Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
CAGL0B00396g1.8ON88884451e-58
TPHA0E039801.8ON86843279e-41
NCAS0B090801.8ON93893234e-40
AFR743W1.8ON82873156e-39
Ecym_10101.8ON82733131e-38
SAKL0C00528g1.8ON110713124e-38
TBLA0A049601.8ON96813104e-38
ZYRO0F18414g1.8ON87733079e-38
KLTH0F00550g1.8ON82703061e-37
Kpol_2002.111.8ON86843061e-37
Kwal_33.130161.8ON82743034e-37
YCL057C-A (MOS1)1.8ON97743036e-37
Skud_3.61.8ON97743001e-36
Smik_3.171.8ON97822992e-36
Suva_3.1551.8ON97742965e-36
KLLA0C00550g1.8ON82702704e-32
TDEL0C069401.8ON86842671e-31
NDAI0A001701.8ON96832621e-30
KNAG0C002501.8ON94712602e-30
KAFR0D001701.8ON90892574e-30
SAKL0C10230g3.119ON97151700.19
TDEL0F047308.349ON69428670.40
TPHA0B025105.259ON136723621.8
Smik_15.2315.655ON65358603.8
YOR054C (VHS3)5.655ON67458595.1
TDEL0E00180singletonON52340586.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0B00396g
         (88 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0B00396g Chr2 complement(24498..24764) [267 bp, 88 aa] {ON} ...   176   1e-58
TPHA0E03980 Chr5 (837161..837421) [261 bp, 86 aa] {ON} Anc_1.8 Y...   130   9e-41
NCAS0B09080 Chr2 (1744147..1744428) [282 bp, 93 aa] {ON} Anc_1.8...   129   4e-40
AFR743W Chr6 (1800868..1801116) [249 bp, 82 aa] {ON} Syntenic ho...   125   6e-39
Ecym_1010 Chr1 complement(19126..19374) [249 bp, 82 aa] {ON} sim...   125   1e-38
SAKL0C00528g Chr3 complement(47403..47735) [333 bp, 110 aa] {ON}...   124   4e-38
TBLA0A04960 Chr1 complement(1220183..1220473) [291 bp, 96 aa] {O...   124   4e-38
ZYRO0F18414g Chr6 (1521776..1522039) [264 bp, 87 aa] {ON} simila...   122   9e-38
KLTH0F00550g Chr6 complement(42092..42340) [249 bp, 82 aa] {ON} ...   122   1e-37
Kpol_2002.11 s2002 complement(19864..20124) [261 bp, 86 aa] {ON}...   122   1e-37
Kwal_33.13016 s33 complement(41816..42064) [249 bp, 82 aa] {ON} ...   121   4e-37
YCL057C-A Chr3 complement(24032..24325) [294 bp, 97 aa] {ON}  MO...   121   6e-37
Skud_3.6 Chr3 complement(12034..12324) [291 bp, 97 aa] {ON} YCL0...   120   1e-36
Smik_3.17 Chr3 complement(25487..25777) [291 bp, 97 aa] {ON} YCL...   119   2e-36
Suva_3.155 Chr3 complement(233792..234085) [294 bp, 97 aa] {ON} ...   118   5e-36
KLLA0C00550g Chr3 complement(40901..41149) [249 bp, 82 aa] {ON} ...   108   4e-32
TDEL0C06940 Chr3 (1261913..1262173) [261 bp, 86 aa] {ON} Anc_1.8...   107   1e-31
NDAI0A00170 Chr1 complement(13975..14265) [291 bp, 96 aa] {ON} A...   105   1e-30
KNAG0C00250 Chr3 complement(38677..38961) [285 bp, 94 aa] {ON} A...   104   2e-30
KAFR0D00170 Chr4 complement(18220..18492) [273 bp, 90 aa] {ON} A...   103   4e-30
SAKL0C10230g Chr3 (920651..923566) [2916 bp, 971 aa] {ON} simila...    32   0.19 
TDEL0F04730 Chr6 (889641..891725) [2085 bp, 694 aa] {ON} Anc_8.3...    30   0.40 
TPHA0B02510 Chr2 complement(573028..577131) [4104 bp, 1367 aa] {...    28   1.8  
Smik_15.231 Chr15 complement(394040..396001) [1962 bp, 653 aa] {...    28   3.8  
YOR054C Chr15 complement(427833..429857) [2025 bp, 674 aa] {ON} ...    27   5.1  
TDEL0E00180 Chr5 complement(21188..22759) [1572 bp, 523 aa] {ON}       27   6.1  

