Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
CAGL0B00352g1.6ON33732415920.0
KNAG0C002301.6ON34931014240.0
NCAS0B091001.6ON32731014160.0
SAKL0C00484g1.6ON33931114110.0
NDAI0A001501.6ON31731014010.0
Kpol_2002.91.6ON33831014020.0
TPHA0E040001.6ON31631013880.0
KLLA0C00506g1.6ON33031013870.0
Ecym_10091.6ON33631013860.0
Kwal_33.130111.6ON33431113820.0
YCL059C (KRR1)1.6ON31631113760.0
Smik_3.151.6ON31631113760.0
Skud_3.41.6ON31631113640.0
Suva_3.1531.6ON31631113630.0
ZYRO0F18458g1.6ON31431013500.0
TDEL0C069601.6ON35031013480.0
KLTH0F00506g1.6ON33231113280.0
AFR744W1.6ON34331013170.0
TBLA0A049401.6ON31631012980.0
KAFR0D001501.6ON34430812831e-178
SAKL0G03740g5.482ON266155970.001
ZYRO0D11440g5.482ON269155970.001
Suva_8.1975.482ON274157970.001
TDEL0A034605.482ON272155960.001
Ecym_45525.482ON271155950.002
Kwal_47.188645.482ON271155950.002
Kpol_543.135.482ON268155940.002
KLTH0G02574g5.482ON271155940.003
CAGL0K09460g5.482ON261155930.004
AAR002W1.420ON178163910.004
Skud_15.3105.482ON276157920.005
NCAS0A119605.482ON270155910.005
YOR145C (PNO1)5.482ON274157910.007
Smik_15.3265.482ON274157900.009
KLLA0C06446g5.482ON274155900.009
TPHA0J028205.482ON268155890.010
NDAI0A043105.482ON274182890.011
KAFR0E036005.482ON276155890.012
TBLA0D018905.482ON271172880.015
KNAG0C046105.482ON277182880.016
TBLA0H018305.375ON40664750.68
KAFR0B030308.309ON46724693.8
AGL183C8.309ON50724694.1
NCAS0A104003.244ON38481676.2
ZYRO0E04356g1.420ON186104657.8
KNAG0G023508.309ON49724677.9
Suva_10.5404.301ON71378668.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0B00352g
         (337 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0B00352g Chr2 complement(22171..23184) [1014 bp, 337 aa] {ON...   617   0.0  
KNAG0C00230 Chr3 complement(36795..37844) [1050 bp, 349 aa] {ON}...   553   0.0  
NCAS0B09100 Chr2 (1745144..1746127) [984 bp, 327 aa] {ON} Anc_1....   550   0.0  
SAKL0C00484g Chr3 complement(45059..46078) [1020 bp, 339 aa] {ON...   548   0.0  
NDAI0A00150 Chr1 complement(12040..12993) [954 bp, 317 aa] {ON} ...   544   0.0  
Kpol_2002.9 s2002 complement(17681..18697) [1017 bp, 338 aa] {ON...   544   0.0  
TPHA0E04000 Chr5 (838446..839396) [951 bp, 316 aa] {ON} Anc_1.6 ...   539   0.0  
KLLA0C00506g Chr3 complement(38584..39576) [993 bp, 330 aa] {ON}...   538   0.0  
Ecym_1009 Chr1 complement(16963..17973) [1011 bp, 336 aa] {ON} s...   538   0.0  
Kwal_33.13011 s33 complement(39946..40950) [1005 bp, 334 aa] {ON...   536   0.0  
YCL059C Chr3 complement(22429..23379) [951 bp, 316 aa] {ON}  KRR...   534   0.0  
Smik_3.15 Chr3 complement(23880..24830) [951 bp, 316 aa] {ON} YC...   534   0.0  
Skud_3.4 Chr3 complement(10422..11372) [951 bp, 316 aa] {ON} YCL...   530   0.0  
Suva_3.153 Chr3 complement(232200..233150) [951 bp, 316 aa] {ON}...   529   0.0  
ZYRO0F18458g Chr6 (1522841..1523785) [945 bp, 314 aa] {ON} highl...   524   0.0  
TDEL0C06960 Chr3 (1262869..1263921) [1053 bp, 350 aa] {ON} Anc_1...   523   0.0  
KLTH0F00506g Chr6 complement(40222..41220) [999 bp, 332 aa] {ON}...   516   0.0  
AFR744W Chr6 (1801815..1802846) [1032 bp, 343 aa] {ON} Syntenic ...   511   0.0  
TBLA0A04940 Chr1 complement(1218143..1219093) [951 bp, 316 aa] {...   504   0.0  
KAFR0D00150 Chr4 complement(16573..17607) [1035 bp, 344 aa] {ON}...   498   e-178
SAKL0G03740g Chr7 complement(309922..310722) [801 bp, 266 aa] {O...    42   0.001
ZYRO0D11440g Chr4 complement(964606..965415) [810 bp, 269 aa] {O...    42   0.001
Suva_8.197 Chr8 complement(354586..355410) [825 bp, 274 aa] {ON}...    42   0.001
TDEL0A03460 Chr1 complement(617779..618597) [819 bp, 272 aa] {ON...    42   0.001
Ecym_4552 Chr4 (1087732..1088547) [816 bp, 271 aa] {ON} similar ...    41   0.002
Kwal_47.18864 s47 (1004428..1005243) [816 bp, 271 aa] {ON} YOR14...    41   0.002
Kpol_543.13 s543 complement(30976..31782) [807 bp, 268 aa] {ON} ...    41   0.002
KLTH0G02574g Chr7 complement(201390..202205) [816 bp, 271 aa] {O...    41   0.003
CAGL0K09460g Chr11 complement(935326..936111) [786 bp, 261 aa] {...    40   0.004
AAR002W Chr1 (341790..342326) [537 bp, 178 aa] {ON} Syntenic hom...    40   0.004
Skud_15.310 Chr15 complement(554002..554832) [831 bp, 276 aa] {O...    40   0.005
NCAS0A11960 Chr1 complement(2371549..2372361) [813 bp, 270 aa] {...    40   0.005
YOR145C Chr15 complement(605347..606171) [825 bp, 274 aa] {ON}  ...    40   0.007
Smik_15.326 Chr15 complement(561176..562000) [825 bp, 274 aa] {O...    39   0.009
KLLA0C06446g Chr3 complement(566371..567195) [825 bp, 274 aa] {O...    39   0.009
TPHA0J02820 Chr10 complement(627383..628189) [807 bp, 268 aa] {O...    39   0.010
NDAI0A04310 Chr1 (970952..971776) [825 bp, 274 aa] {ON} Anc_5.48...    39   0.011
KAFR0E03600 Chr5 (724338..725168) [831 bp, 276 aa] {ON} Anc_5.48...    39   0.012
TBLA0D01890 Chr4 (461527..462342) [816 bp, 271 aa] {ON} Anc_5.48...    39   0.015
KNAG0C04610 Chr3 (905301..906134) [834 bp, 277 aa] {ON} Anc_5.48...    39   0.016
TBLA0H01830 Chr8 complement(433992..435212) [1221 bp, 406 aa] {O...    33   0.68 
KAFR0B03030 Chr2 (632585..633988) [1404 bp, 467 aa] {ON} Anc_8.3...    31   3.8  
AGL183C Chr7 complement(352996..354519) [1524 bp, 507 aa] {ON} S...    31   4.1  
NCAS0A10400 Chr1 complement(2069371..2070525) [1155 bp, 384 aa] ...    30   6.2  
ZYRO0E04356g Chr5 complement(332059..332619) [561 bp, 186 aa] {O...    30   7.8  
KNAG0G02350 Chr7 (542717..544210) [1494 bp, 497 aa] {ON} Anc_8.3...    30   7.9  
Suva_10.540 Chr10 (933675..935816) [2142 bp, 713 aa] {ON} YLR424...    30   8.9  

>CAGL0B00352g Chr2 complement(22171..23184) [1014 bp, 337 aa] {ON}
           highly similar to uniprot|P25586 Saccharomyces
           cerevisiae YCL059c KRR1
          Length = 337

 Score =  617 bits (1592), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/324 (92%), Positives = 301/324 (92%)

Query: 1   MVSTYNKDKPWDTEDIDKWKIEEFKPEDNKSGQPFAEESSFMTLFPKYREAYLKSIWNDV 60
           MVSTYNKDKPWDTEDIDKWKIEEFKPEDNKSGQPFAEESSFMTLFPKYREAYLKSIWNDV
Sbjct: 1   MVSTYNKDKPWDTEDIDKWKIEEFKPEDNKSGQPFAEESSFMTLFPKYREAYLKSIWNDV 60

Query: 61  TRALDKHHIGCTLDLVEGSMTVKTTRKTFDPAIILKARDLIKLLARSVPFPQAVKILQDD 120
           TRALDKHHIGCTLDLVEGSMTVKTTRKTFDPAIILKARDLIKLLARSVPFPQAVKILQDD
Sbjct: 61  TRALDKHHIGCTLDLVEGSMTVKTTRKTFDPAIILKARDLIKLLARSVPFPQAVKILQDD 120

Query: 121 IACDVIKIGNTVANKDRFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPYKGL 180
           IACDVIKIGNTVANKDRFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPYKGL
Sbjct: 121 IACDVIKIGNTVANKDRFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPYKGL 180

Query: 181 KEIRRVVLDCMKNVHPIYHIKELMIKRELAKRPELANEDWSRFLPMFKKRNVARXXXXXX 240
           KEIRRVVLDCMKNVHPIYHIKELMIKRELAKRPELANEDWSRFLPMFKKRNVAR      
Sbjct: 181 KEIRRVVLDCMKNVHPIYHIKELMIKRELAKRPELANEDWSRFLPMFKKRNVARKKPSKV 240

Query: 241 XXXXXVYTPFPPAQLPRKVDLQIESGEYFLSKKEKEIKKLHEQREKQAEKQILKDEERRK 300
                VYTPFPPAQLPRKVDLQIESGEYFLSKKEKEIKKLHEQREKQAEKQILKDEERRK
Sbjct: 241 KAEKKVYTPFPPAQLPRKVDLQIESGEYFLSKKEKEIKKLHEQREKQAEKQILKDEERRK 300

Query: 301 DYIAPKEDEYXXXXXXXXXXXXNE 324
           DYIAPKEDEY            NE
Sbjct: 301 DYIAPKEDEYKSSHKSTKKRTSNE 324

>KNAG0C00230 Chr3 complement(36795..37844) [1050 bp, 349 aa] {ON}
           Anc_1.6 YCL059C
          Length = 349

 Score =  553 bits (1424), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 265/310 (85%), Positives = 281/310 (90%)

Query: 1   MVSTYNKDKPWDTEDIDKWKIEEFKPEDNKSGQPFAEESSFMTLFPKYREAYLKSIWNDV 60
           MVST+NKDKPWDT+DIDKW IEEFKPEDN SGQPFAEESSFMTLFPKYRE YLKS+W DV
Sbjct: 1   MVSTHNKDKPWDTDDIDKWHIEEFKPEDNASGQPFAEESSFMTLFPKYRETYLKSVWKDV 60

