Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
CAGL0B00374g1.7ON121934735e-62
Suva_3.1541.7ON113891695e-16
Smik_3.161.7ON113911671e-15
YCL058W-A (ADF1)1.7ON113911549e-14
Skud_3.51.7ON113911532e-13
KAFR0D001601.7ON111931322e-10
SAKL0C00506g1.7ON105891279e-10
Kpol_2002.101.7ON111911173e-08
NCAS0B090901.7ON119911166e-08
NDAI0A001601.7ON123951089e-07
TPHA0E039901.7ON116921043e-06
KNAG0C002401.7ON126951035e-06
TBLA0A049501.7ON113931017e-06
Kwal_YGOB_YCL058W-A1.7ON10570939e-05
Kwal_33.13015singletonOFF10570939e-05
TDEL0C069501.7ON11189912e-04
KLTH0F00528g1.7ON10466893e-04
ZYRO0F18436g1.7ON11238710.16
KAFR0A022402.582ON104146661.6
CAGL0F05533g8.405ON37338607.7
ADL033W4.50ON191653617.7
NCAS0E025207.406ON77544609.8
NOTE: 2 genes in the same pillar as CAGL0B00374g were not hit in these BLAST results
LIST: AFR743CA KLLA0C00528g

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0B00374g
         (121 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0B00374g Chr2 (23693..24058) [366 bp, 121 aa] {ON} similar t...   186   5e-62
Suva_3.154 Chr3 (233345..233686) [342 bp, 113 aa] {ON} YCL058W-A...    70   5e-16
Smik_3.16 Chr3 (25034..25375) [342 bp, 113 aa] {ON} YCL058W-A (R...    69   1e-15
YCL058W-A Chr3 (23584..23925) [342 bp, 113 aa] {ON}  ADF1Transcr...    64   9e-14
Skud_3.5 Chr3 (11576..11917) [342 bp, 113 aa] {ON} YCL058W-A (REAL)    64   2e-13
KAFR0D00160 Chr4 (17823..18158) [336 bp, 111 aa] {ON} Anc_1.7 YC...    55   2e-10
SAKL0C00506g Chr3 (46439..46756) [318 bp, 105 aa] {ON} weakly si...    54   9e-10
Kpol_2002.10 s2002 (19162..19497) [336 bp, 111 aa] {ON} (19162.....    50   3e-08
NCAS0B09090 Chr2 complement(1744560..1744919) [360 bp, 119 aa] {...    49   6e-08
NDAI0A00160 Chr1 (13398..13769) [372 bp, 123 aa] {ON} Anc_1.7 YC...    46   9e-07
TPHA0E03990 Chr5 complement(837690..838040) [351 bp, 116 aa] {ON...    45   3e-06
KNAG0C00240 Chr3 (38093..38473) [381 bp, 126 aa] {ON} Anc_1.7 YC...    44   5e-06
TBLA0A04950 Chr1 (1219399..1219740) [342 bp, 113 aa] {ON} Anc_1....    44   7e-06
Kwal_YGOB_YCL058W-A s33 (41330..41647) [318 bp, 105 aa] {ON} ANN...    40   9e-05
Kwal_33.13015 s33 (41330..41647) [318 bp, 105 aa] {OFF} [contig ...    40   9e-05
TDEL0C06950 Chr3 complement(1262284..1262619) [336 bp, 111 aa] {...    40   2e-04
KLTH0F00528g Chr6 (41595..41909) [315 bp, 104 aa] {ON} conserved...    39   3e-04
ZYRO0F18436g Chr6 complement(1522314..1522652) [339 bp, 112 aa] ...    32   0.16 
KAFR0A02240 Chr1 complement(464734..467859) [3126 bp, 1041 aa] {...    30   1.6  
CAGL0F05533g Chr6 complement(557208..558329) [1122 bp, 373 aa] {...    28   7.7  
ADL033W Chr4 (636322..642072) [5751 bp, 1916 aa] {ON} Syntenic h...    28   7.7  
NCAS0E02520 Chr5 (499683..502010) [2328 bp, 775 aa] {ON} Anc_7.4...    28   9.8  