>CAGL0B00396g Chr2 complement(24498..24764) [267 bp, 88 aa] {ON}
          highly similar to uniprot|Q96VH5 Saccharomyces
          cerevisiae YCL057ca
          Length = 88

 Score =  176 bits (445), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 88/88 (100%), Positives = 88/88 (100%)

Query: 1  MSNKEETKAKTVDYTPVRSILNDKWDVVLSNMIVKMGLGFGVGVVTSVLFFKRRSFPVWL 60
          MSNKEETKAKTVDYTPVRSILNDKWDVVLSNMIVKMGLGFGVGVVTSVLFFKRRSFPVWL
Sbjct: 1  MSNKEETKAKTVDYTPVRSILNDKWDVVLSNMIVKMGLGFGVGVVTSVLFFKRRSFPVWL 60

Query: 61 GVGFGAGRGYSEGDAIFRSTAGLRSVKV 88
          GVGFGAGRGYSEGDAIFRSTAGLRSVKV
Sbjct: 61 GVGFGAGRGYSEGDAIFRSTAGLRSVKV 88

>TPHA0E03980 Chr5 (837161..837421) [261 bp, 86 aa] {ON} Anc_1.8
          YCL057C-A
          Length = 86

 Score =  130 bits (327), Expect = 9e-41,   Method: Compositional matrix adjust.
 Identities = 60/84 (71%), Positives = 71/84 (84%)

Query: 5  EETKAKTVDYTPVRSILNDKWDVVLSNMIVKMGLGFGVGVVTSVLFFKRRSFPVWLGVGF 64
          E+     ++ T  +SILNDKWDVVLSNM+VK GLGFGVGVVTS+L FKRR+FPVWLG+GF
Sbjct: 3  EQKNNNNLELTSPKSILNDKWDVVLSNMLVKTGLGFGVGVVTSILLFKRRAFPVWLGIGF 62

Query: 65 GAGRGYSEGDAIFRSTAGLRSVKV 88
          G GRGYS+GDAIFRS AGLRS ++
Sbjct: 63 GVGRGYSDGDAIFRSAAGLRSTRI 86

>NCAS0B09080 Chr2 (1744147..1744428) [282 bp, 93 aa] {ON} Anc_1.8
          YCL057C-A
          Length = 93

 Score =  129 bits (323), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 62/89 (69%), Positives = 73/89 (82%), Gaps = 2/89 (2%)

Query: 2  SNKEETKAKTVDYTPV--RSILNDKWDVVLSNMIVKMGLGFGVGVVTSVLFFKRRSFPVW 59
          +N  ++   +   TP   RSILNDKWDVVLSNM+VK+GLGF VGVV SV+FFKRR+FPVW
Sbjct: 5  NNPNQSTPTSTAVTPTIDRSILNDKWDVVLSNMLVKVGLGFSVGVVASVIFFKRRTFPVW 64

Query: 60 LGVGFGAGRGYSEGDAIFRSTAGLRSVKV 88
          LG+GFG GRGY+EGDAIFRS AGLR+ KV
Sbjct: 65 LGIGFGVGRGYAEGDAIFRSPAGLRTAKV 93

>AFR743W Chr6 (1800868..1801116) [249 bp, 82 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YCL057C-A
          Length = 82

 Score =  125 bits (315), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 63/87 (72%), Positives = 70/87 (80%), Gaps = 6/87 (6%)

Query: 1  MSNKEETKAKTVDYTPVRSILNDKWDVVLSNMIVKMGLGFGVGVVTSVLFFKRRSFPVWL 60
          MS + E  A      P RSILNDKWDVVLSN++VK GLGFG GV  SVLFFKRR+FPVWL
Sbjct: 1  MSGQLEVSA------PSRSILNDKWDVVLSNLVVKTGLGFGAGVFASVLFFKRRAFPVWL 54