Query: 61  TRALDKHHIGCTLDLVEGSMTVKTTRKTFDPAIILKARDLIKLLARSVPFPQAVKILQDD 120
           T+ALD HHI CTLDLVEGSMTVKTTRKT+DPAIILKARDLIKLLARSVPFPQAVKILQ+D
Sbjct: 61  TKALDSHHIACTLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQED 120

Query: 121 IACDVIKIGNTVANKDRFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPYKGL 180
            ACDVIKIGN V NK+RFVKRRQRLVGP+GNTLKALELLTKCYILVQGNTVSAMGPYKGL
Sbjct: 121 TACDVIKIGNIVTNKERFVKRRQRLVGPDGNTLKALELLTKCYILVQGNTVSAMGPYKGL 180

Query: 181 KEIRRVVLDCMKNVHPIYHIKELMIKRELAKRPELANEDWSRFLPMFKKRNVARXXXXXX 240
           KE+RRVV DCM NVHPIYHIKELMIKRELAK+PELANEDWSRFLPMFKKRNVAR      
Sbjct: 181 KELRRVVEDCMHNVHPIYHIKELMIKRELAKKPELANEDWSRFLPMFKKRNVARKKPKKI 240

Query: 241 XXXXXVYTPFPPAQLPRKVDLQIESGEYFLSKKEKEIKKLHEQREKQAEKQILKDEERRK 300
                VYTPFPPAQLPRKVDL+IESGEYFL+KKEK+ KKL E++E QAEKQ +KDEERRK
Sbjct: 241 KKEKKVYTPFPPAQLPRKVDLEIESGEYFLNKKEKQFKKLEERKEIQAEKQRVKDEERRK 300

Query: 301 DYIAPKEDEY 310
           DY APKE  Y
Sbjct: 301 DYTAPKEKAY 310

>NCAS0B09100 Chr2 (1745144..1746127) [984 bp, 327 aa] {ON} Anc_1.6
           YCL059C
          Length = 327

 Score =  550 bits (1416), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 261/310 (84%), Positives = 284/310 (91%)

Query: 1   MVSTYNKDKPWDTEDIDKWKIEEFKPEDNKSGQPFAEESSFMTLFPKYREAYLKSIWNDV 60
           MVST+N+DKPWDT D+DKW IEEFKPEDN SG PFAEESSFMTLFPKYRE YLKS+WNDV
Sbjct: 1   MVSTHNRDKPWDTPDVDKWHIEEFKPEDNASGLPFAEESSFMTLFPKYRETYLKSVWNDV 60

Query: 61  TRALDKHHIGCTLDLVEGSMTVKTTRKTFDPAIILKARDLIKLLARSVPFPQAVKILQDD 120
           TRAL+KH++GC LDLVEGSMTVKTTRKTFDPAIILKARDLIKLLARSVPFPQAVKILQDD
Sbjct: 61  TRALNKHNLGCVLDLVEGSMTVKTTRKTFDPAIILKARDLIKLLARSVPFPQAVKILQDD 120

Query: 121 IACDVIKIGNTVANKDRFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPYKGL 180
           +ACDVIKIGN V NK+RFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVS MGP++GL
Sbjct: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSVMGPFQGL 180

Query: 181 KEIRRVVLDCMKNVHPIYHIKELMIKRELAKRPELANEDWSRFLPMFKKRNVARXXXXXX 240
           KE+RRVV DCMKNVHPIYHIKELMIKRELAK+PELANEDWSRFLPMFKKRNVAR      
Sbjct: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKKPELANEDWSRFLPMFKKRNVARKKPKKV 240

Query: 241 XXXXXVYTPFPPAQLPRKVDLQIESGEYFLSKKEKEIKKLHEQREKQAEKQILKDEERRK 300
                +YTPFPPAQLPRKVDL+IESGEYFLSK+EKE+KKLHE+RE+QAEKQ  K+ ER K
Sbjct: 241 RKEKKIYTPFPPAQLPRKVDLEIESGEYFLSKREKEMKKLHERREQQAEKQAEKEVERNK 300

Query: 301 DYIAPKEDEY 310
           +YIAP+E+ Y
Sbjct: 301 NYIAPEEETY 310

>SAKL0C00484g Chr3 complement(45059..46078) [1020 bp, 339 aa] {ON}
           highly similar to uniprot|P25586 Saccharomyces
           cerevisiae YCL059C KRR1 Essential nucleolar protein
           required for the synthesis of 18S rRNA and for the
           assembly of 40S ribosomal subunit
          Length = 339

 Score =  548 bits (1411), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 265/311 (85%), Positives = 285/311 (91%), Gaps = 1/311 (0%)

Query: 1   MVSTYNKDKPWDTEDIDKWKIEEFKPEDNKSGQPFAEESSFMTLFPKYREAYLKSIWNDV 60
           M ST+NKDKPWDT +IDKWKIEEFKPEDN SG PFAEESSFMTLFPKYREAYLKS+WNDV
Sbjct: 1   MPSTHNKDKPWDTPEIDKWKIEEFKPEDNASGLPFAEESSFMTLFPKYREAYLKSVWNDV 60

Query: 61  TRALDKHHIGCTLDLVEGSMTVKTTRKTFDPAIILKARDLIKLLARSVPFPQAVKILQDD 120
           TRALDKHHI CTLDLVEGSM+VKTTRKT+DPAIILKARDLIKLLARSVPFPQAVKIL+DD
Sbjct: 61  TRALDKHHIACTLDLVEGSMSVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILEDD 120

Query: 121 IACDVIKIGNTVANKDRFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPYKGL 180
           +ACDVIKIGN V+NK+RFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGP+KGL
Sbjct: 121 VACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180

Query: 181 KEIRRVVLDCMKNVHPIYHIKELMIKRELAKRPELANEDWSRFLPMFKKRNV-ARXXXXX 239
           KE+RRVV DCMKNVHPIYHIKELMIKRELAKRPELA EDWSRFLPMFKKRNV  +     
Sbjct: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKRPELAEEDWSRFLPMFKKRNVARKKPKKA 240

Query: 240 XXXXXXVYTPFPPAQLPRKVDLQIESGEYFLSKKEKEIKKLHEQREKQAEKQILKDEERR 299
                 VYTPFPPAQLPRKVDL+IESGEYFLSKKEKE+KKL E+R++QAEKQ  K+EER 
Sbjct: 241 KAKEKKVYTPFPPAQLPRKVDLEIESGEYFLSKKEKEVKKLQERRQEQAEKQAQKEEERA 300

Query: 300 KDYIAPKEDEY 310
           KDY+AP+E EY
Sbjct: 301 KDYVAPEEAEY 311

>NDAI0A00150 Chr1 complement(12040..12993) [954 bp, 317 aa] {ON}
           Anc_1.6 YCL059C
          Length = 317

 Score =  544 bits (1401), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 257/310 (82%), Positives = 283/310 (91%)

Query: 1   MVSTYNKDKPWDTEDIDKWKIEEFKPEDNKSGQPFAEESSFMTLFPKYREAYLKSIWNDV 60
           MVST+N+DKPWDTE+I+KWKIEEFKPEDN SG PFAEESSFMTLFPKYRE YLKS+WNDV
Sbjct: 1   MVSTHNRDKPWDTEEINKWKIEEFKPEDNASGLPFAEESSFMTLFPKYRETYLKSVWNDV 60

Query: 61  TRALDKHHIGCTLDLVEGSMTVKTTRKTFDPAIILKARDLIKLLARSVPFPQAVKILQDD 120
           TRAL+ H++ C LDLVEGSMTVKTTRKT+DPAIILKARDLIKLLARSVPFPQAVKIL+DD
Sbjct: 61  TRALNTHNLACVLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILEDD 120

Query: 121 IACDVIKIGNTVANKDRFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPYKGL 180
           +ACDVIKIGN V NK+RFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVS MGP+KGL
Sbjct: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSVMGPFKGL 180

Query: 181 KEIRRVVLDCMKNVHPIYHIKELMIKRELAKRPELANEDWSRFLPMFKKRNVARXXXXXX 240
           KE+RRVV DCMKN+HPIYHIKELMIKRELAK+PELANEDWSRFLPMFKKRNVAR      
Sbjct: 181 KEVRRVVEDCMKNIHPIYHIKELMIKRELAKKPELANEDWSRFLPMFKKRNVARKKPKKV 240

Query: 241 XXXXXVYTPFPPAQLPRKVDLQIESGEYFLSKKEKEIKKLHEQREKQAEKQILKDEERRK 300
                +YTPFPPAQLPRKVDL+IESGEYFLSK+EKE+KKL+E+RE+QAEKQ+ K+ ER K
Sbjct: 241 KKEKKIYTPFPPAQLPRKVDLEIESGEYFLSKREKEMKKLNERREQQAEKQVEKETERNK 300

Query: 301 DYIAPKEDEY 310
           DY+AP E  Y
Sbjct: 301 DYVAPSEPTY 310

>Kpol_2002.9 s2002 complement(17681..18697) [1017 bp, 338 aa] {ON}
           complement(17681..18697) [1017 nt, 339 aa]
          Length = 338

 Score =  544 bits (1402), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 262/310 (84%), Positives = 283/310 (91%)

Query: 1   MVSTYNKDKPWDTEDIDKWKIEEFKPEDNKSGQPFAEESSFMTLFPKYREAYLKSIWNDV 60
           MVST+NKDKPWDTEDIDKWK+EEFKPEDN SG PFAEESSFMTLFPKYRE YLKS+WNDV
Sbjct: 1   MVSTHNKDKPWDTEDIDKWKVEEFKPEDNASGLPFAEESSFMTLFPKYREIYLKSVWNDV 60

Query: 61  TRALDKHHIGCTLDLVEGSMTVKTTRKTFDPAIILKARDLIKLLARSVPFPQAVKILQDD 120
           T+ALDK HI CTLDLVEGSMTVKTTRKTFDP  ILKARDLIKLLARSVPFPQA+KIL+DD
Sbjct: 61  TKALDKRHIACTLDLVEGSMTVKTTRKTFDPYAILKARDLIKLLARSVPFPQAIKILEDD 120

Query: 121 IACDVIKIGNTVANKDRFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPYKGL 180
           +ACDVIKIGN V NK+RFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVS MGP+KGL
Sbjct: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSCMGPFKGL 180

Query: 181 KEIRRVVLDCMKNVHPIYHIKELMIKRELAKRPELANEDWSRFLPMFKKRNVARXXXXXX 240
           KEIRRVV DCMKNVHPIYHIKELMIKRELAKRPELA+EDWSRFLPMFKKRNVAR      
Sbjct: 181 KEIRRVVEDCMKNVHPIYHIKELMIKRELAKRPELADEDWSRFLPMFKKRNVARKKAAKP 240

Query: 241 XXXXXVYTPFPPAQLPRKVDLQIESGEYFLSKKEKEIKKLHEQREKQAEKQILKDEERRK 300
                VYTPFPPAQ PRKVDL+IESGEYFLSKKEKE+K+L E+RE+Q++KQI K++ER K
Sbjct: 241 KKEKKVYTPFPPAQQPRKVDLEIESGEYFLSKKEKEVKRLQERREEQSQKQIEKEKERSK 300

Query: 301 DYIAPKEDEY 310
           DY+AP E+EY
Sbjct: 301 DYVAPMEEEY 310

>TPHA0E04000 Chr5 (838446..839396) [951 bp, 316 aa] {ON} Anc_1.6
           YCL059C
          Length = 316

