHLF--GYGATYYSYLFDRAIASKVWESLFQEDPFSRAGGQRFKEYVLKWGG 752

>Kwal_26.7616 s26 (444266..446578) [2313 bp, 770 aa] {ON} YKL134C
           (OCT1) - 1:1 [contig 55] FULL
          Length = 770

 Score =  150 bits (379), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 129/525 (24%), Positives = 237/525 (45%), Gaps = 44/525 (8%)

Query: 235 QKEYILFTAEEL--KGVPESVIEQFEKVNDEFGIQKLKV-TYKYPDIFPVLKNAQNPETR 291
           + +Y+    +EL   GV   ++ Q  +   +   Q  KV  Y Y   F +L++  N   R
Sbjct: 242 RSDYVKIPCKELDSSGVSTLLLNQLSR---DLKNQNYKVPAYGYA-AFSILRSCPNENVR 297

Query: 292 MKAFMGDQNKVPENE-HLFKDTLKLRNELALVLGYDTYANYNLDIKMAKNADTVLSFVND 350
           MK +    +  PE +    K  + LR  LA ++G  +YA Y L  KMAK+   V  FV  
Sbjct: 298 MKIWTA-MHSCPEKQISRLKQLVMLRGLLASIMGKKSYAEYQLSGKMAKSPVYVRGFVQS 356

Query: 351 LIVKLQDPAKKELDILKNLKKQEFENEFNMVYDGDYYI----WDHRYYD--NKYLKENFN 404
           L+   +  A +EL +L  LK            D D       WD  +Y   N   ++   
Sbjct: 357 LVDVTKPLAAEELRVLAKLKSGHLGVNVPQ-SDADVLRFVRPWDRDFYSTLNALQQQRKT 415

Query: 405 VDEEKIAEYYPLESTIDGMLKIYETLLKLKFVE-VKENKKTWHDDVKQLAVWKLDTPENP 463
           ++ E I+ Y+ L + + G+ +++E +  ++    V +  +TW  +V+++ V      E  
Sbjct: 416 LENEHISSYFSLGTVMQGLSRLFEDIYGIRLEPVVAKAGETWSPEVRRINV----VSEKE 471

Query: 464 EFVGWIFFDLHPRDGKYGHAANFGLSSSYISANGTR----------------SYPITALV 507
             +G ++ DL  R GK  + A+F +  S     G                    P+ +LV
Sbjct: 472 GIIGVVYCDLFERQGKTSNPAHFTVCCSRTIYPGETDLSTIQVGQLPSGEKFQLPVISLV 531

Query: 508 CNFSKSTKDKP--SLLKHSEITTFFHELGHGIHDLVGNNRIGRFNGPGAVPWDFVEAPSQ 565
           C+F++++  +    LL+ S++ T FHE+GH +H ++G   +   +G      DFVE PS 
Sbjct: 532 CSFAQNSASRQGVCLLQLSDVDTLFHEMGHAMHSMLGRTSLQNISGTRCAT-DFVELPSI 590

Query: 566 MLEFWTWNTKELLSLSQNYKDNAKIDTKLLESLIKTKHVNGALFALRQLHFGLFDMKVHM 625
           ++E +  +++ L  + ++Y  +  I T+LL+      +         Q    + D ++H 
Sbjct: 591 LMEHFARDSRVLSRIGRHYATDQPIPTELLKLNQTEMNYLQHTETFSQAKMAMLDQELHS 650

Query: 626 MSAEELDKLDIKKLWNDLREKICLISNGDQPTTGYNSFGHIMXXXXXXXXXXXMWAEVFA 685
             A    KLD+ KL++ + + + +++  D  +     FGH++           ++    A
Sbjct: 651 SKALTDGKLDVVKLYHGVEKDMEVLA--DDQSNWCGRFGHLL--GYGASYYSYLFDRAIA 706

Query: 686 TDMYYTKFKADPLNPEVGVKYRDIVLARGGLYEIDDNLEEFLGRK 730
           + ++   F  DP N E G K+++ VL  GG  +  + + + L RK
Sbjct: 707 SKIWQHLFAEDPFNRENGEKFKESVLKWGGSKDPWECVADALDRK 751

>KAFR0D02950 Chr4 complement(581305..583638) [2334 bp, 777 aa] {ON}
           Anc_2.432 YKL134C
          Length = 777

 Score =  148 bits (373), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 125/468 (26%), Positives = 215/468 (45%), Gaps = 38/468 (8%)

Query: 276 PDIFPVLKNAQNPETRMKAFMGDQNKVPENEHLFKDTLKLRNELALVLGYDTYANYNLDI 335
           P  + VLK+ +N E R   +    +   E        +KLR  LA ++G ++++ Y L  
Sbjct: 286 PTPYAVLKDCKNEEVRADIWTALHSCSSEQILRLSHLVKLRAMLANLMGAESFSQYQLKG 345

Query: 336 KMAKNADTVLSFVNDLIVKLQDPAKKELDILKNLKKQEFENEFNMV-YDGDYYI---WDH 391
           K+AK    V +F+  LI  ++   +KEL  + +LK+++ + + N    DG       WD 
Sbjct: 346 KLAKAPKDVKNFIETLIKYVRPNTEKELKFIADLKRED-QGKINCGEMDGVLSTVRPWDR 404

Query: 392 RYYDNKYLKENFNVDE---EKIAEYYPLESTIDGMLKIYETLLKLKF-VEVKENKKTWHD 447
            YY + Y K     +    E ++ Y+ L    +G+  +   +  +K    +  + +TW +
Sbjct: 405 DYYSSIYFKGKEKTEHEFTEPLSSYFTLGGVFEGLSDLLTQIYGIKLEPAIPVSGETWFN 464

Query: 448 DVKQLAVWKLDTPENPEFVGWIFFDLHPRDGKYGHAANFGLSSS---YISAN-------G 497
           DV+++ V      E    +G I+FDL  R GK  + A+F +  S   Y   N       G
Sbjct: 465 DVRKINV----ISEEEGIIGIIYFDLFERYGKTSNPAHFTVCCSREMYPEENADSIIQLG 520

Query: 498 TR------SYPITALVCNFSKST--KDKP-SLLKHSEITTFFHELGHGIHDLVGNNRIGR 548
           ++        PI +LVCNFS+ T   DK   LL  SEI T FHE+GH IH ++G   +  
Sbjct: 521 SKKDGTIFQLPIISLVCNFSRRTFQSDKTICLLTLSEIETLFHEMGHAIHSMLGRTTLQN 580

Query: 549 FNGPGAVPWDFVEAPSQMLEFWTWNTKELLSLSQNYKDNAKIDTKLLESLIKTKHVNGAL 608
            +G      DFVE PS ++E +  +T+ L  +S +Y+   KI  K L+  +K      + 
Sbjct: 581 VSGTRCAT-DFVELPSILMEHFASDTRVLKKMSCHYETGEKIAEKKLQFHLKEGEFLRSC 639

Query: 609 FALRQLHFGLFDMKVHM-MSAEELDKLDIKKLWNDLREKICLISNGDQPTTGYNSFGHIM 667
               Q    + D ++H       LD L++ +++ +L  ++ ++   D  +     FGH+ 
Sbjct: 640 ETFSQAKMAMLDQELHSDKIIHNLDNLNVVEIYQNLERRLQVLV--DDRSNWCGKFGHLF 697

Query: 668 XXXXXXXXXXXMWAEVFATDMYYTKFKADPLNPEVGVKYRDIVLARGG 715
                      ++    A  ++   F  DP N   G K+++ +L  GG
Sbjct: 698 --GYGATYYSYLFDRAIARKVWNHLFANDPFNKTNGEKFKESLLKWGG 743