>CAGL0B00374g Chr2 (23693..24058) [366 bp, 121 aa] {ON} similar to
           CA0039|IPF3998 Candida albicans and KLLA0C00528g
           Kluyveromyces lactis
          Length = 121

 Score =  186 bits (473), Expect = 5e-62,   Method: Compositional matrix adjust.
 Identities = 93/93 (100%), Positives = 93/93 (100%)

Query: 29  GVNKISASERKKSKILTARLNKDADVAELKIIQELNDNKIAEEPKKRQTALDMNCLVKDQ 88
           GVNKISASERKKSKILTARLNKDADVAELKIIQELNDNKIAEEPKKRQTALDMNCLVKDQ
Sbjct: 29  GVNKISASERKKSKILTARLNKDADVAELKIIQELNDNKIAEEPKKRQTALDMNCLVKDQ 88

Query: 89  KRDKKVREHIEKINSETNSDMLKQLELMSGFSL 121
           KRDKKVREHIEKINSETNSDMLKQLELMSGFSL
Sbjct: 89  KRDKKVREHIEKINSETNSDMLKQLELMSGFSL 121

>Suva_3.154 Chr3 (233345..233686) [342 bp, 113 aa] {ON} YCL058W-A
           (REAL)
          Length = 113

 Score = 69.7 bits (169), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 40/89 (44%), Positives = 59/89 (66%), Gaps = 2/89 (2%)

Query: 33  ISASERKKSKILTARLNKDADVAELKIIQELNDNKIAEEPKKRQTALDMNCLVKDQKRDK 92
           IS +E K++K+   RLNK ++     +++E +   +  + KK ++ L+   LVKDQ RD 
Sbjct: 27  ISTAEMKRTKLQVERLNKSSETMIPTLLKEASKQDL--DKKKTRSTLEAEELVKDQARDS 84

Query: 93  KVREHIEKINSETNSDMLKQLELMSGFSL 121
           KVREHIE   S+TN  MLKQ+E++SGFSL
Sbjct: 85  KVREHIETEKSKTNDSMLKQIEMISGFSL 113

>Smik_3.16 Chr3 (25034..25375) [342 bp, 113 aa] {ON} YCL058W-A
           (REAL)
          Length = 113

 Score = 68.9 bits (167), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 39/91 (42%), Positives = 62/91 (68%), Gaps = 6/91 (6%)

Query: 33  ISASERKKSKILTARLNKDADVAELKIIQELNDNKIAEEPKKRQT--ALDMNCLVKDQKR 90
           IS + +K++K+   +LNK +++    +++E      A+EP KR+T   L    L+KDQ++
Sbjct: 27  ISTAVKKRTKLQVEKLNKSSEMMIPTLLRETG----AQEPAKRKTESTLKAGDLIKDQEK 82

Query: 91  DKKVREHIEKINSETNSDMLKQLELMSGFSL 121
           D KVREHI+   S+TN +MLKQ+E++SGFSL
Sbjct: 83  DSKVREHIQMEKSKTNDNMLKQIEMISGFSL 113

>YCL058W-A Chr3 (23584..23925) [342 bp, 113 aa] {ON}
           ADF1Transcriptional repressor encoded by the antisense
           strand of the FYV5 gene; negatively regulates
           transcription of FYV5 by binding to the promoter on the
           sense strand
          Length = 113

 Score = 63.9 bits (154), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 38/91 (41%), Positives = 58/91 (63%), Gaps = 6/91 (6%)

Query: 33  ISASERKKSKILTARLNKDADVAELKIIQELNDNKIAEEPKK--RQTALDMNCLVKDQKR 90
           IS +ERK++K+   +LNK ++     +++E +     +EP K   +T L    L+KDQ++
Sbjct: 27  ISTAERKRTKLQVEKLNKSSETMIPTLLREAS----TQEPAKLKAETTLKAEELIKDQEK 82