Query: 61 GVGFGAGRGYSEGDAIFRSTAGLRSVK 87
          GVGFG GRGY+EGDAIFRS AGLR+V+
Sbjct: 55 GVGFGLGRGYAEGDAIFRSHAGLRAVR 81

>Ecym_1010 Chr1 complement(19126..19374) [249 bp, 82 aa] {ON}
          similar to Ashbya gossypii AFR743W
          Length = 82

 Score =  125 bits (313), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 58/73 (79%), Positives = 66/73 (90%)

Query: 15 TPVRSILNDKWDVVLSNMIVKMGLGFGVGVVTSVLFFKRRSFPVWLGVGFGAGRGYSEGD 74
           P RSILNDKWDVVLSN++VK GLGF VGV+ SVLFFKRR+FPVWLG+GFG GRGY+EGD
Sbjct: 9  APSRSILNDKWDVVLSNLVVKAGLGFSVGVLASVLFFKRRAFPVWLGIGFGLGRGYAEGD 68

Query: 75 AIFRSTAGLRSVK 87
          AIFRS AGLR++K
Sbjct: 69 AIFRSHAGLRTMK 81

>SAKL0C00528g Chr3 complement(47403..47735) [333 bp, 110 aa] {ON}
           similar to uniprot|Q96VH5 Saccharomyces cerevisiae
           YCL057C-A
          Length = 110

 Score =  124 bits (312), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 57/71 (80%), Positives = 65/71 (91%)

Query: 16  PVRSILNDKWDVVLSNMIVKMGLGFGVGVVTSVLFFKRRSFPVWLGVGFGAGRGYSEGDA 75
           P +SILNDKWDVVLSN++VK GLGFG G+V SVL FKRR+FPVWLGVGFG GRGY+EGDA
Sbjct: 38  PNKSILNDKWDVVLSNVVVKTGLGFGAGIVASVLLFKRRAFPVWLGVGFGLGRGYAEGDA 97

Query: 76  IFRSTAGLRSV 86
           IFRS+AGLR+V
Sbjct: 98  IFRSSAGLRTV 108

>TBLA0A04960 Chr1 complement(1220183..1220473) [291 bp, 96 aa]
          {ON} Anc_1.8 YCL057C-A
          Length = 96

 Score =  124 bits (310), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 58/81 (71%), Positives = 68/81 (83%)

Query: 8  KAKTVDYTPVRSILNDKWDVVLSNMIVKMGLGFGVGVVTSVLFFKRRSFPVWLGVGFGAG 67
          ++ +   T  RSILNDKWD+V+SNM+VK   GFG GV+ SV+FFKRR+FPVWLGVGFG G
Sbjct: 16 ESASTAVTSNRSILNDKWDIVISNMLVKTTFGFGAGVLASVIFFKRRAFPVWLGVGFGLG 75

Query: 68 RGYSEGDAIFRSTAGLRSVKV 88
          RGYSEGDAIFRSTAGLRS +V
Sbjct: 76 RGYSEGDAIFRSTAGLRSFQV 96

>ZYRO0F18414g Chr6 (1521776..1522039) [264 bp, 87 aa] {ON} similar
          to uniprot|Q96VH5 Saccharomyces cerevisiae YCL057C-A
          Length = 87

 Score =  122 bits (307), Expect = 9e-38,   Method: Compositional matrix adjust.
 Identities = 58/73 (79%), Positives = 65/73 (89%)

Query: 15 TPVRSILNDKWDVVLSNMIVKMGLGFGVGVVTSVLFFKRRSFPVWLGVGFGAGRGYSEGD 74
           P +SILNDKWDVVLSN++VK GLGFGVGVV SVL FKRR+FPVWLG+GFG GRGY+EGD
Sbjct: 14 APNKSILNDKWDVVLSNLLVKSGLGFGVGVVASVLIFKRRAFPVWLGIGFGLGRGYAEGD 73