 Score =  539 bits (1388), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 256/310 (82%), Positives = 282/310 (90%)

Query: 1   MVSTYNKDKPWDTEDIDKWKIEEFKPEDNKSGQPFAEESSFMTLFPKYREAYLKSIWNDV 60
           MVST+NK+KPWDTEDIDKWK+E+FKPEDN SG PF+EESSFMTLFPKYRE YLKS+W DV
Sbjct: 1   MVSTHNKEKPWDTEDIDKWKLEDFKPEDNASGMPFSEESSFMTLFPKYREVYLKSVWKDV 60

Query: 61  TRALDKHHIGCTLDLVEGSMTVKTTRKTFDPAIILKARDLIKLLARSVPFPQAVKILQDD 120
           T+ALDKHH+ CTL+LV+GSMTV TTRKT+DP IILKARDLIKLLARSVPFPQAVKIL DD
Sbjct: 61  TKALDKHHVACTLNLVDGSMTVSTTRKTYDPYIILKARDLIKLLARSVPFPQAVKILDDD 120

Query: 121 IACDVIKIGNTVANKDRFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPYKGL 180
           +ACDVIKIGN V NK+RFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVS MGP+KGL
Sbjct: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSVMGPFKGL 180

Query: 181 KEIRRVVLDCMKNVHPIYHIKELMIKRELAKRPELANEDWSRFLPMFKKRNVARXXXXXX 240
           KEIRRVV D M+NVHPIYHIKELMIKRELAK+PELANEDWSRFLPMFKKRNVAR      
Sbjct: 181 KEIRRVVEDAMRNVHPIYHIKELMIKRELAKKPELANEDWSRFLPMFKKRNVARKKSKKP 240

Query: 241 XXXXXVYTPFPPAQLPRKVDLQIESGEYFLSKKEKEIKKLHEQREKQAEKQILKDEERRK 300
                VYTPFPP+QLPRKVDL+IESGEYFLSKKEKE+K+LHE+R++QAEKQ  KD ER K
Sbjct: 241 KREKKVYTPFPPSQLPRKVDLEIESGEYFLSKKEKEVKRLHERRDQQAEKQAEKDIERSK 300

Query: 301 DYIAPKEDEY 310
           +YIAPKE++Y
Sbjct: 301 NYIAPKEEKY 310

>KLLA0C00506g Chr3 complement(38584..39576) [993 bp, 330 aa] {ON}
           highly similar to uniprot|P25586 Saccharomyces
           cerevisiae YCL059C KRR1 Essential nucleolar protein
           required for the synthesis of 18S rRNA and for the
           assembly of 40S ribosomal subunit
          Length = 330

 Score =  538 bits (1387), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 258/310 (83%), Positives = 282/310 (90%), Gaps = 1/310 (0%)

Query: 1   MVSTYNKDKPWDTEDIDKWKIEEFKPEDNKSGQPFAEESSFMTLFPKYREAYLKSIWNDV 60
           MVST+NKDKPWDT+++DKW IEEFKPEDNKSG PFAEESSFMTLFPKYREAYLKS+W DV
Sbjct: 1   MVSTHNKDKPWDTDEVDKWNIEEFKPEDNKSGLPFAEESSFMTLFPKYREAYLKSVWKDV 60

Query: 61  TRALDKHHIGCTLDLVEGSMTVKTTRKTFDPAIILKARDLIKLLARSVPFPQAVKILQDD 120
           TR+LD HHI C L+LVEGSMTVKTTRKT+DPA+ILKARDLIKLLARSVPFPQAVKIL+DD
Sbjct: 61  TRSLDAHHIACELNLVEGSMTVKTTRKTYDPAVILKARDLIKLLARSVPFPQAVKILEDD 120

Query: 121 IACDVIKIGNTVANKDRFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPYKGL 180
           +ACDVIKIGN V+NK+RFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVS MGPYKGL
Sbjct: 121 VACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSVMGPYKGL 180

Query: 181 KEIRRVVLDCMKNVHPIYHIKELMIKRELAKRPELANEDWSRFLPMFKKRNVARXXXXXX 240
           KE+RRVV DCMKNVHPIYHIKELMIKRELAK+PELA EDWSRFLPMFKKRNVAR      
Sbjct: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKKPELAEEDWSRFLPMFKKRNVAR-KKPKK 239

Query: 241 XXXXXVYTPFPPAQLPRKVDLQIESGEYFLSKKEKEIKKLHEQREKQAEKQILKDEERRK 300
                +YTPFPPAQLPRKVDL+IESGEYFLSK+EKE+KKLHE+RE+QA K   K+ ER K
Sbjct: 240 IKEKKIYTPFPPAQLPRKVDLEIESGEYFLSKREKEVKKLHERREQQAAKHAEKESERAK 299

Query: 301 DYIAPKEDEY 310
           D+IAPKE +Y
Sbjct: 300 DFIAPKETDY 309

>Ecym_1009 Chr1 complement(16963..17973) [1011 bp, 336 aa] {ON}
           similar to Ashbya gossypii AFR744W
          Length = 336

 Score =  538 bits (1386), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 260/310 (83%), Positives = 280/310 (90%), Gaps = 1/310 (0%)

Query: 1   MVSTYNKDKPWDTEDIDKWKIEEFKPEDNKSGQPFAEESSFMTLFPKYREAYLKSIWNDV 60
           MVST+NKDKPWDT DIDKWKIEEFKPEDN SG PFAEESSFMTLFPKYREAYLKS WNDV
Sbjct: 1   MVSTHNKDKPWDTPDIDKWKIEEFKPEDNASGLPFAEESSFMTLFPKYREAYLKSTWNDV 60

Query: 61  TRALDKHHIGCTLDLVEGSMTVKTTRKTFDPAIILKARDLIKLLARSVPFPQAVKILQDD 120
           TRALDKHH+ C L+LVEGSMTVKTTRKT+DPAIILKARDLIKLLARSVPFPQAVKIL+DD
Sbjct: 61  TRALDKHHLACELNLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILEDD 120

Query: 121 IACDVIKIGNTVANKDRFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPYKGL 180
           +ACDVIKIGN  +NKDRFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPYKGL
Sbjct: 121 VACDVIKIGNFSSNKDRFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPYKGL 180

Query: 181 KEIRRVVLDCMKNVHPIYHIKELMIKRELAKRPELANEDWSRFLPMFKKRNVARXXXXXX 240
           KE+RRVV DCMKNVHPIYHIKELMIKRELAK+PELA++DWSRFLPMFKKRN+AR      
Sbjct: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKKPELADQDWSRFLPMFKKRNIAR-KKPKK 239

Query: 241 XXXXXVYTPFPPAQLPRKVDLQIESGEYFLSKKEKEIKKLHEQREKQAEKQILKDEERRK 300
                VYTPFPPAQLPRKVDL+IE+GEYFLSK EK++KKL E R +Q EKQ+ K +ER +
Sbjct: 240 IKEKKVYTPFPPAQLPRKVDLEIETGEYFLSKNEKKMKKLEEHRNRQTEKQLEKAKERAE 299

Query: 301 DYIAPKEDEY 310
           DYIAP E EY
Sbjct: 300 DYIAPDEKEY 309

>Kwal_33.13011 s33 complement(39946..40950) [1005 bp, 334 aa] {ON}
           YCL059C (KRR1) - involved in cell division and spore
           germination [contig 123] FULL
          Length = 334

 Score =  536 bits (1382), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 261/311 (83%), Positives = 279/311 (89%), Gaps = 1/311 (0%)

Query: 1   MVSTYNKDKPWDTEDIDKWKIEEFKPEDNKSGQPFAEESSFMTLFPKYREAYLKSIWNDV 60
           M ST+NKDKPWDT DIDKWKIEEFKPEDN SG PF+EESSFMTLFPKYRE YLKS+W DV
Sbjct: 1   MPSTHNKDKPWDTPDIDKWKIEEFKPEDNTSGLPFSEESSFMTLFPKYREVYLKSVWKDV 60

Query: 61  TRALDKHHIGCTLDLVEGSMTVKTTRKTFDPAIILKARDLIKLLARSVPFPQAVKILQDD 120
           TRAL+KH I C LDLVEGSMTVKTTRKT+DPAIILKARDLIKLLARSVPFPQAVKILQDD
Sbjct: 61  TRALEKHSISCVLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQDD 120

Query: 121 IACDVIKIGNTVANKDRFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPYKGL 180
           +ACDVIKIGN V+NK+RFVKRRQRLVGPNGNTLKALELL+KCYILVQGNTVSAMGP+KGL
Sbjct: 121 MACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLSKCYILVQGNTVSAMGPFKGL 180

Query: 181 KEIRRVVLDCMKNVHPIYHIKELMIKRELAKRPELANEDWSRFLPMFKKRNVARXX-XXX 239
           KE+RRVV DCMKNVHPIYHIKELMIKRELAKRP+LA EDWSRFLPMFKKRNVAR      
Sbjct: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKRPDLAEEDWSRFLPMFKKRNVARKKPKNI 240

Query: 240 XXXXXXVYTPFPPAQLPRKVDLQIESGEYFLSKKEKEIKKLHEQREKQAEKQILKDEERR 299
                 VYTPFPP Q PRKVDLQIESGEYFLSKKEKE KKL E++++QAEKQI KD+ER 
Sbjct: 241 KSKEAKVYTPFPPVQQPRKVDLQIESGEYFLSKKEKEAKKLDERKKEQAEKQIEKDKERA 300

Query: 300 KDYIAPKEDEY 310
           KDY+AP E EY
Sbjct: 301 KDYVAPSEKEY 311

>YCL059C Chr3 complement(22429..23379) [951 bp, 316 aa] {ON}
           KRR1Essential nucleolar protein required for the
           synthesis of 18S rRNA and for the assembly of 40S
           ribosomal subunit
          Length = 316

 Score =  534 bits (1376), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 263/311 (84%), Positives = 287/311 (92%), Gaps = 1/311 (0%)

Query: 1   MVSTYNKDKPWDTEDIDKWKIEEFKPEDNKSGQPFAEESSFMTLFPKYREAYLKSIWNDV 60
           MVST+N+DKPWDT+DIDKWKIEEFK EDN SGQPFAEESSFMTLFPKYRE+YLK+IWNDV
Sbjct: 1   MVSTHNRDKPWDTDDIDKWKIEEFKEEDNASGQPFAEESSFMTLFPKYRESYLKTIWNDV 60

Query: 61  TRALDKHHIGCTLDLVEGSMTVKTTRKTFDPAIILKARDLIKLLARSVPFPQAVKILQDD 120
           TRALDKH+I C LDLVEGSMTVKTTRKT+DPAIILKARDLIKLLARSVPFPQAVKILQDD
Sbjct: 61  TRALDKHNIACVLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQDD 120

Query: 121 IACDVIKIGNTVANKDRFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPYKGL 180
           +ACDVIKIGN V NK+RFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGP+KGL
Sbjct: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180

Query: 181 KEIRRVVLDCMKNVHPIYHIKELMIKRELAKRPELANEDWSRFLPMFKKRNVARXX-XXX 239
           KE+RRVV DCMKN+HPIYHIKELMIKRELAKRPELANEDWSRFLPMFKKRNVAR      
Sbjct: 181 KEVRRVVEDCMKNIHPIYHIKELMIKRELAKRPELANEDWSRFLPMFKKRNVARKKPKKI 240