Query: 91  DKKVREHIEKINSETNSDMLKQLELMSGFSL 121
           D KVRE I    S+TN  MLKQ+E++SGFSL
Sbjct: 83  DSKVREQIRTEKSKTNDSMLKQIEMISGFSL 113

>Skud_3.5 Chr3 (11576..11917) [342 bp, 113 aa] {ON} YCL058W-A (REAL)
          Length = 113

 Score = 63.5 bits (153), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 38/91 (41%), Positives = 58/91 (63%), Gaps = 6/91 (6%)

Query: 33  ISASERKKSKILTARLNKDADVAELKIIQELNDNKIAEEPKKRQ--TALDMNCLVKDQKR 90
           IS +ERK++K+   +LNK +++    +I  L      +EP K++  + L    LVKDQ +
Sbjct: 27  ISTAERKRTKLQVEKLNKSSEI----MIPTLLRETATQEPTKKRAKSTLKAEELVKDQAK 82

Query: 91  DKKVREHIEKINSETNSDMLKQLELMSGFSL 121
           D KVRE I+   S+TN  ML+Q+E++SGFSL
Sbjct: 83  DCKVREQIQTEKSKTNDSMLEQIEMISGFSL 113

>KAFR0D00160 Chr4 (17823..18158) [336 bp, 111 aa] {ON} Anc_1.7
           YCL058W-A
          Length = 111

 Score = 55.5 bits (132), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 38/93 (40%), Positives = 56/93 (60%), Gaps = 6/93 (6%)

Query: 31  NKISASERKKSKILTARLNKDADVAELKIIQELNDN--KIAEEPKKRQTALDMNCLVKDQ 88
           N IS SERKK+K++  + N+      +  +QELN +  K      K + AL+   L+ DQ
Sbjct: 23  NVISQSERKKNKLIVEKFNQQT----ITNVQELNKDLKKDKRRLSKTKNALETKKLLHDQ 78

Query: 89  KRDKKVREHIEKINSETNSDMLKQLELMSGFSL 121
            RD +V+++IE    ET   MLKQ+E++SGFSL
Sbjct: 79  ARDHEVKQNIETKLKETEDSMLKQIEMISGFSL 111

>SAKL0C00506g Chr3 (46439..46756) [318 bp, 105 aa] {ON} weakly
           similar to uniprot|Q2V2Q1 Saccharomyces cerevisiae
           YCL058W-A
          Length = 105

 Score = 53.5 bits (127), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 33/89 (37%), Positives = 51/89 (57%), Gaps = 4/89 (4%)

Query: 33  ISASERKKSKILTARLNKDADVAELKIIQELNDNKIAEEPKKRQTALDMNCLVKDQKRDK 92
           I  S++K+++I   +LNK   +     +      K  E+PK     L    L +DQK+DK
Sbjct: 21  IKKSQKKRTRIQVEQLNKQEFLLSDLNMTNAGSTKTKEKPK----TLQAKALAQDQKKDK 76

Query: 93  KVREHIEKINSETNSDMLKQLELMSGFSL 121
           + R+ +EK   +TN +ML QLE++SGFSL
Sbjct: 77  ETRDKLEKQRKDTNDNMLAQLEMISGFSL 105

>Kpol_2002.10 s2002 (19162..19497) [336 bp, 111 aa] {ON}
           (19162..19497) [336 nt, 112 aa]
          Length = 111

 Score = 49.7 bits (117), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 33/91 (36%), Positives = 54/91 (59%), Gaps = 1/91 (1%)

Query: 31  NKISASERKKSKILTARLNKDADVAELKIIQELNDNKIAEEPKKRQTALDMNCLVKDQKR 90
           N IS SE+K++KI   ++NK+  +    I+Q  N+ +  +    ++ AL+   L +D  +
Sbjct: 22  NVISQSEKKRNKIKMEKINKEG-ILPSDILQLNNETRNGQSEGNKERALESQKLQQDNVK 80

Query: 91  DKKVREHIEKINSETNSDMLKQLELMSGFSL 121
           D++    IE    ET+  MLKQ+ELM+GFSL
Sbjct: 81  DRETIAKIEASKKETDDSMLKQIELMTGFSL 111