Query: 75 AIFRSTAGLRSVK 87
          AIFRS AGLR+ K
Sbjct: 74 AIFRSAAGLRTSK 86

>KLTH0F00550g Chr6 complement(42092..42340) [249 bp, 82 aa] {ON}
          similar to uniprot|Q96VH5 Saccharomyces cerevisiae
          YCL057C-A
          Length = 82

 Score =  122 bits (306), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 57/70 (81%), Positives = 65/70 (92%)

Query: 18 RSILNDKWDVVLSNMIVKMGLGFGVGVVTSVLFFKRRSFPVWLGVGFGAGRGYSEGDAIF 77
          RS+LNDKWDVVLSN++VK GLGFG GVV SVL FKRR+FPVW+GVGFG GRGY+EGDAIF
Sbjct: 12 RSLLNDKWDVVLSNLVVKTGLGFGAGVVASVLLFKRRAFPVWIGVGFGLGRGYAEGDAIF 71

Query: 78 RSTAGLRSVK 87
          RS+AGLR+VK
Sbjct: 72 RSSAGLRTVK 81

>Kpol_2002.11 s2002 complement(19864..20124) [261 bp, 86 aa] {ON}
          complement(19864..20124) [261 nt, 87 aa]
          Length = 86

 Score =  122 bits (306), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 56/84 (66%), Positives = 66/84 (78%)

Query: 5  EETKAKTVDYTPVRSILNDKWDVVLSNMIVKMGLGFGVGVVTSVLFFKRRSFPVWLGVGF 64
          ++++   +   P RSILNDKWDVVLSN +VK  LGFG GV+ SV+ FKRR+FPVWLG+GF
Sbjct: 3  QQSQELQITSAPTRSILNDKWDVVLSNFLVKTSLGFGAGVLASVILFKRRAFPVWLGIGF 62

Query: 65 GAGRGYSEGDAIFRSTAGLRSVKV 88
          G GRGYSEGDAIFRS AGLR   V
Sbjct: 63 GIGRGYSEGDAIFRSAAGLRKSTV 86

>Kwal_33.13016 s33 complement(41816..42064) [249 bp, 82 aa] {ON}
          YCL057C-A - Hypothetical ORF, has similarity to
          proteins in S. pombe, C. elegans, D. melanogaster.
          [contig 123] FULL
          Length = 82

 Score =  121 bits (303), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 59/74 (79%), Positives = 67/74 (90%), Gaps = 1/74 (1%)

Query: 15 TPV-RSILNDKWDVVLSNMIVKMGLGFGVGVVTSVLFFKRRSFPVWLGVGFGAGRGYSEG 73
           PV RS+LNDKWDVVLSN++VK+GLGFG GVV SVL FKRR+ PVW+GVGFG GRGYSEG
Sbjct: 8  APVSRSLLNDKWDVVLSNLVVKVGLGFGAGVVASVLLFKRRAAPVWIGVGFGLGRGYSEG 67

Query: 74 DAIFRSTAGLRSVK 87
          DAIFRS+AGLR+VK
Sbjct: 68 DAIFRSSAGLRTVK 81

>YCL057C-A Chr3 complement(24032..24325) [294 bp, 97 aa] {ON}
          MOS1Mitochondrial protein essential for proper inner
          membrane organization; conserved component of the
          mitochondrial inner membrane organizing system (MICOS,
          MINOS, or MitOS), a scaffold-like structure on the
          intermembrane space side of the inner membrane which
          has a role in the maintenance of crista junctions and
          inner membrane architecture; ortholog of human MINOS1
          Length = 97

 Score =  121 bits (303), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 56/74 (75%), Positives = 66/74 (89%)

Query: 15 TPVRSILNDKWDVVLSNMIVKMGLGFGVGVVTSVLFFKRRSFPVWLGVGFGAGRGYSEGD 74
          + V +IL+ KWD+VLSNM+VK  +GFGVGV TSVLFFKRR+FPVWLG+GFG GRGY+EGD
Sbjct: 24 SSVSTILDTKWDIVLSNMLVKTAMGFGVGVFTSVLFFKRRAFPVWLGIGFGVGRGYAEGD 83

Query: 75 AIFRSTAGLRSVKV 88
          AIFRS+AGLRS KV
Sbjct: 84 AIFRSSAGLRSSKV 97

>Skud_3.6 Chr3 complement(12034..12324) [291 bp, 97 aa] {ON}
          YCL057C-A (REAL)
          Length = 97