>SAKL0E03938g Chr5 (317017..319320) [2304 bp, 767 aa] {ON} similar
           to uniprot|P35999 Saccharomyces cerevisiae YKL134C OCT1
           Mitochondrial intermediate peptidase cleaves N-terminal
           residues of a subset of proteins upon import after their
           cleavage by mitochondrial processing peptidase
           (Mas1p-Mas2p) may contribute to mitochondrial iron
           homeostasis
          Length = 767

 Score =  147 bits (371), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 130/509 (25%), Positives = 232/509 (45%), Gaps = 46/509 (9%)

Query: 238 YILFTAEEL--KGVPESVIEQFEKVNDEFGIQKLKVTYKYPDIFPVLKNAQNPETRMKAF 295
           YI    EEL   G+ + V+ Q  K  D  G      T+ Y   + +L++  +   RMK +
Sbjct: 240 YIKVEVEELNKSGINKIVLNQLSK--DIKGRHYKIPTFGYIP-YSILRSCPDDNIRMKVW 296

Query: 296 MGDQNKVPENEHLFKDTLKLRNELALVLGYDTYANYNLDIKMAKNADTVLSFVNDLIVKL 355
               +   +        +KLR+ LA ++G  ++A+Y L+ KMAK  + V  F+  LI   
Sbjct: 297 SALHSCSEKQIARLDQLIKLRSVLANIMGKKSFAHYQLEGKMAKTPEYVRGFMQSLIDAT 356

Query: 356 QDPAKKELDILKNLKKQEFENEFNMVYDGDYYI------WDHRYYDNKY-LKENFNVDEE 408
           +  A +EL  + +LK +      N   +  + I      WD  +Y + + L++    + E
Sbjct: 357 KPKAAEELKFIADLKAKHVPG--NKPAESMHEILEMVKPWDRDFYGSVHALQQRRPFNNE 414

Query: 409 KIAEYYPLESTIDGMLKIYETLLKLKFVE--VKENKKTWHDDVKQLAVWKLDTPENPEFV 466
           +I+ Y+ L   I G+  +++ +  + ++E  V +  +TW  +V+++ V      E    +
Sbjct: 415 QISSYFSLGVVIQGLSNLFKQIYGI-YLEPVVPKTGETWSPEVRRINV----VSEKEGVI 469

Query: 467 GWIFFDLHPRDGKYGHAANFGLSSSYISANGTR----------------SYPITALVCNF 510
           G ++ DL  R GK  + A+F +  S    +G                    P+ +LVCNF
Sbjct: 470 GVVYCDLFERQGKTANPAHFTVCCSRQIYDGETDLSTIQVGQNSKGEQFQLPVISLVCNF 529

Query: 511 SKST---KDKPSLLKHSEITTFFHELGHGIHDLVGNNRIGRFNGPGAVPWDFVEAPSQML 567
           S +T   +    LL+ SEI T FHE+GH +H ++G  ++   +G      DFVE PS ++
Sbjct: 530 SPTTISQEQSICLLQLSEIETLFHEMGHAMHSMLGRTKLQNISGTRCAT-DFVELPSILM 588

Query: 568 EFWTWNTKELLSLSQNYKDNAKIDTKLLESLIKTKHVNGALFALRQLHFGLFDMKVHMMS 627
           E +  + + L  ++ +Y     I  +LL S            A  Q    + D ++H  S
Sbjct: 589 EHFARDHRVLQRMASHYSTGESIPEQLLFSYQSEVKFLQHAEAFSQAKMAILDQELHGES 648

Query: 628 -AEELDKLDIKKLWNDLREKICLISNGDQPTTGYNSFGHIMXXXXXXXXXXXMWAEVFAT 686
             +E+  LDI KL+++L  ++ ++S  D  +     FGH+            ++    A+
Sbjct: 649 IMKEMQYLDIVKLYHNLERQLEVLS--DDKSNWCGRFGHLF--GYGATYYSYLFDRAIAS 704

Query: 687 DMYYTKFKADPLNPEVGVKYRDIVLARGG 715
            ++   F  DP     G K+++ VL  GG
Sbjct: 705 KIWQHLFANDPFCRRSGEKFKNSVLKWGG 733

>Suva_11.91 Chr11 complement(175327..177654) [2328 bp, 775 aa] {ON}
           YKL134C (REAL)
          Length = 775

 Score =  146 bits (368), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 121/487 (24%), Positives = 218/487 (44%), Gaps = 37/487 (7%)

Query: 257 FEKVNDEFGIQKLKV-TYKYPDIFPVLKNAQNPETRMKAFMGDQNKVPENEHLFKDTLKL 315
            +++N +   Q  KV T+ Y   + +LK+ +  + R K +    +   +        +KL
Sbjct: 266 LKQLNKDVKGQNYKVPTFGYA-AYALLKSCEKEQVRKKIWTALHSCSDKQIKRLNHLIKL 324

Query: 316 RNELALVLGYDTYANYNLDIKMAKNADTVLSFVNDLIVKLQDPAKKELDILKNLKKQEFE 375
           R  LA ++   +YA Y L+ KMAKN   V  F+  L+    D    EL  +  LK ++ +
Sbjct: 325 RANLADLMHKGSYAEYQLEGKMAKNPKDVQDFILTLMNDTIDKTATELKFIAELKAKDLK 384

Query: 376 NEFNMVYDGDYYI---WDHRYYDNKYLKEN-FNVDEEK-IAEYYPLESTIDGMLKIYETL 430
                  D    +   WD  YY  KYL+ N  N    K I+ Y+ L + I G+  +++ +
Sbjct: 385 KPLATKTDEILKLVRPWDRDYYTGKYLQLNPSNAPSAKEISSYFTLGNVIQGLSDLFQHI 444

Query: 431 LKLKF-VEVKENKKTWHDDVKQLAVWKLDTPENPEFVGWIFFDLHPRDGKYGHAANFGLS 489
             +K    + +  +TW  DV++L V      E    +G I+ DL  R GK  + A+F + 
Sbjct: 445 YGIKLEPAIADEGETWSPDVRRLNV----ISEEEGIIGIIYCDLFERSGKTSNPAHFTVC 500

Query: 490 SS-------------YISANGTRSY---PITALVCNFSK---STKDKPSLLKHSEITTFF 530
            S              +  N   S+   P+ +LVCNF+    ++K     L+ SE+ T F
Sbjct: 501 CSRQIYPNETDFSTIQLGENADGSFFQLPVISLVCNFAPIPIASKKSLCFLQLSEVETLF 560

Query: 531 HELGHGIHDLVGNNRIGRFNGPGAVPWDFVEAPSQMLEFWTWNTKELLSLSQNYKDNAKI 590
           HE+GH +H ++G   +   +G      DFVE PS ++E +  + + L  + ++Y+    +
Sbjct: 561 HEMGHAMHSMLGRTHMQNISGTRCAT-DFVELPSILMEHFAKDIRILTRIGKHYETGETV 619

Query: 591 DTKLLESLIKTKHVNGALFALRQLHFGLFDMKVHMMSA-EELDKLDIKKLWNDLREKICL 649
           +  +L+S ++T +         Q    + D   H       +D  D+ K +  L  ++ +
Sbjct: 620 EPDMLQSFMRTTNFLQNCETYSQAKMAMLDQSFHDEEVISNIDNYDVVKNYQALERRLKV 679