Query: 240 XXXXXXVYTPFPPAQLPRKVDLQIESGEYFLSKKEKEIKKLHEQREKQAEKQILKDEERR 299
                 VYTPFPPAQLPRKVDL+IESGEYFLSK+EK++KKL+EQ+EKQ E++I + EER 
Sbjct: 241 RNVEKKVYTPFPPAQLPRKVDLEIESGEYFLSKREKQMKKLNEQKEKQMEREIERQEERA 300

Query: 300 KDYIAPKEDEY 310
           KD+IAP+E+ Y
Sbjct: 301 KDFIAPEEEAY 311

>Smik_3.15 Chr3 complement(23880..24830) [951 bp, 316 aa] {ON}
           YCL059C (REAL)
          Length = 316

 Score =  534 bits (1376), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 264/311 (84%), Positives = 286/311 (91%), Gaps = 1/311 (0%)

Query: 1   MVSTYNKDKPWDTEDIDKWKIEEFKPEDNKSGQPFAEESSFMTLFPKYREAYLKSIWNDV 60
           MVST+N+DKPWDT+DIDKWKIEEFK EDN SGQPFAEESSFMTLFPKYRE+YLK+IWNDV
Sbjct: 1   MVSTHNRDKPWDTDDIDKWKIEEFKEEDNASGQPFAEESSFMTLFPKYRESYLKTIWNDV 60

Query: 61  TRALDKHHIGCTLDLVEGSMTVKTTRKTFDPAIILKARDLIKLLARSVPFPQAVKILQDD 120
           TRALDKH+I C LDLVEGSMTVKTTRKT+DPAIILKARDLIKLLARSVPFPQAVKILQDD
Sbjct: 61  TRALDKHNIACVLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQDD 120

Query: 121 IACDVIKIGNTVANKDRFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPYKGL 180
           +ACDVIKIGN V NK+RFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGP+KGL
Sbjct: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180

Query: 181 KEIRRVVLDCMKNVHPIYHIKELMIKRELAKRPELANEDWSRFLPMFKKRNVARXX-XXX 239
           KE+RRVV DCMKNVHPIYHIKELMIKRELAKRPELANEDWSRFLPMFKKRNVAR      
Sbjct: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKRPELANEDWSRFLPMFKKRNVARKKPKKI 240

Query: 240 XXXXXXVYTPFPPAQLPRKVDLQIESGEYFLSKKEKEIKKLHEQREKQAEKQILKDEERR 299
                 VYTPFPPAQLPRKVDL+IESGEYFLSK+EK++KKL EQ+EKQ E++I + EER 
Sbjct: 241 RNIEKKVYTPFPPAQLPRKVDLEIESGEYFLSKREKQMKKLSEQKEKQMEREIERQEERA 300

Query: 300 KDYIAPKEDEY 310
           KD+IAP+E+ Y
Sbjct: 301 KDFIAPEEETY 311

>Skud_3.4 Chr3 complement(10422..11372) [951 bp, 316 aa] {ON}
           YCL059C (REAL)
          Length = 316

 Score =  530 bits (1364), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 259/311 (83%), Positives = 285/311 (91%), Gaps = 1/311 (0%)

Query: 1   MVSTYNKDKPWDTEDIDKWKIEEFKPEDNKSGQPFAEESSFMTLFPKYREAYLKSIWNDV 60
           MVST+N++KPWDT+DIDKWKIEEFK EDN SGQPFAEESSFMTLFPKYRE YLK+IWNDV
Sbjct: 1   MVSTHNREKPWDTDDIDKWKIEEFKEEDNGSGQPFAEESSFMTLFPKYREGYLKTIWNDV 60

Query: 61  TRALDKHHIGCTLDLVEGSMTVKTTRKTFDPAIILKARDLIKLLARSVPFPQAVKILQDD 120
           TRALDKH+I C LDLVEGSMTVKTTRKT+DPAIILKARDLIKLLARSVPFPQAVKILQDD
Sbjct: 61  TRALDKHNIACVLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQDD 120

Query: 121 IACDVIKIGNTVANKDRFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPYKGL 180
           +ACDVIKIGN V NK+RFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGP+KGL
Sbjct: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180

Query: 181 KEIRRVVLDCMKNVHPIYHIKELMIKRELAKRPELANEDWSRFLPMFKKRNVARXX-XXX 239
           KE+RRVV DCMKN+HPIYHIKELMIKRELAKRPELANEDWSRFLPMFKKRNVAR      
Sbjct: 181 KEVRRVVEDCMKNIHPIYHIKELMIKRELAKRPELANEDWSRFLPMFKKRNVARKKPKKI 240

Query: 240 XXXXXXVYTPFPPAQLPRKVDLQIESGEYFLSKKEKEIKKLHEQREKQAEKQILKDEERR 299
                 VYTPFPPAQLPRKVDL+IESGEYFLSK++K++KKL+EQ+EKQ E+++ + EER 
Sbjct: 241 RNVEKKVYTPFPPAQLPRKVDLEIESGEYFLSKRDKQVKKLNEQKEKQMERELERQEERA 300

Query: 300 KDYIAPKEDEY 310
           KD+ AP+E+ Y
Sbjct: 301 KDFTAPEEESY 311

>Suva_3.153 Chr3 complement(232200..233150) [951 bp, 316 aa] {ON}
           YCL059C (REAL)
          Length = 316

 Score =  529 bits (1363), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 259/311 (83%), Positives = 285/311 (91%), Gaps = 1/311 (0%)

Query: 1   MVSTYNKDKPWDTEDIDKWKIEEFKPEDNKSGQPFAEESSFMTLFPKYREAYLKSIWNDV 60
           MVST+N+DKPWDT+D+DKW IEEFK EDN SGQPFAEESSFMTLFPKYRE YLK+IWNDV
Sbjct: 1   MVSTHNRDKPWDTDDVDKWTIEEFKEEDNASGQPFAEESSFMTLFPKYRENYLKTIWNDV 60

Query: 61  TRALDKHHIGCTLDLVEGSMTVKTTRKTFDPAIILKARDLIKLLARSVPFPQAVKILQDD 120
           TRALDKH+I C LDLVEGSMTVKTTRKT+DPAIILKARDLIKLLARSVPFPQAVKILQDD
Sbjct: 61  TRALDKHNISCVLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQDD 120

Query: 121 IACDVIKIGNTVANKDRFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPYKGL 180
           +ACDVIKIGN V NK+RFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGP+KGL
Sbjct: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180

Query: 181 KEIRRVVLDCMKNVHPIYHIKELMIKRELAKRPELANEDWSRFLPMFKKRNVARXX-XXX 239
           KE+RRVV DCMKNVHPIYHIKELMIKRELAKRPELANEDWSRFLPMFKKRNVAR      
Sbjct: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKRPELANEDWSRFLPMFKKRNVARKKPKKI 240

Query: 240 XXXXXXVYTPFPPAQLPRKVDLQIESGEYFLSKKEKEIKKLHEQREKQAEKQILKDEERR 299
                 VYTPFPPAQLPRKVDL+IESGEYFLSK+EK++KKL+EQ+EKQ E+++ + EER 
Sbjct: 241 RNIEKKVYTPFPPAQLPRKVDLEIESGEYFLSKREKQMKKLNEQKEKQMEREVERQEERA 300

Query: 300 KDYIAPKEDEY 310
           K+++AP+E+ Y
Sbjct: 301 KNFVAPQEEAY 311

>ZYRO0F18458g Chr6 (1522841..1523785) [945 bp, 314 aa] {ON} highly
           similar to uniprot|P25586 Saccharomyces cerevisiae
           YCL059C KRR1 Essential nucleolar protein required for
           the synthesis of 18S rRNA and for the assembly of 40S
           ribosomal subunit
          Length = 314

 Score =  524 bits (1350), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 254/310 (81%), Positives = 277/310 (89%)

Query: 1   MVSTYNKDKPWDTEDIDKWKIEEFKPEDNKSGQPFAEESSFMTLFPKYREAYLKSIWNDV 60
           MVST+NKDKPWDT +IDKW  +EFK EDN SG PFAEESSFMTLFPKYREAYLKSIWNDV
Sbjct: 1   MVSTHNKDKPWDTGEIDKWHQDEFKEEDNASGLPFAEESSFMTLFPKYREAYLKSIWNDV 60

Query: 61  TRALDKHHIGCTLDLVEGSMTVKTTRKTFDPAIILKARDLIKLLARSVPFPQAVKILQDD 120
           T+AL+K+H+ C LDLVEGSMTVKTTRKT DPAIILKARDLIKLLARSVPFPQAVKIL+D+
Sbjct: 61  TKALNKYHVACVLDLVEGSMTVKTTRKTCDPAIILKARDLIKLLARSVPFPQAVKILEDN 120

Query: 121 IACDVIKIGNTVANKDRFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPYKGL 180
            ACDVIKIGNTVANK+RF KRRQRLVGPNGNTLKALELLTKCYILVQGNTV+AMG YKGL
Sbjct: 121 TACDVIKIGNTVANKERFQKRRQRLVGPNGNTLKALELLTKCYILVQGNTVAAMGNYKGL 180

Query: 181 KEIRRVVLDCMKNVHPIYHIKELMIKRELAKRPELANEDWSRFLPMFKKRNVARXXXXXX 240
           KE+RRVV D MKN+HPIYHIKELMIKRELAKRPELANEDWSRFLP FKKRNVAR      
Sbjct: 181 KEVRRVVEDTMKNIHPIYHIKELMIKRELAKRPELANEDWSRFLPNFKKRNVARKKPMKI 240

Query: 241 XXXXXVYTPFPPAQLPRKVDLQIESGEYFLSKKEKEIKKLHEQREKQAEKQILKDEERRK 300
                VYTPFPPAQ PRKVDL+IESGEYFL+K+EKE KKL E+REKQAEKQ  + +ERRK
Sbjct: 241 RKEKKVYTPFPPAQTPRKVDLEIESGEYFLNKREKEAKKLEERREKQAEKQEERQKERRK 300

Query: 301 DYIAPKEDEY 310
           D++ PKE++Y
Sbjct: 301 DFLPPKEEDY 310

>TDEL0C06960 Chr3 (1262869..1263921) [1053 bp, 350 aa] {ON} Anc_1.6
           YCL059C
          Length = 350

 Score =  523 bits (1348), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 261/310 (84%), Positives = 278/310 (89%)

Query: 1   MVSTYNKDKPWDTEDIDKWKIEEFKPEDNKSGQPFAEESSFMTLFPKYREAYLKSIWNDV 60
           MVST+N+DKPWDTEDIDKW++EEFKPEDN SG PFAEESSFMTLFPKYRE YLKSIWNDV
Sbjct: 1   MVSTHNRDKPWDTEDIDKWQVEEFKPEDNASGLPFAEESSFMTLFPKYREPYLKSIWNDV 60

Query: 61  TRALDKHHIGCTLDLVEGSMTVKTTRKTFDPAIILKARDLIKLLARSVPFPQAVKILQDD 120
           TRAL+ HHI C LDL+EGSMTVKTTRKTFDPAIIL+ARDLIKLLARSVPF QAVKIL++D
Sbjct: 61  TRALNAHHIACVLDLMEGSMTVKTTRKTFDPAIILRARDLIKLLARSVPFAQAVKILEED 120