 Score =  120 bits (300), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 55/74 (74%), Positives = 66/74 (89%)

Query: 15 TPVRSILNDKWDVVLSNMIVKMGLGFGVGVVTSVLFFKRRSFPVWLGVGFGAGRGYSEGD 74
          + V +IL+ KWD+V+SNM+VK  +GFGVGV TSVLFFKRR+FPVWLG+GFG GRGY+EGD
Sbjct: 24 SAVSTILDAKWDIVMSNMLVKTAMGFGVGVFTSVLFFKRRAFPVWLGIGFGVGRGYAEGD 83

Query: 75 AIFRSTAGLRSVKV 88
          AIFRS+AGLRS KV
Sbjct: 84 AIFRSSAGLRSSKV 97

>Smik_3.17 Chr3 complement(25487..25777) [291 bp, 97 aa] {ON}
          YCL057C-A (REAL)
          Length = 97

 Score =  119 bits (299), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 56/82 (68%), Positives = 70/82 (85%)

Query: 7  TKAKTVDYTPVRSILNDKWDVVLSNMIVKMGLGFGVGVVTSVLFFKRRSFPVWLGVGFGA 66
          +K  + + + V ++L+ KWD+VLSNM+VK  +GFGVGV TSVLFFKRR+FPVWLG+GFG 
Sbjct: 16 SKDSSKNGSGVSTVLDTKWDIVLSNMLVKTAMGFGVGVFTSVLFFKRRAFPVWLGIGFGV 75

Query: 67 GRGYSEGDAIFRSTAGLRSVKV 88
          GRGY+EGDAIFRS+AGLRS KV
Sbjct: 76 GRGYAEGDAIFRSSAGLRSSKV 97

>Suva_3.155 Chr3 complement(233792..234085) [294 bp, 97 aa] {ON}
          YCL057C-A (REAL)
          Length = 97

 Score =  118 bits (296), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 53/74 (71%), Positives = 65/74 (87%)

Query: 15 TPVRSILNDKWDVVLSNMIVKMGLGFGVGVVTSVLFFKRRSFPVWLGVGFGAGRGYSEGD 74
          + V ++L+ KWD+VLSNM+VK  +GFG+GV TSVLFFKRR+FP WLG+GFG GRGY+EGD
Sbjct: 24 SAVSTVLDAKWDIVLSNMLVKTAMGFGIGVFTSVLFFKRRAFPAWLGIGFGVGRGYAEGD 83

Query: 75 AIFRSTAGLRSVKV 88
          AIFRS+AGLRS KV
Sbjct: 84 AIFRSSAGLRSSKV 97

>KLLA0C00550g Chr3 complement(40901..41149) [249 bp, 82 aa] {ON}
          similar to uniprot|Q96VH5 Saccharomyces cerevisiae
          YCL057C-A
          Length = 82

 Score =  108 bits (270), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 51/70 (72%), Positives = 60/70 (85%)

Query: 17 VRSILNDKWDVVLSNMIVKMGLGFGVGVVTSVLFFKRRSFPVWLGVGFGAGRGYSEGDAI 76
          V SIL+ +WDVVLSN++ K  LG GVG+V SVLFFKRR+FPVW+GVGFG GRGY+EGDAI
Sbjct: 11 VPSILDKRWDVVLSNVVAKTALGAGVGIVASVLFFKRRAFPVWVGVGFGLGRGYAEGDAI 70

Query: 77 FRSTAGLRSV 86
          FR+ AGLR V
Sbjct: 71 FRTNAGLRKV 80

>TDEL0C06940 Chr3 (1261913..1262173) [261 bp, 86 aa] {ON} Anc_1.8
          YCL057C-A
          Length = 86

 Score =  107 bits (267), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 65/84 (77%), Positives = 73/84 (86%)

Query: 5  EETKAKTVDYTPVRSILNDKWDVVLSNMIVKMGLGFGVGVVTSVLFFKRRSFPVWLGVGF 64
          E+++A+     P RSILNDKWDVVLSNM+VK GLGFGVGVV SVLFFKRR+FPVWLG+GF
Sbjct: 3  EKSQAQLQVAAPSRSILNDKWDVVLSNMLVKTGLGFGVGVVGSVLFFKRRAFPVWLGIGF 62