>NCAS0B09090 Chr2 complement(1744560..1744919) [360 bp, 119 aa] {ON}
           Anc_1.7 YCL058W-A
          Length = 119

 Score = 49.3 bits (116), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 28/91 (30%), Positives = 54/91 (59%)

Query: 31  NKISASERKKSKILTARLNKDADVAELKIIQELNDNKIAEEPKKRQTALDMNCLVKDQKR 90
           N IS S+RKK+K    +LNK  ++  + ++       ++++P+  ++ L    L++DQK+
Sbjct: 29  NSISFSDRKKAKHQVEKLNKKENLLPMNVLDLQKKKNLSKKPEPLKSILHARSLLQDQKK 88

Query: 91  DKKVREHIEKINSETNSDMLKQLELMSGFSL 121
           DK++R  I      T+  + KQ+E++SGF+ 
Sbjct: 89  DKEIRNKIRAEQKATDDSIEKQIEMISGFTF 119

>NDAI0A00160 Chr1 (13398..13769) [372 bp, 123 aa] {ON} Anc_1.7
           YCL058W-A
          Length = 123

 Score = 46.2 bits (108), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 32/95 (33%), Positives = 56/95 (58%), Gaps = 5/95 (5%)

Query: 31  NKISASERKKSKILTARLNKDA----DVAELKIIQELNDNKIAEEPKKRQTALDMNCLVK 86
           N I  S+RKK+KI  A  NK++    +V+EL   Q ++  K  ++  ++ ++L  + L+ 
Sbjct: 30  NVIKQSDRKKNKIKVAMFNKESSLHMNVSELNS-QSMSPIKQKQDSLRKGSSLSAHDLLN 88

Query: 87  DQKRDKKVREHIEKINSETNSDMLKQLELMSGFSL 121
           DQK+D +    I+    + N DML+Q+E++SGF  
Sbjct: 89  DQKKDIEANNRIQTEKKQVNDDMLRQIEMISGFKF 123

>TPHA0E03990 Chr5 complement(837690..838040) [351 bp, 116 aa] {ON}
           Anc_1.7 YCL058W-A
          Length = 116

 Score = 44.7 bits (104), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 31/92 (33%), Positives = 55/92 (59%), Gaps = 6/92 (6%)

Query: 32  KISASERKKSKILTARLNKDADVA--ELKIIQELNDNKIAEEPKKRQTALDMNCLVKDQK 89
           K+S+  RK +K    +LNK   ++  ++  +  LN     ++ +K+ + L+   L KD  
Sbjct: 29  KLSSQVRKSTKHKVEKLNKLEVISSDDINALNALN----GKKREKQTSVLEAKTLAKDNL 84

Query: 90  RDKKVREHIEKINSETNSDMLKQLELMSGFSL 121
           +D+++ E IE    ETN+ +L+Q+E+MSGFSL
Sbjct: 85  KDRQLIEKIESKKKETNASLLQQIEMMSGFSL 116

>KNAG0C00240 Chr3 (38093..38473) [381 bp, 126 aa] {ON} Anc_1.7
           YCL058W-A
          Length = 126

 Score = 44.3 bits (103), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 26/95 (27%), Positives = 56/95 (58%), Gaps = 6/95 (6%)

Query: 33  ISASERKKSKILTARLNK------DADVAELKIIQELNDNKIAEEPKKRQTALDMNCLVK 86
           I  SERK++K+   +LN+      + +  +++   + ++ ++  + +    +LD+  L +
Sbjct: 32  IPLSERKRNKLQVEKLNRPTNGMIEGNAVDIRNEIDKHNQEVEGQNRTVHRSLDVEKLAQ 91

Query: 87  DQKRDKKVREHIEKINSETNSDMLKQLELMSGFSL 121
           D+ +D+ ++E + K   ET+  ML Q+E++SGFSL
Sbjct: 92  DKSKDRIIQEQVAKKQKETDQSMLAQIEMISGFSL 126