Query: 121 IACDVIKIGNTVANKDRFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPYKGL 180
           +ACDVIKIGN VANK+RFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVS MGPYKGL
Sbjct: 121 VACDVIKIGNVVANKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSVMGPYKGL 180

Query: 181 KEIRRVVLDCMKNVHPIYHIKELMIKRELAKRPELANEDWSRFLPMFKKRNVARXXXXXX 240
           KE+RRVV D M+NVHPIY IKELMIKRELAKRPELA EDWSRFLPMFKKRNVAR      
Sbjct: 181 KEVRRVVEDTMRNVHPIYQIKELMIKRELAKRPELAEEDWSRFLPMFKKRNVARKKPKKI 240

Query: 241 XXXXXVYTPFPPAQLPRKVDLQIESGEYFLSKKEKEIKKLHEQREKQAEKQILKDEERRK 300
                VYTPFPPAQ PRK+DL+IESGEYFLSKKEKEI KL E+REKQAEKQ  K+E R K
Sbjct: 241 RAEKKVYTPFPPAQQPRKIDLEIESGEYFLSKKEKEINKLKERREKQAEKQEEKEEARSK 300

Query: 301 DYIAPKEDEY 310
           DYIAPKED Y
Sbjct: 301 DYIAPKEDVY 310

>KLTH0F00506g Chr6 complement(40222..41220) [999 bp, 332 aa] {ON}
           highly similar to uniprot|P25586 Saccharomyces
           cerevisiae YCL059C KRR1 Essential nucleolar protein
           required for the synthesis of 18S rRNA and for the
           assembly of 40S ribosomal subunit
          Length = 332

 Score =  516 bits (1328), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 259/311 (83%), Positives = 280/311 (90%), Gaps = 1/311 (0%)

Query: 1   MVSTYNKDKPWDTEDIDKWKIEEFKPEDNKSGQPFAEESSFMTLFPKYREAYLKSIWNDV 60
           M ST+NKDKPWDT DIDKWKIEEFKPEDN SG PFAEESSFMTLFPKYREAYLKS+WNDV
Sbjct: 1   MPSTHNKDKPWDTPDIDKWKIEEFKPEDNVSGMPFAEESSFMTLFPKYREAYLKSVWNDV 60

Query: 61  TRALDKHHIGCTLDLVEGSMTVKTTRKTFDPAIILKARDLIKLLARSVPFPQAVKILQDD 120
           TRALDKH+I C LDLVEGSMTVKTTR+T+DPAIILKARDLIKLLARSVPFPQAVKILQDD
Sbjct: 61  TRALDKHNIACVLDLVEGSMTVKTTRRTYDPAIILKARDLIKLLARSVPFPQAVKILQDD 120

Query: 121 IACDVIKIGNTVANKDRFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPYKGL 180
            ACDVIKIGN V+NK+RFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGP+KGL
Sbjct: 121 TACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180

Query: 181 KEIRRVVLDCMKNVHPIYHIKELMIKRELAKRPELANEDWSRFLPMFKKRNVARXX-XXX 239
           KE+RRVV DCM+N+HPIYHIKELMIKRELAKRP+LA EDWSRFLPMFKKRNVAR      
Sbjct: 181 KEVRRVVEDCMRNIHPIYHIKELMIKRELAKRPDLAEEDWSRFLPMFKKRNVARKKPKNI 240

Query: 240 XXXXXXVYTPFPPAQLPRKVDLQIESGEYFLSKKEKEIKKLHEQREKQAEKQILKDEERR 299
                 VYTPFPPAQ PRK+DLQIESGEYFL+KKEKE KKL E++ +QAEKQ+ K++ER 
Sbjct: 241 KPKENKVYTPFPPAQQPRKIDLQIESGEYFLTKKEKEAKKLEERKREQAEKQVEKNKERA 300

Query: 300 KDYIAPKEDEY 310
           KDY+AP E  Y
Sbjct: 301 KDYVAPIEKGY 311

>AFR744W Chr6 (1801815..1802846) [1032 bp, 343 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YCL059C (KRR1)
          Length = 343

 Score =  511 bits (1317), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 257/310 (82%), Positives = 276/310 (89%), Gaps = 1/310 (0%)

Query: 1   MVSTYNKDKPWDTEDIDKWKIEEFKPEDNKSGQPFAEESSFMTLFPKYREAYLKSIWNDV 60
           MVST NKDKPWDT D+DKW IEEF PED+ SG PFAEESSFMTLFPKYRE YLKSIW +V
Sbjct: 1   MVSTPNKDKPWDTPDVDKWAIEEFNPEDSASGLPFAEESSFMTLFPKYRETYLKSIWKEV 60

Query: 61  TRALDKHHIGCTLDLVEGSMTVKTTRKTFDPAIILKARDLIKLLARSVPFPQAVKILQDD 120
           TRAL+KHHI C L+LVEGSM+VKTTRKT+DPAIILKARDLIKLLARSVP PQA+KILQDD
Sbjct: 61  TRALEKHHIACELNLVEGSMSVKTTRKTYDPAIILKARDLIKLLARSVPLPQAIKILQDD 120

Query: 121 IACDVIKIGNTVANKDRFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPYKGL 180
           IACDVIKIGN VA+K+RFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPYKGL
Sbjct: 121 IACDVIKIGNIVASKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPYKGL 180

Query: 181 KEIRRVVLDCMKNVHPIYHIKELMIKRELAKRPELANEDWSRFLPMFKKRNVARXXXXXX 240
           KE+RRVV DCM+N+HPIYHIKELMIKRELAKRPELA EDWSRFLPMFKKRNVAR      
Sbjct: 181 KEVRRVVEDCMRNIHPIYHIKELMIKRELAKRPELAEEDWSRFLPMFKKRNVAR-KKPKK 239

Query: 241 XXXXXVYTPFPPAQLPRKVDLQIESGEYFLSKKEKEIKKLHEQREKQAEKQILKDEERRK 300
                VYTPFPPAQLPRKVDL+IE+GEYFLSKKEKE KKL  +R +QAEKQ  K++ER K
Sbjct: 240 IKEKKVYTPFPPAQLPRKVDLEIETGEYFLSKKEKEAKKLEARRAQQAEKQSEKEKERAK 299

Query: 301 DYIAPKEDEY 310
           DYIAP E EY
Sbjct: 300 DYIAPAEPEY 309

>TBLA0A04940 Chr1 complement(1218143..1219093) [951 bp, 316 aa] {ON}
           Anc_1.6 YCL059C
          Length = 316

 Score =  504 bits (1298), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 257/310 (82%), Positives = 283/310 (91%)

Query: 1   MVSTYNKDKPWDTEDIDKWKIEEFKPEDNKSGQPFAEESSFMTLFPKYREAYLKSIWNDV 60
           MVST+N+DKPWDT DI+KW+I+EFKPEDN SG PF EESSFMTLFPKYRE YL+ +W DV
Sbjct: 1   MVSTHNRDKPWDTPDINKWEIQEFKPEDNASGLPFTEESSFMTLFPKYRETYLREVWGDV 60

Query: 61  TRALDKHHIGCTLDLVEGSMTVKTTRKTFDPAIILKARDLIKLLARSVPFPQAVKILQDD 120
           T++LDK+H+ CTLDL+EGSMTVKTTRKT+DPAIILKARDLIKLLARSVP+PQA++ILQDD
Sbjct: 61  TKSLDKYHVACTLDLIEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPYPQAIRILQDD 120

Query: 121 IACDVIKIGNTVANKDRFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPYKGL 180
           IACDVIKIGN V NK+RFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGP+KGL
Sbjct: 121 IACDVIKIGNVVNNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180

Query: 181 KEIRRVVLDCMKNVHPIYHIKELMIKRELAKRPELANEDWSRFLPMFKKRNVARXXXXXX 240
           KE+RRVV DCMKNVHPIYHIKELMIKREL+KRPELANEDWSRFLPMFKKRNVAR      
Sbjct: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELSKRPELANEDWSRFLPMFKKRNVARKKSKKP 240

Query: 241 XXXXXVYTPFPPAQLPRKVDLQIESGEYFLSKKEKEIKKLHEQREKQAEKQILKDEERRK 300
                VYTPFPPAQLPRKVDL+IESGEYFLSKKEKEIKKL E+REKQ EKQ+ K++ERRK
Sbjct: 241 KKEKKVYTPFPPAQLPRKVDLEIESGEYFLSKKEKEIKKLKERREKQEEKQVEKEKERRK 300

Query: 301 DYIAPKEDEY 310
           D+IAP E EY
Sbjct: 301 DFIAPSEKEY 310

>KAFR0D00150 Chr4 complement(16573..17607) [1035 bp, 344 aa] {ON}
           Anc_1.6 YCL059C
          Length = 344

 Score =  498 bits (1283), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 257/308 (83%), Positives = 284/308 (92%)

Query: 1   MVSTYNKDKPWDTEDIDKWKIEEFKPEDNKSGQPFAEESSFMTLFPKYREAYLKSIWNDV 60
           MVSTYNK+KPWDTEDIDKW+ EEFKPEDN SG PFAEESSFMTLFPKYRE+YLKS+W DV
Sbjct: 1   MVSTYNKEKPWDTEDIDKWQTEEFKPEDNASGLPFAEESSFMTLFPKYRESYLKSVWKDV 60

Query: 61  TRALDKHHIGCTLDLVEGSMTVKTTRKTFDPAIILKARDLIKLLARSVPFPQAVKILQDD 120
           T+AL+KHHI C LDLVEGSMTVKTTRKT+DPAIILKARDLIKLLARSVPFPQA+KIL+D+
Sbjct: 61  TKALEKHHIACILDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAIKILEDN 120

Query: 121 IACDVIKIGNTVANKDRFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPYKGL 180
           +ACDVIKIGN V+NK+RFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGP+KGL
Sbjct: 121 MACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180

Query: 181 KEIRRVVLDCMKNVHPIYHIKELMIKRELAKRPELANEDWSRFLPMFKKRNVARXXXXXX 240
           KE+RRVV DCM NVHPIYHIKELMIKRELAK+PELANEDWSRFLPMFKKRNVAR      
Sbjct: 181 KEVRRVVEDCMLNVHPIYHIKELMIKRELAKKPELANEDWSRFLPMFKKRNVARKKPKKI 240

Query: 241 XXXXXVYTPFPPAQLPRKVDLQIESGEYFLSKKEKEIKKLHEQREKQAEKQILKDEERRK 300
                VYTPFPP QLPRKVDL+IESGEYFLSKKEKE+KKL E++E+QA+KQ  K++ER+K
Sbjct: 241 RKEKKVYTPFPPTQLPRKVDLEIESGEYFLSKKEKEVKKLEERKEEQAKKQEEKEKERKK 300

Query: 301 DYIAPKED 308
           +YIAPKE+
Sbjct: 301 NYIAPKEE 308

>SAKL0G03740g Chr7 complement(309922..310722) [801 bp, 266 aa] {ON}
           similar to uniprot|Q7LHP7 Saccharomyces cerevisiae
           YOR145C PNO1 Partner of Nob1 Protein required for cell
           viability
          Length = 266