Query: 650 ISNGDQPTTGYNSFGHIMXXXXXXXXXXXMWAEVFATDMYYTKFKADPLNPEVGVKYRDI 709
           +   D  +     FGH+            ++    A+ ++Y  F+ DP + + G K++  
Sbjct: 680 LV--DDQSNWCGRFGHLF--GYGATYYSYLFDRTIASKIWYALFEDDPYSRKNGDKFKKH 735

Query: 710 VLARGGL 716
           +L  GGL
Sbjct: 736 LLKWGGL 742

>TPHA0G02390 Chr7 complement(486025..488412) [2388 bp, 795 aa] {ON}
           Anc_2.432 YKL134C
          Length = 795

 Score =  146 bits (368), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 127/473 (26%), Positives = 218/473 (46%), Gaps = 40/473 (8%)

Query: 273 YKYPDIFPV----LKNAQNPETRMKAFMGDQNKVPENEHLFKDTLKLRNELALVLGYDTY 328
           YK P   P+    L N  N   R K +    +   E     K  + LR +LA +L   ++
Sbjct: 296 YKIPTTGPIPYSILTNCSNETIRKKIWTELHSCSQEQIERLKKMVTLRYKLAKLLKKKSF 355

Query: 329 ANYNLDIKMAKNADTVLSFVNDLIVKLQDPAKKELDILKNLKKQE----FENEFNMVYDG 384
           A Y L  KMAKN + V  F++ L+   +  A KEL  L  +K  +    F+N+ N + + 
Sbjct: 356 AEYQLQGKMAKNPEEVKKFISTLLDFTKPLAIKELTSLAEVKAADLGLAFKNDSNFIVNL 415

Query: 385 DYYIWDHRYYD--NKYLKENFNVDEEKIAEYYPLESTIDGMLKIYETLLKLKF-VEVKEN 441
               WD  YY   N+Y  +    D  ++  Y+ L + I G+  ++  +  ++F + V + 
Sbjct: 416 -IRPWDRNYYSKINRYENKQTMEDLNELPYYFSLGNVIAGLSNLFHNIYGIRFELAVPKL 474

Query: 442 KKTWHDDVKQLAVWKLDTPENPEFVGWIFFDLHPRDGKYGHAANFGLSSSYISANGTR-- 499
           ++TW  +V++L V      E+   +G ++ DL  R  K  +AA+F +  S     G    
Sbjct: 475 EETWLPEVRKLNV----ISESEGLIGIVYCDLFERPSKKTNAAHFTICCSREIGKGEDIS 530

Query: 500 -------------SYPITALVCNFSKS---TKDKPSLLKHSEITTFFHELGHGIHDLVGN 543
                          PI +L+CNFSKS    ++ P  L+  EI T FHE+GH +H ++G 
Sbjct: 531 TMQVGMNSKGNMFQLPIISLICNFSKSHLFEENGPCFLQLHEIETLFHEMGHAMHSVLGR 590

Query: 544 NRIGRFNGPGAVPWDFVEAPSQMLEFWTWNTKELLSLSQNYKDNAKIDTKLLESLIKTKH 603
            R+   +G      DFVE PS ++E +  + + + S+S +Y        +LL++ + +  
Sbjct: 591 TRLQNTSGTRCAT-DFVELPSILMEHFAKDVRVMESISSHYISQEPASPELLQTWLHSTD 649

Query: 604 VNGALFALRQLHFGLFDMKVHMMSA-EELDKLDIKKLWNDLREKICLISNGDQPTTGYNS 662
               L    Q    + D  +H     E+   +++ K +NDL +K+ L S+      G   
Sbjct: 650 NLQNLELYTQAKMSMLDQILHSNEIFEDQKDINVVKSYNDLEKKLELFSDDQSNWCG--K 707

Query: 663 FGHIMXXXXXXXXXXXMWAEVFATDMYYTKFKADPLNPEVGVKYRDIVLARGG 715
           FGH+            ++    A+ ++ + FK +P +   G+K++D VL  GG
Sbjct: 708 FGHLF--GYGASYYSYLFDRAIASKVWESLFKQNPFSRTSGLKFKDSVLRWGG 758

>Smik_11.102 Chr11 complement(175013..177331) [2319 bp, 772 aa] {ON}
           YKL134C (REAL)
          Length = 772

 Score =  145 bits (367), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 132/513 (25%), Positives = 228/513 (44%), Gaps = 45/513 (8%)

Query: 257 FEKVNDEFGIQKLKV-TYKYPDIFPVLKNAQNPETRMKAFMGDQNKVPENEHLFKDTLKL 315
            +++N +   Q  KV T+ Y   F +LK+ +    R K +    +   +        +KL
Sbjct: 263 LKQLNKDVKGQNYKVPTFGYA-AFALLKSCEIEVVRKKIWTALHSCSDKQIKRLDRLIKL 321

Query: 316 RNELALVLGYDTYANYNLDIKMAKNADTVLSFVNDLIVKLQDPAKKELDILKNLKKQEFE 375
           R  LA ++   +YA Y L+ KMAKN   V  F+  L+    D    EL  + +LK ++ +
Sbjct: 322 RAVLANLMHKGSYAEYQLEGKMAKNPKDVQDFILTLMNNTIDKTANELKFIADLKAKDLK 381

Query: 376 NEFNMVYDGDYYI---WDHRYYDNKYLKEN-FNVDEEK-IAEYYPLESTIDGMLKIYETL 430
                  D    +   WD  YY  KY++ N  NV   K I+ Y+ L + I G+  +++ +
Sbjct: 382 KPLTTNTDEILKLVRPWDRDYYTGKYIQLNPSNVPSAKEISYYFTLGNVIQGLSDLFQQI 441

Query: 431 LKLKF-VEVKENKKTWHDDVKQLAVWKLDTPENPEFVGWIFFDLHPRDGKYGHAANFGLS 489
             ++    + +  +TW  DV++L V      E    +G I+ DL  R+GK  + A+F + 
Sbjct: 442 YGIRLEPAIADEGETWSPDVRRLNV----ISEEEGIIGIIYCDLFERNGKTSNPAHFTVC 497

Query: 490 SS-------------YISANGTRSY---PITALVCNFSK---STKDKPSLLKHSEITTFF 530
            S              +  N   SY   P+ +LVCNFS    ++K     L+ SE+ T F
Sbjct: 498 CSRQIYPHETDFSTIQVGENPNGSYFQLPVISLVCNFSPVPIASKKSLCFLQLSEVETLF 557

Query: 531 HELGHGIHDLVGNNRIGRFNGPGAVPWDFVEAPSQMLEFWTWNTKELLSLSQNYKDNAKI 590
           HE+GH +H ++G   +   +G      DFVE PS ++E +  + + L  + ++Y+    I
Sbjct: 558 HEMGHAMHSMLGRTHMQNISGTRCAT-DFVELPSILMEHFAKDIRVLTRIGKHYETGETI 616

Query: 591 DTKLLESLIKTKHVNGALFALRQLHFGLFDMKVH---MMSAEELDKLDIKKLWNDLREKI 647
              +L+  +KT +         Q    + D   H   +MS  ++D  ++   +  L   +
Sbjct: 617 QKGMLQCFMKTTNFLQNCETYSQAKMAMLDQSFHDEKIMS--DIDNFNVVDNYQALERHL 674

Query: 648 CLISNGDQPTTGYNSFGHIMXXXXXXXXXXXMWAEVFATDMYYTKFKADPLNPEVGVKYR 707
            ++   D  +     FGH+            ++    A+ ++YT F  DP +   G K++
Sbjct: 675 KVLV--DDQSNWCGRFGHLF--GYGATYYSYLFDRTIASKIWYTLFDDDPYSRNNGDKFK 730