>TBLA0A04950 Chr1 (1219399..1219740) [342 bp, 113 aa] {ON} Anc_1.7
           YCL058W-A
          Length = 113

 Score = 43.5 bits (101), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 30/93 (32%), Positives = 56/93 (60%), Gaps = 6/93 (6%)

Query: 30  VNKISASERKKSKILTARLNK-DADVAELKIIQELNDNKIAEEPKKRQTALDMNCLVKDQ 88
            NKIS  ++K++K+   ++NK D+ ++++     +N N  ++E  K    L    L KDQ
Sbjct: 26  ANKISVGDKKRAKLQVEKMNKQDSLLSDI-----INLNGKSKELAKNVNTLSSKQLKKDQ 80

Query: 89  KRDKKVREHIEKINSETNSDMLKQLELMSGFSL 121
           ++D+ +   I+    +TN D++ Q+E++SGFSL
Sbjct: 81  EKDRLLNVEIKNKKKQTNDDLIAQIEMISGFSL 113

>Kwal_YGOB_YCL058W-A s33 (41330..41647) [318 bp, 105 aa] {ON}
           ANNOTATED BY YGOB -
          Length = 105

 Score = 40.4 bits (93), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 43/70 (61%), Gaps = 8/70 (11%)

Query: 56  ELKIIQELNDNKIAEEPKKRQTA----LDMNCLVKDQKRDKKVREHIEKINSETNSDMLK 111
           E+ +I ELN      E  KRQ++    L  + LVKD K+D+  ++ +E     T+ ++L+
Sbjct: 40  EVFLISELN----KREDTKRQSSPLESLKPSRLVKDIKKDQNAQKQLESQRKATDENVLR 95

Query: 112 QLELMSGFSL 121
           QLEL+SGFSL
Sbjct: 96  QLELISGFSL 105

>Kwal_33.13015 s33 (41330..41647) [318 bp, 105 aa] {OFF} [contig
           123] FULL
          Length = 105

 Score = 40.4 bits (93), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 43/70 (61%), Gaps = 8/70 (11%)

Query: 56  ELKIIQELNDNKIAEEPKKRQTA----LDMNCLVKDQKRDKKVREHIEKINSETNSDMLK 111
           E+ +I ELN      E  KRQ++    L  + LVKD K+D+  ++ +E     T+ ++L+
Sbjct: 40  EVFLISELN----KREDTKRQSSPLESLKPSRLVKDIKKDQNAQKQLESQRKATDENVLR 95

Query: 112 QLELMSGFSL 121
           QLEL+SGFSL
Sbjct: 96  QLELISGFSL 105

>TDEL0C06950 Chr3 complement(1262284..1262619) [336 bp, 111 aa] {ON}
           Anc_1.7 YCL058W-A
          Length = 111

 Score = 39.7 bits (91), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 30/89 (33%), Positives = 49/89 (55%), Gaps = 2/89 (2%)

Query: 33  ISASERKKSKILTARLNKDADVAELKIIQELNDNKIAEEPKKRQTALDMNCLVKDQKRDK 92
           IS  + KK+K     LN+D   A L  I +LN +   +   ++   L+   L KD ++D+
Sbjct: 25  ISRRDVKKTKFRVENLNRD--TASLSEIIKLNASTAVKGSARKANTLENRTLQKDWQKDQ 82

Query: 93  KVREHIEKINSETNSDMLKQLELMSGFSL 121
           K+RE  +    E  +++ KQ+E +SGFSL
Sbjct: 83  KIREKSKAEKEEMANNLEKQIEDISGFSL 111

>KLTH0F00528g Chr6 (41595..41909) [315 bp, 104 aa] {ON} conserved
           hypothetical protein
          Length = 104

 Score = 38.9 bits (89), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 46/66 (69%), Gaps = 6/66 (9%)