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 35/155 (22%), Positives = 69/155 (44%), Gaps = 4/155 (2%)

Query: 46  PKYREAYLKSIWNDVTRALDKH-HIGCTLDLVEGSMTVKTTRK-TFDPAIILKARDLIKL 103
           P +R   L++ W  +   L  H  +   ++L   S+ ++T  K T DP  + K  D IK 
Sbjct: 94  PPHRMTPLRNNWTKIYPPLVDHLKLQVRMNLKTKSVELRTHPKHTTDPGALQKGADFIKA 153

Query: 104 LARSVPFPQAVKILQ-DDIACDVIKIGNT-VANKDRFVKRRQRLVGPNGNTLKALELLTK 161
            A       A+ +L+ DD+  +  ++ +      D   +   R+ G +G T  A+E  T+
Sbjct: 154 FALGFDLDDAIALLRLDDLYIETFEVKDVKTLTGDHLSRAIGRIAGKDGKTKFAIENATR 213

Query: 162 CYILVQGNTVSAMGPYKGLKEIRRVVLDCMKNVHP 196
             I++  + +  +G +  ++  R  V+  +    P
Sbjct: 214 TRIVLADSKIHILGGFTHIRMAREAVVSLILGSPP 248

>ZYRO0D11440g Chr4 complement(964606..965415) [810 bp, 269 aa] {ON}
           highly similar to uniprot|Q7LHP7 Saccharomyces
           cerevisiae YOR145C PNO1 Partner of Nob1 Protein required
           for cell viability
          Length = 269

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 33/155 (21%), Positives = 70/155 (45%), Gaps = 4/155 (2%)

Query: 46  PKYREAYLKSIWNDVTRALDKH-HIGCTLDLVEGSMTVKT-TRKTFDPAIILKARDLIKL 103
           P +R   L++ W  +   L +H  +   ++L   S+ +++  R+T DP  + K  D IK 
Sbjct: 97  PPHRMTPLRNNWTKIYPPLVEHLKLQVRMNLKTKSVELRSHPRQTTDPGALQKGADFIKA 156

Query: 104 LARSVPFPQAVKILQ-DDIACDVIKIGNT-VANKDRFVKRRQRLVGPNGNTLKALELLTK 161
                    ++ +L+ DD+  +  ++ +    N D   +   R+ G +G T  A+E  T+
Sbjct: 157 FTLGFDLDDSIALLRLDDLYIETFEVKDVKTLNGDHLSRAIGRIAGKDGKTKFAIENATR 216

Query: 162 CYILVQGNTVSAMGPYKGLKEIRRVVLDCMKNVHP 196
             I++    +  +G +  ++  R  V+  +    P
Sbjct: 217 TRIVLADAKIHILGGFTHIRMAREAVVSLILGSPP 251

>Suva_8.197 Chr8 complement(354586..355410) [825 bp, 274 aa] {ON}
           YOR145C (REAL)
          Length = 274

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 34/157 (21%), Positives = 71/157 (45%), Gaps = 4/157 (2%)

Query: 44  LFPKYREAYLKSIWNDVTRALDKH-HIGCTLDLVEGSMTVKTTRK-TFDPAIILKARDLI 101
           + P +R   L++ W  +   L +H  +   ++L   S+ ++T  K T DP  + K  D I
Sbjct: 100 MVPPHRLTPLRNSWTKIYPPLVEHLKLQVRMNLKTKSVELRTNPKFTTDPGALQKGADFI 159

Query: 102 KLLARSVPFPQAVKILQ-DDIACDVIKIGNT-VANKDRFVKRRQRLVGPNGNTLKALELL 159
           K  A       ++ +L+ DD+  +  ++ +      D   +   R+ G +G T  A+E  
Sbjct: 160 KAFALGFDLDDSIALLRLDDLYIETFEVKDVKTLTGDHLSRAIGRIAGKDGKTKFAIENA 219

Query: 160 TKCYILVQGNTVSAMGPYKGLKEIRRVVLDCMKNVHP 196
           T+  I++  + +  +G +  ++  R  V+  +    P
Sbjct: 220 TRTRIVLADSKIHILGGFTHIRMAREFVVSLILGSPP 256

>TDEL0A03460 Chr1 complement(617779..618597) [819 bp, 272 aa] {ON}
           Anc_5.482 YOR145C
          Length = 272

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 35/155 (22%), Positives = 70/155 (45%), Gaps = 4/155 (2%)

Query: 46  PKYREAYLKSIWNDVTRALDKH-HIGCTLDLVEGSMTVKTTRK-TFDPAIILKARDLIKL 103
           P +R   L++ W  +   L +H  +   ++L   S+ ++T  K T DP  + K  D IK 
Sbjct: 100 PPHRMTPLRNNWTKIYPPLVEHLKLQVRMNLKTKSVELRTNPKHTTDPGALQKGADFIKA 159

Query: 104 LARSVPFPQAVKILQ-DDIACDVIKIGNT-VANKDRFVKRRQRLVGPNGNTLKALELLTK 161
                    ++ +L+ DD+  +  +I +    N D   +   R+ G +G T  A+E  T+
Sbjct: 160 FTLGFDLDDSIALLRLDDLYIETFEIKDVKTLNGDHLSRAIGRIAGKDGKTKFAIENATR 219

Query: 162 CYILVQGNTVSAMGPYKGLKEIRRVVLDCMKNVHP 196
             I++  + +  +G +  ++  R  V+  +    P
Sbjct: 220 TRIVLADSKIHILGGFTHIRMAREAVVSLILGSPP 254

>Ecym_4552 Chr4 (1087732..1088547) [816 bp, 271 aa] {ON} similar to
           Ashbya gossypii AFR390C
          Length = 271

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 34/155 (21%), Positives = 69/155 (44%), Gaps = 4/155 (2%)

Query: 46  PKYREAYLKSIWNDVTRALDKH-HIGCTLDLVEGSMTVKTTRK-TFDPAIILKARDLIKL 103
           P +R   L++ W  +   L  H  +   ++L   S+ ++T  K T DP  + K  D IK 
Sbjct: 99  PPHRMTPLRNNWTKIYPPLVDHLKLQVRMNLKTKSVELRTHPKHTVDPGALQKGADFIKT 158

Query: 104 LARSVPFPQAVKILQ-DDIACDVIKIGNT-VANKDRFVKRRQRLVGPNGNTLKALELLTK 161
                    ++ +L+ DD+  +  +I +    N D   +   R+ G +G T  A+E  T+
Sbjct: 159 FTLGFDLDDSIALLRLDDLYIETFEIKDVKTLNGDHLSRAIGRIAGKDGKTKFAIENATR 218

Query: 162 CYILVQGNTVSAMGPYKGLKEIRRVVLDCMKNVHP 196
             I++  + +  +G +  ++  R  ++  +    P
Sbjct: 219 TRIVLADSKIHILGGFTHIRMARETIVSLILGSPP 253

>Kwal_47.18864 s47 (1004428..1005243) [816 bp, 271 aa] {ON} YOR145C
           - Protein required for cell viability [contig 189] FULL
          Length = 271

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 35/155 (22%), Positives = 69/155 (44%), Gaps = 4/155 (2%)

Query: 46  PKYREAYLKSIWNDVTRALDKH-HIGCTLDLVEGSMTVKTTRK-TFDPAIILKARDLIKL 103
           P +R   L++ W  +   L  H  +   ++L   ++ ++T  K T DP  + K  D IK 
Sbjct: 99  PPHRLTPLRNNWTKIYPPLVDHLKLQVRMNLKTKTVELRTHPKHTTDPGALQKGADFIKA 158

Query: 104 LARSVPFPQAVKILQ-DDIACDVIKIGNT-VANKDRFVKRRQRLVGPNGNTLKALELLTK 161
                    A+ +L+ DD+  +  +I +    N D   +   R+ G +G T  A+E  T+
Sbjct: 159 FTLGFDLDDAIALLRLDDLYIETFEIKDVKTLNGDHLSRAIGRIAGKDGKTKFAIENATR 218

Query: 162 CYILVQGNTVSAMGPYKGLKEIRRVVLDCMKNVHP 196
             I++  + +  +G +  ++  R  V+  +    P
Sbjct: 219 TRIVLADSKIHILGGFTHIRMARESVVSLILGSPP 253

>Kpol_543.13 s543 complement(30976..31782) [807 bp, 268 aa] {ON}
           complement(30976..31782) [807 nt, 269 aa]
          Length = 268

 Score = 40.8 bits (94), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 35/155 (22%), Positives = 69/155 (44%), Gaps = 4/155 (2%)

Query: 46  PKYREAYLKSIWNDVTRALDKH-HIGCTLDLVEGSMTVKTTRK-TFDPAIILKARDLIKL 103
           P +R   L++ W  +   L  H  +   ++L   S+ ++T  K T DP  + K  D IK 
Sbjct: 96  PPHRMTPLRNNWTKIYPPLVDHLKLQVRMNLKTKSVELRTNPKHTTDPGALQKGADFIKA 155

Query: 104 LARSVPFPQAVKILQ-DDIACDVIKIGNT-VANKDRFVKRRQRLVGPNGNTLKALELLTK 161
                    ++ +L+ DD+  +  +I +    N D   +   R+ G +G T  A+E  T+
Sbjct: 156 FTLGFDLDDSIALLRLDDLYIETFEIKDVKTLNGDHLSRAIGRIAGKDGKTKFAIENATR 215

Query: 162 CYILVQGNTVSAMGPYKGLKEIRRVVLDCMKNVHP 196
             I++  + +  +G +  ++  R  V+  +    P
Sbjct: 216 TRIVLADSKIHILGGFTHIRMAREAVVSLILGSPP 250

>KLTH0G02574g Chr7 complement(201390..202205) [816 bp, 271 aa] {ON}
           similar to uniprot|Q7LHP7 Saccharomyces cerevisiae
           YOR145C PNO1 Partner of Nob1 Protein required for cell
           viability
          Length = 271

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 35/155 (22%), Positives = 69/155 (44%), Gaps = 4/155 (2%)

Query: 46  PKYREAYLKSIWNDVTRALDKH-HIGCTLDLVEGSMTVKTTRK-TFDPAIILKARDLIKL 103
           P +R   L++ W  +   L  H  +   ++L   ++ ++T  K T DP  + K  D IK 
Sbjct: 99  PPHRMTPLRNNWTKIYPPLVDHLKLQVRMNLKTKTVELRTHPKHTTDPGALQKGADFIKA 158

Query: 104 LARSVPFPQAVKILQ-DDIACDVIKIGNT-VANKDRFVKRRQRLVGPNGNTLKALELLTK 161
                    A+ +L+ DD+  +  +I +    N D   +   R+ G +G T  A+E  T+
Sbjct: 159 FTLGFDLDDAIALLRLDDLYIETFEIKDVKTLNGDHLSRAIGRIAGKDGKTKFAIENATR 218

Query: 162 CYILVQGNTVSAMGPYKGLKEIRRVVLDCMKNVHP 196
             I++  + +  +G +  ++  R  V+  +    P
Sbjct: 219 TRIVLADSKIHILGGFTHIRMARESVVSLILGSPP 253

>CAGL0K09460g Chr11 complement(935326..936111) [786 bp, 261 aa] {ON}
           highly similar to uniprot|Q99216 Saccharomyces
           cerevisiae YOR145c
          Length = 261