Query: 65 GAGRGYSEGDAIFRSTAGLRSVKV 88
          G GRGY+EGDAIFRS AGLRSVK 
Sbjct: 63 GLGRGYAEGDAIFRSAAGLRSVKA 86

>NDAI0A00170 Chr1 complement(13975..14265) [291 bp, 96 aa] {ON}
          Anc_1.8 YCL057C-A
          Length = 96

 Score =  105 bits (262), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 61/83 (73%), Positives = 74/83 (89%), Gaps = 4/83 (4%)

Query: 6  ETKAKTVDYTPVRSILNDKWDVVLSNMIVKMGLGFGVGVVTSVLFFKRRSFPVWLGVGFG 65
          + +  T+D    +SILNDKWD+VLSN +VK+GLGFGVGVVTSV+FFKRR+FPVWLG+GFG
Sbjct: 18 QQQLATID----KSILNDKWDIVLSNTLVKVGLGFGVGVVTSVIFFKRRTFPVWLGIGFG 73

Query: 66 AGRGYSEGDAIFRSTAGLRSVKV 88
          AGRGY+EGDAIFRS+AG+RSV V
Sbjct: 74 AGRGYAEGDAIFRSSAGIRSVNV 96

>KNAG0C00250 Chr3 complement(38677..38961) [285 bp, 94 aa] {ON}
          Anc_1.8 YCL057C-A
          Length = 94

 Score =  104 bits (260), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 59/71 (83%), Positives = 69/71 (97%)

Query: 18 RSILNDKWDVVLSNMIVKMGLGFGVGVVTSVLFFKRRSFPVWLGVGFGAGRGYSEGDAIF 77
          RS+LNDKWDVVLSNM+VK+G+GFGVGVVTSVL F+RR+FPVWLG+GFG GRGYSEGDAIF
Sbjct: 24 RSLLNDKWDVVLSNMLVKVGMGFGVGVVTSVLLFRRRAFPVWLGIGFGVGRGYSEGDAIF 83

Query: 78 RSTAGLRSVKV 88
          RST+G+R+VKV
Sbjct: 84 RSTSGIRTVKV 94

>KAFR0D00170 Chr4 complement(18220..18492) [273 bp, 90 aa] {ON}
          Anc_1.8 YCL057C-A
          Length = 90

 Score =  103 bits (257), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 62/89 (69%), Positives = 76/89 (85%), Gaps = 3/89 (3%)

Query: 3  NKEETKAKTVDYTPV---RSILNDKWDVVLSNMIVKMGLGFGVGVVTSVLFFKRRSFPVW 59
          ++E+   K  +Y+     RSILNDKWD+VLSNM+VK+GLGFGVGVVTSV+FFKRR+FPVW
Sbjct: 2  SEEDKVGKPAEYSNNSIDRSILNDKWDLVLSNMLVKVGLGFGVGVVTSVIFFKRRAFPVW 61

Query: 60 LGVGFGAGRGYSEGDAIFRSTAGLRSVKV 88
          LG+G+G GR YSEGDAIFRS AGLRSV++
Sbjct: 62 LGIGYGFGRAYSEGDAIFRSNAGLRSVQI 90

>SAKL0C10230g Chr3 (920651..923566) [2916 bp, 971 aa] {ON} similar
           to uniprot|Q12252 Saccharomyces cerevisiae YOL084W PHM7
           Protein of unknown function expression is regulated by
           phosphate levels green fluorescent protein (GFP)-fusion
           protein localizes to the cell periphery and vacuole
          Length = 971

 Score = 31.6 bits (70), Expect = 0.19,   Method: Composition-based stats.
 Identities = 20/51 (39%), Positives = 27/51 (52%), Gaps = 4/51 (7%)