Query: 59  IIQELNDNKIAEEPKKRQTALD---MNCLVKDQKRDKKVREHIEKINSETNSDMLKQLEL 115
           +I ELN+    E   KR  AL+   ++ L++D+++DK +++ +E+    T++++++QLEL
Sbjct: 42  LISELNER---EHNTKRTPALESLKVSDLIEDREKDKSMQKKMEEQKQSTDNNIIEQLEL 98

Query: 116 MSGFSL 121
           +SGFSL
Sbjct: 99  ISGFSL 104

>ZYRO0F18436g Chr6 complement(1522314..1522652) [339 bp, 112 aa]
           {ON} similar to uniprot|Q2V2Q1 Saccharomyces cerevisiae
           YCL058W-A
          Length = 112

 Score = 32.0 bits (71), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 27/38 (71%)

Query: 84  LVKDQKRDKKVREHIEKINSETNSDMLKQLELMSGFSL 121
           L +D+K D+  R+       ET++++L+Q+E++SGFSL
Sbjct: 75  LEQDRKMDQDTRDKANAKKKETDNNILQQIEMISGFSL 112

>KAFR0A02240 Chr1 complement(464734..467859) [3126 bp, 1041 aa] {ON}
           Anc_2.582 YKL057C
          Length = 1041

 Score = 30.0 bits (66), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 25/46 (54%), Gaps = 6/46 (13%)

Query: 81  MNCLVKDQKRDKKVREHIE------KINSETNSDMLKQLELMSGFS 120
           +NCL K      KV   +E       INS T+ +M K L+L++GF+
Sbjct: 477 VNCLTKYNHFLYKVNSTLENYFFNIHINSSTDEEMAKYLKLLNGFA 522

>CAGL0F05533g Chr6 complement(557208..558329) [1122 bp, 373 aa] {ON}
           weakly similar to uniprot|P14905 Saccharomyces
           cerevisiae YDR197w CBS2 cytochrome B translational
           activator protein
          Length = 373

 Score = 27.7 bits (60), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 25/38 (65%)

Query: 84  LVKDQKRDKKVREHIEKINSETNSDMLKQLELMSGFSL 121
           L+ DQ + K+   H  +I+   +S ML +L+LM+G+S+
Sbjct: 37  LMVDQLKLKRFMNHESQISLYRSSLMLDRLQLMAGYSV 74

>ADL033W Chr4 (636322..642072) [5751 bp, 1916 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR305C (STT4)
          Length = 1916

 Score = 28.1 bits (61), Expect = 7.7,   Method: Composition-based stats.
 Identities = 16/53 (30%), Positives = 29/53 (54%), Gaps = 3/53 (5%)

Query: 56  ELKIIQELNDNKIAEE--PKKRQTALDMNCLVKDQKRDKKVREHIEKINSETN 106
           EL+II   N   +A +     R+T++DMN +++    +  V+E   ++NS  N
Sbjct: 743 ELRIIA-YNSPPLASDFPANNRETSVDMNTILRRGSSNHNVKEQKNRLNSHLN 794

>NCAS0E02520 Chr5 (499683..502010) [2328 bp, 775 aa] {ON} Anc_7.406
           YER109C
          Length = 775

 Score = 27.7 bits (60), Expect = 9.8,   Method: Composition-based stats.
 Identities = 17/44 (38%), Positives = 24/44 (54%), Gaps = 1/44 (2%)

Query: 39  KKSKILTARLNKDADVAELKII-QELNDNKIAEEPKKRQTALDM 81
           K SK  TA+  KD+     KII Q++N+N   +EPK      D+
Sbjct: 506 KVSKRQTAKKTKDSKTTSKKIIQQQINNNSSVKEPKSDTITPDL 549

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.309    0.126    0.320 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 9,307,699
Number of extensions: 368843
Number of successful extensions: 2345
Number of sequences better than 10.0: 148
Number of HSP's gapped: 2331
Number of HSP's successfully gapped: 148
Length of query: 121
Length of database: 53,481,399
Length adjustment: 90
Effective length of query: 31
Effective length of database: 43,161,459
Effective search space: 1338005229
Effective search space used: 1338005229
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 59 (27.3 bits)