 Score = 40.4 bits (93), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 33/155 (21%), Positives = 69/155 (44%), Gaps = 4/155 (2%)

Query: 46  PKYREAYLKSIWNDVTRALDKH-HIGCTLDLVEGSMTVKTTRK-TFDPAIILKARDLIKL 103
           P +R   L++ WN +   L  H  +   ++L   ++ ++T  K T DP  + K  D IK 
Sbjct: 89  PPHRMTPLRNSWNKIYPPLVDHLKLQVRMNLKTRTVELRTHPKHTTDPGALQKGADFIKA 148

Query: 104 LARSVPFPQAVKILQ-DDIACDVIKIGNT-VANKDRFVKRRQRLVGPNGNTLKALELLTK 161
                    ++ +L+ DD+  +  ++ +      D   +   R+ G +G T  A+E  T+
Sbjct: 149 FTLGFDLDDSIALLRLDDLYIETFEVKDVKTLTGDHLSRAIGRIAGKDGKTKFAIENATR 208

Query: 162 CYILVQGNTVSAMGPYKGLKEIRRVVLDCMKNVHP 196
             I++  + +  +G +  ++  R  V+  +    P
Sbjct: 209 TRIVLADSKIHILGGFTHIRMAREAVVSLILGSPP 243

>AAR002W Chr1 (341790..342326) [537 bp, 178 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YCR003W (MRPL32)
          Length = 178

 Score = 39.7 bits (91), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 43/163 (26%), Positives = 66/163 (40%), Gaps = 35/163 (21%)

Query: 54  KSIWNDVTRALDKHHIGCTLDLVEGSMTVKTTRKTFDPAIILKARDLIKLLARSVPFPQA 113
           +++W +V RAL +    CT  L          R       ++  R L++LL R+    QA
Sbjct: 4   QAVWGNVGRALSE----CTAALF--------PRLELGSGSVIAPRTLLELLRRAGGSQQA 51

Query: 114 --VKILQDDIACDVIKIGNTVANKDRFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTV 171
               +  D +   V K       K    KRRQ+L GP    L+ +  L KC         
Sbjct: 52  GTAAVGADGLVLAVPK------KKVSHQKRRQKLYGPGKKQLQMVHHLGKC--------- 96

Query: 172 SAMGPYKGLKEIRRVVLDCMKNVHPIYHIKELMIKRELAKRPE 214
            + G YK L  +      CM  V  I HI ++  + + A+ P+
Sbjct: 97  PSCGHYKRLNTL------CMYCVGEIRHIWKVYTQTKPAEPPQ 133

>Skud_15.310 Chr15 complement(554002..554832) [831 bp, 276 aa] {ON}
           YOR145C (REAL)
          Length = 276

 Score = 40.0 bits (92), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 33/157 (21%), Positives = 70/157 (44%), Gaps = 4/157 (2%)

Query: 44  LFPKYREAYLKSIWNDVTRALDKH-HIGCTLDLVEGSMTVKTTRK-TFDPAIILKARDLI 101
           + P +R   L++ W  +   L +H  +   ++L   S+ ++T  K T DP  + K  D I
Sbjct: 102 MVPPHRMTPLRNSWTKIYPPLVEHLKLQVRMNLKTKSVELRTNPKFTTDPGALQKGADFI 161

Query: 102 KLLARSVPFPQAVKILQ-DDIACDVIKIGNT-VANKDRFVKRRQRLVGPNGNTLKALELL 159
           K          ++ +L+ DD+  +  ++ +      D   +   R+ G +G T  A+E  
Sbjct: 162 KAFTLGFDLDDSIALLRLDDLYIETFEVKDVKTLTGDHLSRAIGRIAGKDGKTKFAIENA 221

Query: 160 TKCYILVQGNTVSAMGPYKGLKEIRRVVLDCMKNVHP 196
           T+  I++  + +  +G +  ++  R  V+  +    P
Sbjct: 222 TRTRIVLADSKIHILGGFTHIRMARESVVSLILGSPP 258

>NCAS0A11960 Chr1 complement(2371549..2372361) [813 bp, 270 aa] {ON}
           Anc_5.482 YOR145C
          Length = 270

 Score = 39.7 bits (91), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 34/155 (21%), Positives = 67/155 (43%), Gaps = 4/155 (2%)

Query: 46  PKYREAYLKSIWNDVTRALDKH-HIGCTLDLVEGSMTVKTTRK-TFDPAIILKARDLIKL 103
           P +R   L++ W  +   L  H  +   ++L   S+ ++T  K T DP  + K  D IK 
Sbjct: 98  PPHRMTPLRNSWTKIYPPLVDHLKLQVRMNLKTKSVELRTHPKHTTDPGALQKGADFIKA 157

Query: 104 LARSVPFPQAVKILQ-DDIACDVIKIGNT-VANKDRFVKRRQRLVGPNGNTLKALELLTK 161
                    ++ +L+ DD+  +  +I +      D   +   R+ G +G T  A+E  T+
Sbjct: 158 FTLGFDLDDSIALLRLDDLYIETFEIKDVKTLTGDHLSRAIGRIAGKDGKTKFAIENATR 217

Query: 162 CYILVQGNTVSAMGPYKGLKEIRRVVLDCMKNVHP 196
             I++    +  +G +  ++  R  V+  +    P
Sbjct: 218 TRIVLADTKIHILGGFTHIRMAREAVVSLILGSPP 252

>YOR145C Chr15 complement(605347..606171) [825 bp, 274 aa] {ON}
           PNO1Essential nucleolar protein required for pre-18S
           rRNA processing, interacts with Dim1p, an 18S rRNA
           dimethyltransferase, and also with Nob1p, which is
           involved in proteasome biogenesis; contains a KH domain
          Length = 274

 Score = 39.7 bits (91), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 33/157 (21%), Positives = 70/157 (44%), Gaps = 4/157 (2%)

Query: 44  LFPKYREAYLKSIWNDVTRALDKH-HIGCTLDLVEGSMTVKTTRK-TFDPAIILKARDLI 101
           + P +R   L++ W  +   L +H  +   ++L   S+ ++T  K T DP  + K  D I
Sbjct: 100 MVPPHRMTPLRNSWTKIYPPLVEHLKLQVRMNLKTKSVELRTNPKFTTDPGALQKGADFI 159

Query: 102 KLLARSVPFPQAVKILQ-DDIACDVIKIGNT-VANKDRFVKRRQRLVGPNGNTLKALELL 159
           K          ++ +L+ DD+  +  ++ +      D   +   R+ G +G T  A+E  
Sbjct: 160 KAFTLGFDLDDSIALLRLDDLYIETFEVKDVKTLTGDHLSRAIGRIAGKDGKTKFAIENA 219

Query: 160 TKCYILVQGNTVSAMGPYKGLKEIRRVVLDCMKNVHP 196
           T+  I++  + +  +G +  ++  R  V+  +    P
Sbjct: 220 TRTRIVLADSKIHILGGFTHIRMARESVVSLILGSPP 256

>Smik_15.326 Chr15 complement(561176..562000) [825 bp, 274 aa] {ON}
           YOR145C (REAL)
          Length = 274

 Score = 39.3 bits (90), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 33/157 (21%), Positives = 70/157 (44%), Gaps = 4/157 (2%)

Query: 44  LFPKYREAYLKSIWNDVTRALDKH-HIGCTLDLVEGSMTVKTTRK-TFDPAIILKARDLI 101
           + P +R   L++ W  +   L +H  +   ++L   S+ ++T  K T DP  + K  D I
Sbjct: 100 MVPPHRMTPLRNSWTKIYPPLVEHLKLQVRMNLKTKSVELRTNPKFTTDPGALQKGADFI 159

Query: 102 KLLARSVPFPQAVKILQ-DDIACDVIKIGNT-VANKDRFVKRRQRLVGPNGNTLKALELL 159
           K          ++ +L+ DD+  +  ++ +      D   +   R+ G +G T  A+E  
Sbjct: 160 KAFTLGFDLDDSIALLRLDDLYIETFEVKDVKTLTGDHLSRAIGRIAGKDGKTKFAIENA 219

Query: 160 TKCYILVQGNTVSAMGPYKGLKEIRRVVLDCMKNVHP 196
           T+  I++  + +  +G +  ++  R  V+  +    P
Sbjct: 220 TRTRIVLADSKIHILGGFTHIRMARESVVSLILGSPP 256

>KLLA0C06446g Chr3 complement(566371..567195) [825 bp, 274 aa] {ON}
           highly similar to uniprot|Q7LHP7 Saccharomyces
           cerevisiae YOR145C PNO1 Partner of Nob1 Protein required
           for cell viability,
          Length = 274

 Score = 39.3 bits (90), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 35/155 (22%), Positives = 69/155 (44%), Gaps = 4/155 (2%)

Query: 46  PKYREAYLKSIWNDVTRALDKH-HIGCTLDLVEGSMTVKTTRK-TFDPAIILKARDLIKL 103
           P +R   LK+ W+ +   L  H  +   ++L   S+ ++T  K T DP  + K  D IK 
Sbjct: 102 PPHRMTPLKNNWSKIYPPLVDHLKLQVRMNLKTKSVELRTHPKHTTDPGALQKGADFIKA 161

Query: 104 LARSVPFPQAVKILQ-DDIACDVIKIGNT-VANKDRFVKRRQRLVGPNGNTLKALELLTK 161
                    ++ +L+ DD+  +  +I +      D   +   R+ G +G T  A+E  T+
Sbjct: 162 FTLGFDLDDSIALLRLDDLYIETFEIKDVKTLQGDHLSRAIGRIAGKDGKTKFAIENATR 221

Query: 162 CYILVQGNTVSAMGPYKGLKEIRRVVLDCMKNVHP 196
             I++  + +  +G +  ++  R  V+  +    P
Sbjct: 222 TRIVLADSKIHILGGFTHIRMARESVVSLILGSPP 256

>TPHA0J02820 Chr10 complement(627383..628189) [807 bp, 268 aa] {ON}
           Anc_5.482 YOR145C
          Length = 268

 Score = 38.9 bits (89), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 34/155 (21%), Positives = 69/155 (44%), Gaps = 4/155 (2%)

Query: 46  PKYREAYLKSIWNDVTRALDKH-HIGCTLDLVEGSMTVKTTRK-TFDPAIILKARDLIKL 103
           P +R   L++ W+ +   L  H  +   ++L   S+ ++T  K T DP  + K  D IK 
Sbjct: 96  PPHRMTPLRNSWSKIYPPLVDHLKLQVRMNLKSKSVELRTHPKHTTDPGALQKGADFIKA 155

Query: 104 LARSVPFPQAVKILQ-DDIACDVIKIGNT-VANKDRFVKRRQRLVGPNGNTLKALELLTK 161
                    ++ +L+ DD+  +  +I +    + D   +   R+ G +G T  A+E  T+
Sbjct: 156 FTLGFDLDDSIALLRLDDLYIETFEIKDVKTLHGDHLSRAIGRIAGKDGKTKFAIENATR 215

Query: 162 CYILVQGNTVSAMGPYKGLKEIRRVVLDCMKNVHP 196
             I++    +  +G +  ++  R  V+  +    P
Sbjct: 216 TRIVLADTKIHILGGFTHIRMAREAVVSLILGSPP 250