Query: 708 DIVLARGGLYE----IDDNLEEFLGRKPAKDAF 736
             +L  GGL +    I D LE  +  K   DA 
Sbjct: 731 KHLLKWGGLKDPWKCIADVLECPMLEKGGSDAM 763

>CAGL0D02112g Chr4 complement(216204..218489) [2286 bp, 761 aa] {ON}
           similar to uniprot|P35999 Saccharomyces cerevisiae
           YKL134c MIP1
          Length = 761

 Score =  144 bits (363), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 114/465 (24%), Positives = 214/465 (46%), Gaps = 42/465 (9%)

Query: 281 VLKNAQNPETRMKAFMGDQNKVPENEHLFKDTLKLRNELALVLGYDTYANYNLDIKMAKN 340
           +LK+  + + R + +    N            ++LR  L+ +LG  +Y++Y LD KMA +
Sbjct: 277 ILKSCPDEDIRKEVWAALHNCPKAQIQRLNQLVRLRVILSNLLGKQSYSDYQLDNKMAGS 336

Query: 341 ADTVLSFVNDLIVKLQDPAKKELDILKNLK------KQEFENEFNMVYDGDYYIWDHRYY 394
            + V  F+  L+   +  A +EL+ +   K      +   +NE   +       WD  Y+
Sbjct: 337 PENVKGFIKTLMNVTKPLAARELEFIARDKLNAPDSRHMSDNEILSIVKP----WDKNYF 392

Query: 395 DNKYLKEN--FNVDEEKIAEYYPLESTIDGMLKIYETLLKLKFVEVK-ENKKTWHDDVKQ 451
            +KY  +N    + +E++  Y+ L + I+G+ ++++ +  +     + EN +TW  DV++
Sbjct: 393 SSKYDSDNEMAMIRDEQLRYYFSLGNVINGLSELFKRIYGITLQPSRTENGETWSPDVRR 452

Query: 452 LAVWKLDTPENPEFVGWIFFDLHPRDGKYGHAANFGLSSSY---------------ISAN 496
           L V      E    VG I+ DL  R GK  + A+F +  S                 +++
Sbjct: 453 LDV----ISEEEGLVGVIYCDLFERVGKISNPAHFTVCCSRQVYPDENDFTTIQTGQNSD 508

Query: 497 GTR-SYPITALVCNFSKST---KDKPSLLKHSEITTFFHELGHGIHDLVGNNRIGRFNGP 552
           GT    P+ +LVCNFS       ++   L  +EI T FHE+GH +H ++G  R+   +G 
Sbjct: 509 GTVFQLPVISLVCNFSTVALPNGNRTCFLHMNEIETLFHEMGHAMHSMLGRTRLQNISGT 568

Query: 553 GAVPWDFVEAPSQMLEFWTWNTKELLSLSQNYKDNAKIDTKLLESLIKTKHVNGALFALR 612
                DFVE PS ++E +  + + L ++  +Y+ +      LL   +             
Sbjct: 569 RCAT-DFVELPSILMEHFARDIRVLRTIGSHYETSEPAPEALLNDYLDKTQFLQHCETYS 627

Query: 613 QLHFGLFDMKVH-MMSAEELDKLDIKKLWNDLREKICLISNGDQPTTGYNSFGHIMXXXX 671
           Q    + D K+H   S  +++++D  K++  L  ++ ++++ +    G   FGH+     
Sbjct: 628 QAKMAMLDQKLHGSFSLSDIERIDSAKIYQKLETRLQVLADDESNWCG--RFGHLF--GY 683

Query: 672 XXXXXXXMWAEVFATDMYYTKFKADPLNPEVGVKYRDIVLARGGL 716
                  ++    A+ ++ + FK DP N   G K+++ VL  GGL
Sbjct: 684 GATYYSYLFDRAIASKVWDSLFKDDPFNRTGGEKFKERVLKWGGL 728

>TDEL0A02080 Chr1 complement(373425..375788) [2364 bp, 787 aa] {ON}
           Anc_2.432 YKL134C
          Length = 787

 Score =  144 bits (362), Expect = 7e-35,   Method: Compositional matrix adjust.
 Identities = 119/501 (23%), Positives = 224/501 (44%), Gaps = 61/501 (12%)

Query: 262 DEFGIQKLKVT----------YKYPD----IFPVLKNAQNPETRMKAFMGDQNKVPENEH 307
           D  GI KL ++          YK P      + +L++  + E RM  +        +  +
Sbjct: 267 DNSGINKLLISQLPKDVRGKYYKIPTHGYIAYSILRSCPDEEIRMNLWTAMHRCSDKQIN 326

Query: 308 LFKDTLKLRNELALVLGYDTYANYNLDIKMAKNADTVLSFVNDLIVKLQDPAKKELDILK 367
                L+LR  LA ++G +++A Y L+ KMA+    V  F+  L+  ++    +EL  + 
Sbjct: 327 RLDQLLRLRAILAKLMGKESFAQYQLEGKMAQTPQQVRDFIGTLVNYMRPKTIEELKFIY 386

Query: 368 NLKKQEFENEF----------NMVYDGDYYIWDHRYYDNKY-LKENFN-VDEEKIAEYYP 415
            LK ++ + E           +MV       WD  YY + Y L++  + +D+E+I+ Y+ 
Sbjct: 387 ELKSKQEKREIQPSPSEQDIASMVRP-----WDREYYTSMYSLQQRRDAIDDEQISSYFT 441

Query: 416 LESTIDGMLKIYETLLKLKFVE-VKENKKTWHDDVKQLAVWKLDTPENPEFVGWIFFDLH 474
           L + I G+  ++E++  ++    V +  +T+  +V++L V      E    +G ++ DL 
Sbjct: 442 LGNVIQGLSDLFESIYGIRLEPVVPKTGETFSPEVRRLNV----VCEQEGVIGVVYCDLF 497

Query: 475 PRDGKYGHAANFGLSSS----------------YISANGTRSYPITALVCNFSKSTKDKP 518
            R GK  + ++F +  S                + S       P+ ALVCNFS ST  + 
Sbjct: 498 ERAGKTSNPSHFTVCCSRQIYPKETEFSTIQTGFNSEGLMFQLPVIALVCNFSSSTDSEG 557

Query: 519 ---SLLKHSEITTFFHELGHGIHDLVGNNRIGRFNGPGAVPWDFVEAPSQMLEFWTWNTK 575
               LL+ +E+ T FHE+GH +H ++G  R+   +G      DFVE PS ++E +  + +
Sbjct: 558 KSICLLQLNEVETLFHEMGHAMHSMLGRTRLQNISGTRCAT-DFVELPSILMEHFARDVR 616

Query: 576 ELLSLSQNYKDNAKIDTKLLESLIKTKHVNGALFALRQLHFGLFDMKVHMMSA-EELDKL 634
            L  + ++++  A I  KLL + ++            Q    + D  +H     ++ D  
Sbjct: 617 VLERIGKHHRTGAPISEKLLLNYLEETKFMQHCETFSQAKMAMLDQDLHGEKVIKDFDHF 676

Query: 635 DIKKLWNDLREKICLISNGDQPTTGYNSFGHIMXXXXXXXXXXXMWAEVFATDMYYTKFK 694
           D+   +  L   + ++   D  +     FGH+            ++    A+ ++ + F 
Sbjct: 677 DVTAAYQQLERDMKVLV--DDKSNWCGKFGHLF--GYGATYYSYLFDRAIASKVWDSLFS 732