Query: 40  FGVGVVTSVLFFKRRSFPVWLGVGFGAGRGYSEGDAIFRSTA---GLRSVK 87
           F  G V + L+FKRR  P++  V   A R Y+ G+  F   A   GLR +K
Sbjct: 677 FLAGTVAAHLYFKRRFIPLFDAVPLSAIR-YARGEPTFLYPARDQGLREIK 726

>TDEL0F04730 Chr6 (889641..891725) [2085 bp, 694 aa] {ON} Anc_8.349
           YLR143W
          Length = 694

 Score = 30.4 bits (67), Expect = 0.40,   Method: Composition-based stats.
 Identities = 11/28 (39%), Positives = 19/28 (67%)

Query: 5   EETKAKTVDYTPVRSILNDKWDVVLSNM 32
           E+ + K +D  PV  +LNDKW  +L+++
Sbjct: 261 EDDRKKQLDALPVPPLLNDKWSALLNSL 288

>TPHA0B02510 Chr2 complement(573028..577131) [4104 bp, 1367 aa] {ON}
           Anc_5.259 YJL042W
          Length = 1367

 Score = 28.5 bits (62), Expect = 1.8,   Method: Composition-based stats.
 Identities = 11/23 (47%), Positives = 17/23 (73%)

Query: 2   SNKEETKAKTVDYTPVRSILNDK 24
           SNKE+  AK++ +TPV +I  +K
Sbjct: 126 SNKEQDDAKSISFTPVDNITTNK 148

>Smik_15.231 Chr15 complement(394040..396001) [1962 bp, 653 aa] {ON}
           YOR054C (REAL)
          Length = 653

 Score = 27.7 bits (60), Expect = 3.8,   Method: Composition-based stats.
 Identities = 17/58 (29%), Positives = 29/58 (50%), Gaps = 6/58 (10%)

Query: 16  PVRSILNDKWDVVL------SNMIVKMGLGFGVGVVTSVLFFKRRSFPVWLGVGFGAG 67
           PV  I   +W  +L      +N + K+ LG    ++TSV+     +FP++L    G+G
Sbjct: 457 PVLHIELRRWADILVVAPLTANTLAKIALGLCDNLLTSVIRAWNPTFPIFLAPSMGSG 514

>YOR054C Chr15 complement(427833..429857) [2025 bp, 674 aa] {ON}
           VHS3Negative regulatory subunit of protein phosphatase 1
           Ppz1p and also a subunit of the
           phosphopantothenoylcysteine decarboxylase (PPCDC; Cab3p,
           Sis2p, Vhs3p) complex, which catalyzes the third step of
           coenzyme A biosynthesis
          Length = 674

 Score = 27.3 bits (59), Expect = 5.1,   Method: Composition-based stats.
 Identities = 17/58 (29%), Positives = 29/58 (50%), Gaps = 6/58 (10%)

Query: 16  PVRSILNDKWDVVL------SNMIVKMGLGFGVGVVTSVLFFKRRSFPVWLGVGFGAG 67
           PV  I   +W  +L      +N + K+ LG    ++TSV+     +FP++L    G+G
Sbjct: 456 PVLHIELRRWADILVVAPLTANTLAKIALGLCDNLLTSVIRAWNPTFPIFLAPSMGSG 513

>TDEL0E00180 Chr5 complement(21188..22759) [1572 bp, 523 aa] {ON}
          Length = 523

 Score = 26.9 bits (58), Expect = 6.1,   Method: Composition-based stats.
 Identities = 15/40 (37%), Positives = 23/40 (57%), Gaps = 5/40 (12%)

Query: 1   MSNKEETKA-----KTVDYTPVRSILNDKWDVVLSNMIVK 35
           +SNK+ET       + V+ T   ++L  K+DVVL  +I K
Sbjct: 257 VSNKQETAPTNYNLRVVEVTVAANVLAAKYDVVLKKLIAK 296

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.138    0.412 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 8,416,720
Number of extensions: 278580
Number of successful extensions: 715
Number of sequences better than 10.0: 26
Number of HSP's gapped: 715
Number of HSP's successfully gapped: 26
Length of query: 88
Length of database: 53,481,399
Length adjustment: 60
Effective length of query: 28
Effective length of database: 46,601,439
Effective search space: 1304840292
Effective search space used: 1304840292
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 59 (27.3 bits)