>NDAI0A04310 Chr1 (970952..971776) [825 bp, 274 aa] {ON} Anc_5.482
           YOR145C
          Length = 274

 Score = 38.9 bits (89), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 40/182 (21%), Positives = 76/182 (41%), Gaps = 7/182 (3%)

Query: 22  EEFKP---EDNKSGQPFAEESSFMTLFPKYREAYLKSIWNDVTRALDKH-HIGCTLDLVE 77
           E+ KP     N+ G    +  S     P +R   L++ W  +   L  H  +   ++L  
Sbjct: 75  EQGKPRFSSANQKGSTKVKLESRKIAVPPHRMTPLRNSWTKIYPPLVDHLKLQVRMNLKT 134

Query: 78  GSMTVKTTRK-TFDPAIILKARDLIKLLARSVPFPQAVKILQ-DDIACDVIKIGNT-VAN 134
            S+ ++T  K T DP  + K  D IK          ++ +L+ DD+  +  +I +     
Sbjct: 135 KSVELRTHPKHTTDPGALQKGADFIKAFTLGFDLDDSIALLRLDDLYIETFEIKDVKTLT 194

Query: 135 KDRFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPYKGLKEIRRVVLDCMKNV 194
            D   +   R+ G +G T  A+E  T+  I++    +  +G +  ++  R  V+  +   
Sbjct: 195 GDHLSRAIGRIAGKDGKTKFAIENATRTRIVLADTKIHILGGFTHIRMARESVVSLILGS 254

Query: 195 HP 196
            P
Sbjct: 255 PP 256

>KAFR0E03600 Chr5 (724338..725168) [831 bp, 276 aa] {ON} Anc_5.482
           YOR145C
          Length = 276

 Score = 38.9 bits (89), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 33/155 (21%), Positives = 69/155 (44%), Gaps = 4/155 (2%)

Query: 46  PKYREAYLKSIWNDVTRALDKH-HIGCTLDLVEGSMTVKTTRK-TFDPAIILKARDLIKL 103
           P +R   L++ W  +   L +H  +   ++L   S+ ++T  K T DP  + K  D IK 
Sbjct: 104 PPHRMTPLRNNWTKIYPPLVEHLKLQVRMNLKTKSVELRTHPKHTTDPGALQKGADFIKA 163

Query: 104 LARSVPFPQAVKILQ-DDIACDVIKIGNT-VANKDRFVKRRQRLVGPNGNTLKALELLTK 161
                    ++ +L+ DD+  +  ++ +      D   +   R+ G +G T  A+E  T+
Sbjct: 164 FTLGFDLDDSIALLRLDDLYIETFEVKDVKTLTGDHLSRAIGRIAGKDGKTKFAIENATR 223

Query: 162 CYILVQGNTVSAMGPYKGLKEIRRVVLDCMKNVHP 196
             I++  + +  +G +  ++  R  V+  +    P
Sbjct: 224 TRIVLADSKIHILGGFTHIRMAREAVVSLILGSPP 258

>TBLA0D01890 Chr4 (461527..462342) [816 bp, 271 aa] {ON} Anc_5.482
           YOR145C
          Length = 271

 Score = 38.5 bits (88), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 37/172 (21%), Positives = 74/172 (43%), Gaps = 4/172 (2%)

Query: 29  NKSGQPFAEESSFMTLFPKYREAYLKSIWNDVTRALDKH-HIGCTLDLVEGSMTVKTTRK 87
           NKS Q   +  S     P +R   L++ W  +   L  H  +   ++L   S+ ++T  K
Sbjct: 82  NKSKQTKVKLESRKVAVPPHRMTPLRNNWPKIYPPLVDHLKLQVRMNLRTKSVELRTHPK 141

Query: 88  -TFDPAIILKARDLIKLLARSVPFPQAVKILQ-DDIACDVIKIGNT-VANKDRFVKRRQR 144
            T DP  + K  D IK          ++ +L+ DD+  +  ++ +      D   +   R
Sbjct: 142 HTTDPGALQKGADFIKAFTLGFDLDDSIALLRLDDLYIETFEVKDVKTLTGDHLSRAIGR 201

Query: 145 LVGPNGNTLKALELLTKCYILVQGNTVSAMGPYKGLKEIRRVVLDCMKNVHP 196
           + G +G T  A+E  T+  I++  + +  +G +  ++  R  ++  +    P
Sbjct: 202 IAGKDGKTKFAIENATRTRIVLADSKIHILGGFTHIRMARESIVSLILGSPP 253

>KNAG0C04610 Chr3 (905301..906134) [834 bp, 277 aa] {ON} Anc_5.482
           YOR145C
          Length = 277

 Score = 38.5 bits (88), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 39/182 (21%), Positives = 79/182 (43%), Gaps = 7/182 (3%)

Query: 22  EEFKP---EDNKSGQPFAEESSFMTLFPKYREAYLKSIWNDVTRALDKH-HIGCTLDLVE 77
           E+ KP     NK+ +   +  S     P +R   L++ W  +   L  H  +   ++L  
Sbjct: 78  EQGKPRFSSANKASETKIKAESRKVAVPPHRMTPLRNNWTKIYPPLVDHLKLQVRMNLKT 137

Query: 78  GSMTVKTTRK-TFDPAIILKARDLIKLLARSVPFPQAVKILQ-DDIACDVIKIGNT-VAN 134
            S+ ++T  K T DP  + K  D IK          ++ +L+ DD+  +  ++ +    +
Sbjct: 138 KSVELRTHPKHTTDPGALQKGADFIKAFTLGFDLDDSIALLRLDDLYIETFEVKDVKTLH 197

Query: 135 KDRFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPYKGLKEIRRVVLDCMKNV 194
            D   +   R+ G +G T  A+E  T+  I++  + +  +G +  ++  R  V+  +   
Sbjct: 198 GDHLSRAIGRIAGKDGKTKFAIENATRTRIVLADSKIHILGGFTHIRMARESVVSLILGS 257

Query: 195 HP 196
            P
Sbjct: 258 PP 259

>TBLA0H01830 Chr8 complement(433992..435212) [1221 bp, 406 aa] {ON}
           Anc_5.375 YDR331W
          Length = 406

 Score = 33.5 bits (75), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 34/64 (53%), Gaps = 3/64 (4%)

Query: 79  SMTVKTTRKTFDPAIILKARDLIKLLAR-SVPFPQAVKILQDDIACDVIKI--GNTVANK 135
           ++ V T+R  F+   +  A  + +   R  VP  Q + +L DD+AC+   +  G+   NK
Sbjct: 30  AVIVSTSRFWFNYRHMANALSMYRTFKRLGVPDSQIILMLSDDVACNSRNLFPGSVFNNK 89

Query: 136 DRFV 139
           DRF+
Sbjct: 90  DRFL 93

>KAFR0B03030 Chr2 (632585..633988) [1404 bp, 467 aa] {ON} Anc_8.309
           YLR116W
          Length = 467

 Score = 31.2 bits (69), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 12/24 (50%), Positives = 18/24 (75%)

Query: 145 LVGPNGNTLKALELLTKCYILVQG 168
           L+GP GNTL+ L+  +KC I ++G
Sbjct: 151 LLGPRGNTLRKLQEQSKCKIAIRG 174

>AGL183C Chr7 complement(352996..354519) [1524 bp, 507 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR116W
           (MSL5)
          Length = 507

 Score = 31.2 bits (69), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 12/24 (50%), Positives = 18/24 (75%)

Query: 145 LVGPNGNTLKALELLTKCYILVQG 168
           L+GP GNTLK L+  + C I+++G
Sbjct: 169 LLGPRGNTLKQLQQQSGCKIVIRG 192

>NCAS0A10400 Chr1 complement(2069371..2070525) [1155 bp, 384 aa]
           {ON} Anc_3.244 YBR042C
          Length = 384

 Score = 30.4 bits (67), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 19/81 (23%), Positives = 37/81 (45%), Gaps = 14/81 (17%)

Query: 34  PFAEESSFMTLFPKYREAYLKSIWNDVTRALDKHHIGCTLDLVEGSMTVKTTRKTFDPAI 93
           P+ +E +F          +L ++W D  R LD+++I  T   ++G  T+      F PA+
Sbjct: 305 PYQDEEAF--------SKWLFTVWEDKNRLLDQYYINDTFQGMDGKTTL------FCPAM 350

Query: 94  ILKARDLIKLLARSVPFPQAV 114
            +   D + ++   V F   +
Sbjct: 351 DVNPYDFVTVVFLPVAFGMVL 371

>ZYRO0E04356g Chr5 complement(332059..332619) [561 bp, 186 aa] {ON}
           similar to uniprot|P25348 Saccharomyces cerevisiae
           YCR003W MRPL32 Mitochondrial ribosomal protein of the
           large subunit
          Length = 186

 Score = 29.6 bits (65), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 24/104 (23%), Positives = 47/104 (45%), Gaps = 12/104 (11%)

Query: 116 ILQDDIACDVIKIGNTVANKDRFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMG 175
           I+++D   +  ++      K    K+RQRL  P    LK +  L KC          + G
Sbjct: 57  IVEEDFFSNNGRLLAVPKKKVTHQKKRQRLYAPGKKQLKFIHELNKC---------PSCG 107

Query: 176 PYKGLKEIRRVVLDCMKNVHPIYHIKELMIKRELAKRPELANED 219
            Y   K    + + C+++V  I+  + +  ++E ++  EL++ D
Sbjct: 108 HY---KRANCLCMHCVQHVRHIWKTQTVKERQEPSQEQELSDLD 148

>KNAG0G02350 Chr7 (542717..544210) [1494 bp, 497 aa] {ON} Anc_8.309
           YLR116W
          Length = 497

 Score = 30.4 bits (67), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 12/24 (50%), Positives = 17/24 (70%)

Query: 145 LVGPNGNTLKALELLTKCYILVQG 168
           L+GP GNTLK L+  + C I ++G
Sbjct: 148 LLGPRGNTLKQLQKQSNCKIAIRG 171

>Suva_10.540 Chr10 (933675..935816) [2142 bp, 713 aa] {ON} YLR424W
           (REAL)
          Length = 713

 Score = 30.0 bits (66), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 18/78 (23%), Positives = 36/78 (46%), Gaps = 12/78 (15%)

Query: 8   DKPWDTEDIDKWKIEEFKPEDNKSGQPFAEESSFMTLF------------PKYREAYLKS 55
           D+ W+  +   +++E++K ED+  G+   E+ S    F            PK  E  ++ 
Sbjct: 465 DELWERHNDPIFELEDWKEEDDNGGEEAIEKESGFFYFVKKMRNYAHYFHPKQYELLIRG 524

Query: 56  IWNDVTRALDKHHIGCTL 73
            +N + + L + HI C +
Sbjct: 525 TFNSINKVLYQWHIYCAV 542

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.135    0.397 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 33,484,455
Number of extensions: 1432031
Number of successful extensions: 10340
Number of sequences better than 10.0: 109
Number of HSP's gapped: 10465
Number of HSP's successfully gapped: 117
Length of query: 337
Length of database: 53,481,399
Length adjustment: 110
Effective length of query: 227
Effective length of database: 40,868,139
Effective search space: 9277067553
Effective search space used: 9277067553
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 66 (30.0 bits)