Query: 695 ADPLNPEVGVKYRDIVLARGG 715
           +DP +   G K+++ VL  GG
Sbjct: 733 SDPYSRVNGEKFKECVLKWGG 753

>YKL134C Chr11 complement(189124..191442) [2319 bp, 772 aa] {ON}
           OCT1Mitochondrial intermediate peptidase, cleaves
           destabilizing N-terminal residues of a subset of
           proteins upon import, after their cleavage by
           mitochondrial processing peptidase (Mas1p-Mas2p); may
           contribute to mitochondrial iron homeostasis
          Length = 772

 Score =  142 bits (359), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 124/511 (24%), Positives = 227/511 (44%), Gaps = 41/511 (8%)

Query: 257 FEKVNDEFGIQKLKV-TYKYPDIFPVLKNAQNPETRMKAFMGDQNKVPENEHLFKDTLKL 315
            +++N +   Q  KV T+ Y   + +LK+ +N   R K +    +   +        +KL
Sbjct: 263 LKQLNKDVKGQNYKVPTFGYA-AYALLKSCENEMVRKKLWTALHSCSDKQVKRLSHLIKL 321

Query: 316 RNELALVLGYDTYANYNLDIKMAKNADTVLSFVNDLIVKLQDPAKKELDILKNLKKQEFE 375
           R  LA ++   +YA Y L+ KMAKN   V  F+  L+    +    EL  +  LK ++ +
Sbjct: 322 RAILANLMHKTSYAEYQLEGKMAKNPKDVQDFILTLMNNTIEKTANELKFIAELKAKDLK 381

Query: 376 NEFNMVYDGDYYI---WDHRYYDNKYLKEN--FNVDEEKIAEYYPLESTIDGMLKIYETL 430
                  D    +   WD  YY  KY + N   + + ++I+ Y+ L + I G+  +++ +
Sbjct: 382 KPLTTNTDEILKLVRPWDRDYYTGKYFQLNPSNSPNAKEISYYFTLGNVIQGLSDLFQQI 441

Query: 431 LKLKF-VEVKENKKTWHDDVKQLAVWKLDTPENPEFVGWIFFDLHPRDGKYGHAANFGLS 489
             ++    + +  +TW  DV++L V      E    +G I+ DL  R+GK  + A+F + 
Sbjct: 442 YGIRLEPAITDEGETWSPDVRRLNV----ISEEEGIIGIIYCDLFERNGKTSNPAHFTVC 497

Query: 490 SS-------------YISANGTRSY---PITALVCNFSK---STKDKPSLLKHSEITTFF 530
            S              +  N   +Y   P+ +LVCNFS    ++K     L+ SE+ T F
Sbjct: 498 CSRQIYPSETDFSTIQVGENPDGTYFQLPVISLVCNFSPILIASKKSLCFLQLSEVETLF 557

Query: 531 HELGHGIHDLVGNNRIGRFNGPGAVPWDFVEAPSQMLEFWTWNTKELLSLSQNYKDNAKI 590
           HE+GH +H ++G   +   +G      DFVE PS ++E +  + + L  + ++Y     I
Sbjct: 558 HEMGHAMHSMLGRTHMQNISGTRCAT-DFVELPSILMEHFAKDIRILTKIGKHYGTGETI 616

Query: 591 DTKLLESLIKTKHVNGALFALRQLHFGLFDMKVH-MMSAEELDKLDIKKLWNDLREKICL 649
              +L+  +K+ +         Q    + D   H      ++D  D+ + +  L  ++ +
Sbjct: 617 QADMLQRFMKSTNFLQNCETYSQAKMAMLDQSFHDEKIISDIDNFDVVENYQALERRLKV 676

Query: 650 ISNGDQPTTGYNSFGHIMXXXXXXXXXXXMWAEVFATDMYYTKFKADPLNPEVGVKYRDI 709
           +   D  +     FGH+            ++    A+ ++Y  F+ DP + + G K++  
Sbjct: 677 LV--DDQSNWCGRFGHLF--GYGATYYSYLFDRTIASKIWYALFEDDPYSRKNGDKFKKH 732

Query: 710 VLARGGLYE----IDDNLEEFLGRKPAKDAF 736
           +L  GGL +    I D LE  +  K   DA 
Sbjct: 733 LLKWGGLKDPWKCIADVLECPMLEKGGSDAM 763

>AFR198W Chr6 (797448..799778) [2331 bp, 776 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YKL134C (OCT1)
          Length = 776

 Score =  139 bits (351), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 122/433 (28%), Positives = 201/433 (46%), Gaps = 42/433 (9%)

Query: 309 FKDTLKLRNELALVLGYDTYANYNLDIKMAKNADTVLSFVNDLIVKLQDPAKKELDILKN 368
            K  L+LR +LA ++G   Y +Y L+ KMAK+ + V +F+N L+   +  A  EL+ L  
Sbjct: 326 LKSLLQLRRKLANIMGATDYVSYQLEGKMAKSPENVKNFLNTLVDHTKPLAAGELEELAK 385

Query: 369 LKKQEFENEFNMVYDGDYYIWDHRYYDN---KYLKENFNVDE-EKIAEYYPLESTIDGML 424
           LK+   EN            WD  YY +    + + N  VD    I  Y+ L   + G+ 
Sbjct: 386 LKRN-VENLSETNTLKLMRPWDRDYYSSLSPNFTRPNHRVDGFTSINTYFSLGVVMQGIS 444

Query: 425 KIYETL--LKLKFVEVKENKKTWHDDVKQLAVWKLDTPENPEFVGWIFFDLHPRDGKYGH 482
            ++  +  + LK V V +  +TW  DV++L V      E    +G I+ DL  R GK   
Sbjct: 445 DLFRDIYGISLKPV-VAQAGETWAPDVRKLQV----ISETEGIIGLIYCDLLERPGKTTS 499

Query: 483 AANFGLSSS---YISAN------------GTR-SYPITALVCNF--SKSTKDKP-SLLKH 523
            ++F +  S   Y   N            G+R   P+ +L+CNF  ++  K+K   LL+ 
Sbjct: 500 PSHFTVCCSRQIYPEENDFSTIQVGENPDGSRFQMPVISLICNFRATRHGKNKSLCLLEL 559

Query: 524 SEITTFFHELGHGIHDLVGNNRIGRFNGPGAVPWDFVEAPSQMLEFWTWNTKELLSLSQN 583
           S++ T FHE+GH +H ++G  ++   +G   V  DFVE PS ++E +  + + LL +S N
Sbjct: 560 SDVETLFHEMGHALHSMLGRTQLQNLSGTRCVT-DFVELPSILMEHFAKDRRVLLRISSN 618

Query: 584 YKDNAKIDTKLLESLIKTKHVNGALFALRQLHFGLFDMKVHMMSAEELDKLDIKKLWNDL 643
           Y     I  +LL +  +  +         Q+   + D ++H ++    D+ DI  +++ L
Sbjct: 619 YATGEPIPEELLSAFQEQNNFLKNTETFSQIKMSMLDQRLHSIT----DQDDIIAVYHGL 674

Query: 644 -REKICLISNGDQPTTGYNSFGHIMXXXXXXXXXXXMWAEVFATDMYYTKFKADPLNPEV 702
            RE   L+   D  T     FGH+            +     A  ++   FK DP +   
Sbjct: 675 EREMEVLV---DDQTNWCGRFGHLF--GYGASYYSYLMDRAIAAKIWDHLFKKDPFSRSS 729

Query: 703 GVKYRDIVLARGG 715
           G K+++ VL  GG
Sbjct: 730 GEKFKEGVLKWGG 742

>KLTH0D04730g Chr4 (432572..434890) [2319 bp, 772 aa] {ON} similar
           to uniprot|P35999 Saccharomyces cerevisiae YKL134C OCT1
           Mitochondrial intermediate peptidase cleaves N-terminal
           residues of a subset of proteins upon import after their
           cleavage by mitochondrial processing peptidase
           (Mas1p-Mas2p) may contribute to mitochondrial iron
           homeostasis
          Length = 772

 Score =  137 bits (344), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 123/516 (23%), Positives = 237/516 (45%), Gaps = 55/516 (10%)

Query: 235 QKEYILFTAEELK--GVPESVIEQFEKVNDEFGIQKLKV-TYKYPDIFPVLKNAQNPETR 291
           + EY+  +  EL+  G+   ++    +  D  G Q  KV TY Y   F +L++  +   R
Sbjct: 243 KSEYVKVSCNELETSGISPLLLNHLSR--DTKG-QNYKVPTYGYI-AFSILRSCPSENIR 298

Query: 292 MKAFMGDQNKVPENEHLFKDTLKLRNELALVLGYDTYANYNLDIKMAKNADTVLSFVNDL 351
           MK +    +   +     K  +KLR  LA ++G ++Y++Y L+ KMAK+   V  FV  L
Sbjct: 299 MKVWTAVHSCPEKQITRLKHLVKLRGLLAQIMGKNSYSDYQLEGKMAKSPVYVRGFVESL 358

Query: 352 IVKLQDPAKKELDILKNLKKQEF--------ENEFNMVYDGDYYIWDHRYYDN--KYLKE 401
              ++  A +EL  L NLK            E     V       WD  +Y       ++
Sbjct: 359 AEAIKPLAMRELRALANLKSSHLDLPIPKTDEEVLKFVRP-----WDRDFYSTLISLQQQ 413

Query: 402 NFNVDEEKIAEYYPLESTIDGMLKIYETLLKLKF-VEVKENKKTWHDDVKQLAVWKLDTP 460
              ++ E+I  Y+ L + + G+  + E +  ++    V +  +TW  +V+++ V      
Sbjct: 414 RKTLENEQINSYFSLGTVMQGLSSLLEDIYGIRLEPAVAKVGETWSPEVRRINV----VS 469

Query: 461 ENPEFVGWIFFDLHPRDGKYGHAANFGLSSSYI-----------------SANGTRSYPI 503
           +    +G ++ DL  R GK  + A+F +  S                   S+      P+
Sbjct: 470 DQEGVIGVVYCDLFERQGKTSNPAHFTVCCSRQIYPEETDLSTIQVGQQPSSGQIFQLPV 529

Query: 504 TALVCNFSKSTKDKP--SLLKHSEITTFFHELGHGIHDLVGNNRIGRFNGPGAVPWDFVE 561
            +LVC+FS+++  K    LL+ SE+ T FHE+GH IH ++G   +   +G      DFVE
Sbjct: 530 ISLVCSFSQNSGSKKDVCLLQLSEVDTLFHEMGHAIHSMLGRTSLQNISGTRCAT-DFVE 588

Query: 562 APSQMLEFWTWNTKELLSLSQNYKDNAKIDTKLLE-SLIKTKHV-NGALFALRQLHFGLF 619
            PS ++E +  +++ L  + ++Y  N  +  +LL  +  + K++ N   F+  Q    + 
Sbjct: 589 LPSILMEHFAHDSRVLSRIGKHYITNEPVPDELLHLNQNELKYLQNTETFS--QAKMAML 646

Query: 620 DMKVHMMSAEELDKLDIKKLWNDLREKICLISNGDQPTTGYNSFGHIMXXXXXXXXXXXM 679
           D ++H         +D+ ++++++ +++ +++  D  +     FGH++           +
Sbjct: 647 DQEMHSPRMLTDGPVDVVEIYHEVEKQMGVLT--DDKSNWCGRFGHLL--GYGASYYSYL 702

Query: 680 WAEVFATDMYYTKFKADPLNPEVGVKYRDIVLARGG 715
           +    A+ ++   F  DP + + G K+++ VL  GG
Sbjct: 703 FDRAIASKVWQHLFANDPFSRKSGEKFKNSVLRWGG 738

>KNAG0A06200 Chr1 complement(937577..939946) [2370 bp, 789 aa] {ON}
           Anc_2.432 YKL134C
          Length = 789

 Score =  137 bits (344), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 131/518 (25%), Positives = 238/518 (45%), Gaps = 57/518 (11%)

Query: 235 QKEYILFTAEEL--KGVPESVIEQFEKVNDEFGIQKLKVT-YKYPDI----FPVLKNAQN 287
           + E+I   +EEL   GV   ++ Q            ++ T YK P      + +L++ +N
Sbjct: 260 RSEFIEIASEELDNSGVSPILLRQLTTT--------VRGTHYKVPAYGTAPYIILRSCKN 311

Query: 288 PETRMKAFMGDQNKVPENE-HLFKDTLKLRNELALVLGYDTYANYNLDIKMAKNADTVLS 346
              R KA     +  P+ + +     +K+R+ L+ ++G   +A Y L  KMAK+ + VL+
Sbjct: 312 ENAR-KAVWTALHSCPDKQINRLTHMVKMRSVLSNIMGKVGFAVYQLQGKMAKSPENVLN 370

Query: 347 FVNDLIVKLQDPAKKELDILKNLKKQEF----ENEFNMVYDGDYYIWDHRYYDNKYLK-- 400
           F+  L+   +  A +EL +L N+K  +      N    + +     WD  YY  K  +  
Sbjct: 371 FITRLMEHTKPMAAEELKLLANMKLNDLGLPEANSEKEILE-TVRPWDRDYYVAKSQQTR 429

Query: 401 --ENFNVDEEKIAEYYPLESTIDGMLKIYETLLKLKF-VEVKENKKTWHDDVKQLAVWKL 457
             +N   + E I  Y+ L S ++G+  +++++  +   V      +TW  +V+++ V   
Sbjct: 430 KAKNQLTNHEPINAYFTLGSVLEGLSNLFKSIYGISLEVVASIPGETWSSEVRRVNV--- 486

Query: 458 DTPENPEFVGWIFFDLHPRDGKYGHAANFGLSSSY----------ISANGTRS------Y 501
              EN   +G ++ DL  R  K    A+F +  S           I  +G  S       
Sbjct: 487 -KTENNNIIGVVYCDLFERKAKTSSPAHFTVCCSRELYAEENDPSILQSGVNSRGEKFQL 545

Query: 502 PITALVCNFSKSTKDKPSLLKHSEITTFFHELGHGIHDLVGNNRIGRFNGPGAVPWDFVE 561
           PI +LVCNF++++ ++  LL+ SEI T FHE+GH +H ++G  ++   +G      DFVE
Sbjct: 546 PIISLVCNFARTSDNELCLLQLSEIETLFHEMGHAMHSMLGQTKLQNISGTRCTT-DFVE 604

Query: 562 APSQMLEFWTWNTKELLSLSQNYKDNAKIDTKLL-ESLIKTKHV-NGALFALRQLHFGLF 619
            PS ++E +  + + L  + ++Y    K+   LL E L  T+++ N   FA  Q    + 
Sbjct: 605 LPSIIMEHFARDPRVLKGIGRHYITKEKVPEDLLAEELNSTRYLQNCETFA--QAKMAML 662

Query: 620 DMKVHMMSAE-ELDKLDIKKLWNDLREKICLISNGDQPTTGYNSFGHIMXXXXXXXXXXX 678
           D +++  +    +  LD+ +L++DL   + ++   D  T     FGH+            
Sbjct: 663 DQRLYDNNIIFHVRDLDVVELYHDLERNLEVLV--DDQTNWCGKFGHLF--GYGATYYSY 718

Query: 679 MWAEVFATDMYYTKFKADPLNPEVGVKYRDIVLARGGL 716
           +     A  ++   F  DP +   G  +++ VL  GGL
Sbjct: 719 LLDRAIAAKIWDCLFVNDPFSRTGGENFKNAVLKWGGL 756

>NCAS0A04280 Chr1 complement(864327..866648) [2322 bp, 773 aa] {ON}
           Anc_2.432
          Length = 773

 Score =  136 bits (343), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 119/444 (26%), Positives = 212/444 (47%), Gaps = 41/444 (9%)

Query: 313 LKLRNELALVLGYDTYANYNLDIKMAKNADTVLSFVNDLIVKLQDPAKKELDILKNLKKQ 372
           +KLR  LA +L   ++A Y L+ KMAK    V  F+  L+  ++  A +EL  + +LK +
Sbjct: 320 VKLRAILAHLLNKCSFAKYQLEGKMAKTPQNVRDFIKTLMDYMRPKAAQELKFMADLKCK 379

Query: 373 EF----ENEFNMVYDGDYYIWDHRYYDNKYLK-ENFNVDE-EKIAEYYPLESTIDGMLKI 426
           E      +    + D     WD  YY   + K ++ N+ E   I  Y+ + + + G+  I
Sbjct: 380 ELNIPTSDSTTAILDL-ISPWDREYYTTIHSKAKDVNLYENHPINMYFTMGNIMKGLSHI 438

Query: 427 YETLLKLKF-VEVKENKKTWHDDVKQLAVWKLDTPENPEFVGWIFFDLHPRDGKYGHAAN 485
           ++ +  ++    V E  +TW  +V++L V      E    +G ++ DL  R GK  + A+
Sbjct: 439 FQRIYGIRLEAVVPEEGETWSPEVRRLNV----ISETEGLIGVVYCDLFERAGKTSNPAH 494

Query: 486 FG-------------LSSSYISAN--GTR-SYPITALVCNFSK--STKDKP-SLLKHSEI 526
           F              LS+  I  N  GT    P+ +LVCNFS   ++ DK   LL+ +EI
Sbjct: 495 FTVCCSRQIYPDENDLSTIQIGTNPDGTAFQLPVISLVCNFSSTLTSNDKMICLLQLNEI 554

Query: 527 TTFFHELGHGIHDLVGNNRIGRFNGPGAVPWDFVEAPSQMLEFWTWNTKELLSLSQNYKD 586
            T FHE+GH +H ++G +R+   +G      DFVE PS ++E +  + + L  +  +Y+ 
Sbjct: 555 ETLFHEMGHAMHSMLGRSRLQNVSGTRCAT-DFVELPSILMEHFARDKRVLHEIGFHYET 613

Query: 587 NAKIDTKLLESLIKTKHVNGALFALRQLHFGLFDMKVHMMS-AEELDKLDIKKLWNDLRE 645
           N ++   ++E+ +K            Q    + D +++  +  ++LD +D+ K++  L E
Sbjct: 614 NERVSEYVIEAHLKKMKFLQDCETFSQGKMAMLDQELYSENIIKDLDHVDVVKIYQTLEE 673

Query: 646 KICLISNGDQPTTGYNSFGHIMXXXXXXXXXXXMWAEVFATDMYYTKFKADPLNPEVGVK 705
            + ++   D  +     FGH+            ++    A+ ++   F  DP + E G K
Sbjct: 674 DLKVLV--DNKSNWCGKFGHLF--GYGASYYSYLFDRAIASKVWDQLFAKDPFSREGGEK 729

Query: 706 YRDIVLARGGLYE----IDDNLEE 725
           +++ VL  GGL +    I D LE+
Sbjct: 730 FKNCVLKWGGLRDPWHCIADVLEQ 753

>KLLA0B12397g Chr2 complement(1084129..1086468) [2340 bp, 779 aa]
           {ON} similar to uniprot|P35999 Saccharomyces cerevisiae
           YKL134C OCT1 Mitochondrial intermediate peptidase
           cleaves N-terminal residues of a subset of proteins upon
           import after their cleavage by mitochondrial processing
           peptidase (Mas1p-Mas2p) may contribute to mitochondrial
           iron homeostasis
          Length = 779

 Score =  130 bits (327), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 108/466 (23%), Positives = 204/466 (43%), Gaps = 40/466 (8%)

Query: 281 VLKNAQNPETRMKAFMGDQNKVPENEHLFKDTLKLRNELALVLGYDTYANYNLDIKMAKN 340
           +L+   +   RMK +    +            + LR ELA +LG   +A Y L  KMAK 
Sbjct: 288 LLRTCSDEVIRMKIWTEMHSCSDAQIERLTKLISLRVELAKLLGSQNFAQYQLHGKMAKT 347

Query: 341 ADTVLSFVNDLIVKLQDPAKKELDILKNLKKQEFENEFNMVYDGDYYI---WDHRYYDNK 397
            + V  F+  L+   +  A  EL  L  LK +    +     +    +   WD  YY + 
Sbjct: 348 PENVSGFLESLVHSTRIKAASELKPLAVLKSELTGTQTPHTSEEVLELMKPWDRDYYGSI 407

Query: 398 YL---KENFNVDE-EKIAEYYPLESTIDGMLKIYETLLKLKFV-EVKENKKTWHDDVKQL 452
                + + ++D  E I+  + L   + G+  ++E +  +K V    +  +TW  DV+++
Sbjct: 408 QALAQRRSSSLDNGESISSSFSLGVVMQGLSDLFEKIYGIKLVPATPKTGETWSPDVRRI 467

Query: 453 AVWKLDTPENPEFVGWIFFDLHPRDGKYGHAANFGLSSSY---------------ISANG 497
            V      E+   +G ++ DL  R+GK  + A+F +  S                +++NG
Sbjct: 468 DV----VDEHDGLIGVMYCDLFEREGKTPNPAHFTVCCSRNMYLNEADTSTIQVGVNSNG 523

Query: 498 TR-SYPITALVCNF-------SKSTKDKPSLLKHSEITTFFHELGHGIHDLVGNNRIGRF 549
            +   P+ +LVC+F             +  LL+ +EI T FHE+GH +H ++G  ++   
Sbjct: 524 QKFQLPVISLVCDFRWVEVNMGDGKHQQMCLLQLNEIETLFHEMGHAMHSMLGRTQLQNV 583

Query: 550 NGPGAVPWDFVEAPSQMLEFWTWNTKELLSLSQNYKDNAKIDTKLLESLIKTKHVNGALF 609
           +G      DFVE PS ++E +  +T+ L S+S +YK    +D ++L++            
Sbjct: 584 SGTRCAT-DFVELPSILMEHFARDTRVLSSISSHYKTGKSLDVEVLKNHQLENQFLQNCE 642

Query: 610 ALRQLHFGLFDMKVHMMSAEELDKLDIKKLWNDLREKICLISNGDQPTTGYNSFGHIMXX 669
              Q+     D ++H +       +D+  +++ L  ++ ++   D  +     FGH+   
Sbjct: 643 TFSQIKMSFLDQELHNLDHTTDGSIDVIAIYHRLERRLAVLP--DDQSNWCGKFGHLF-- 698

Query: 670 XXXXXXXXXMWAEVFATDMYYTKFKADPLNPEVGVKYRDIVLARGG 715
                    ++    A+ ++   F+ DP N   G K+++ +L  GG
Sbjct: 699 GYGASYYSYLFDRAIASKIWDHLFEQDPFNRTNGTKFKEGLLQWGG 744

>Ecym_6099 Chr6 complement(186647..188968) [2322 bp, 773 aa] {ON}
           similar to Ashbya gossypii AFR198W
          Length = 773

 Score =  130 bits (326), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 116/500 (23%), Positives = 225/500 (45%), Gaps = 51/500 (10%)

Query: 245 ELKGVPESVIEQFEK-VNDEFGIQKLKVTYKYPDI----FPVLKNAQNPETRMKAFMGDQ 299
           E  GV + V++Q  K ++ +F        YK P      + +++   +   R K +    
Sbjct: 262 EASGVSQMVLQQLSKDLSGKF--------YKIPTYGYLPYSIIRTCPSEYIRKKVWTA-M 312

Query: 300 NKVPENE-HLFKDTLKLRNELALVLGYDTYANYNLDIKMAKNADTVLSFVNDLIVKLQDP 358
              PE +    K  ++LR +LA ++G   YA Y L+ KMAK+   V +F+N LI   +  
Sbjct: 313 YSCPEKQIKRLKKLVRLRQQLAHIMGKPDYATYQLEGKMAKSPKNVKNFMNTLIEYTKPL 372

Query: 359 AKKELDILKNLKKQEFENEFNMVYDGDYYIWDHRYYDNKYL----KENFNVDEEKIAEYY 414
           A +EL  L ++K      + + +       WD  Y+ +  L    +    +  + +  Y+
Sbjct: 373 AMEELKPLADMKHDNHCKDASEIL-SSVRPWDRDYFGSMSLLAQPRSVKTMSFQSLNCYF 431

Query: 415 PLESTIDGMLKIYETLLKLKFVE-VKENKKTWHDDVKQLAVWKLDTPENPEFVGWIFFDL 473
            L   I G+  +++++  ++    V +  +TW  +V+++ V      E    +G I+ DL
Sbjct: 432 SLGVVIQGLSDLFQSIYGIRLEPVVAKTGETWDPEVRKIQV----ISEANGVIGVIYCDL 487

Query: 474 HPRDGKYGHAANFGLSSS-------------YISANGTRS---YPITALVCNFSKSTKDK 517
             R GK  + A+F +  S              + ++  +S    P+ +LVCNFS +  D 
Sbjct: 488 FERQGKTPNPAHFTVCCSRQIYPNETDYSTIQVGSHPDKSKFQMPVISLVCNFSHTQADD 547

Query: 518 PS--LLKHSEITTFFHELGHGIHDLVGNNRIGRFNGPGAVPWDFVEAPSQMLEFWTWNTK 575
            S  LL+ SE+ T FHE+GH +H ++G  ++   +G      DFVE PS ++E +  + +
Sbjct: 548 DSICLLQLSEVETLFHEMGHAMHSMLGRTQLQNISGTRCAT-DFVELPSILMEHFAKDLR 606

Query: 576 ELLSLSQNYKDNAKIDTKLLESLIKTKHVNGALFALRQLHFGLFDMKVHMMSAEELDKLD 635
            L  +S +Y    ++  ++L +  +            Q+   + D ++H ++    +  D
Sbjct: 607 VLSRISSHYATGERVPKEMLVNYQQENRFLEHTETFSQIKMAMLDQRLHSLTD---NSED 663

Query: 636 IKKLWNDLREKICLISNGDQPTTGYNSFGHIMXXXXXXXXXXXMWAEVFATDMYYTKFKA 695
           I  +++ L +++ ++   D  +     FGH+            +     A  ++   F+ 
Sbjct: 664 IVTVYHGLEKELQVLV--DDRSNWCGRFGHLF--GYGASYYSYLMDRAIAAKVWNHLFQH 719

Query: 696 DPLNPEVGVKYRDIVLARGG 715
           DP +   G K+++ VL  GG
Sbjct: 720 DPFSRAGGEKFKNSVLKWGG 739

>ZYRO0G10076g Chr7 (805645..807993) [2349 bp, 782 aa] {ON} highly
           similar to uniprot|P07264 Saccharomyces cerevisiae
           YGL009C LEU1 Isopropylmalate isomerase catalyzes the
           second step in the leucine biosynthesis pathway
          Length = 782

 Score = 35.4 bits (80), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 25/41 (60%)

Query: 139 KTIRDASMEATMLLQDFEIESGSRVDLFKQFDLIWNQIKDK 179
           K I D SMEA M + +  IE+G+R  + K  +  +N +K+K
Sbjct: 219 KAIEDLSMEARMSMCNMSIEAGARAGMIKPDETTFNYVKNK 259

>Ecym_3519 Chr3 (976242..979943) [3702 bp, 1233 aa] {ON} similar to
           Ashbya gossypii AGR116W
          Length = 1233

 Score = 34.3 bits (77), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 41/173 (23%), Positives = 80/173 (46%), Gaps = 28/173 (16%)

Query: 294 AFMGDQNKVPENEHLFK----DTLKLRNELALVLGYDTYANYNLDIKMAKNADTVLSFVN 349
           AF+G    +P+ E L      +TLK+     ++ G++T +    D+   +   ++L F+ 
Sbjct: 686 AFIG----LPDLERLLSRIHSNTLKISEFDKVITGFETVSKLVQDLNKYELKGSLLKFLK 741

Query: 350 DLIVKLQDPAKKELDILKNLKKQEFENEFNMVYDGDYYIWDHRYYDNKYLKENFNVDEEK 409
           ++ + L      E DI          N +N VYD +  + +     NK +++ F+   ++
Sbjct: 742 EIPITL------EGDI----------NTWNKVYDRNKAVHEGALIPNKGVEQEFDKSIDR 785

Query: 410 IAEYYPLESTIDGMLKIYETLLKLKFVEVKENKKTWHDDVKQLAVWKLDTPEN 462
           I E   LE+    ML+ Y+  LK   ++ K++ K  +     ++V K + P N
Sbjct: 786 INE---LENEFSSMLREYKKELKCSSIQYKDSGKEIYTIEIPISVCK-NVPSN 834

>NDAI0A03440 Chr1 (789010..790836) [1827 bp, 608 aa] {ON} Anc_8.227
           YDR091C
          Length = 608

 Score = 33.1 bits (74), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 33/59 (55%), Gaps = 2/59 (3%)

Query: 333 LDIKMAKNADTVLSFVNDLIVKLQDPAKKELDILKNLKKQEFENEFNMVYDGDYYIWDH 391
           L ++M K+++TV S++  L  +L+    +E+D L   + Q F    + V D D Y++D 
Sbjct: 191 LKLRMEKDSETVKSYIKTL--QLEGVLNREIDKLSGGELQRFAIGMSCVQDADVYMFDE 247

>NCAS0D04600 Chr4 (875553..880604) [5052 bp, 1683 aa] {ON} Anc_6.341
          Length = 1683

 Score = 32.3 bits (72), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 18/29 (62%)

Query: 40  HLNNTYTSSIRNYSQLANTRFTNMPSLTP 68
           HLN T  +SI   SQL N+   N+P+ TP
Sbjct: 223 HLNQTSNASISTISQLTNSSLNNIPTPTP 251

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.137    0.411 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 84,478,512
Number of extensions: 4028784
Number of successful extensions: 13039
Number of sequences better than 10.0: 91
Number of HSP's gapped: 13216
Number of HSP's successfully gapped: 91
Length of query: 743
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 626
Effective length of database: 40,065,477
Effective search space: 25080988602
Effective search space used: 25080988602
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 70 (31.6 bits)