Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
CAGL0B00330g1.5ON1136113653180.0
NDAI0A001401.5ON10916598041e-89
NCAS0B091101.5ON10206207852e-87
Suva_3.1521.5ON11403987115e-77
SAKL0C00462g1.5ON11773747072e-76
TDEL0C069701.5ON9416426931e-75
Kpol_2002.81.5ON9854026932e-75
KAFR0D001401.5ON10413876863e-74
Smik_3.141.5ON11133656771e-72
Skud_3.31.5ON11524246752e-72
TPHA0E040101.5ON9653786515e-70
ZYRO0F18480g1.5ON9603926437e-69
YCL061C (MRC1)1.5ON10963906113e-64
KLLA0C00484g1.5ON9253685709e-60
Ecym_10081.5ON11183425605e-58
TBLA0A075701.5ON12523915449e-56
AFR745W1.5ON10183415293e-54
KLTH0F00484g1.5ON9933594501e-44
Kwal_33.130051.5ON9703654331e-42
KNAG0C002201.5ON1161851452e-08
NDAI0B036102.274ON63163744.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0B00330g
         (1136 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0B00330g Chr2 complement(18031..21441) [3411 bp, 1136 aa] {O...  2053   0.0  
NDAI0A00140 Chr1 complement(8373..11648) [3276 bp, 1091 aa] {ON}...   314   1e-89
NCAS0B09110 Chr2 (1746358..1749420) [3063 bp, 1020 aa] {ON} Anc_...   306   2e-87
Suva_3.152 Chr3 complement(228665..232087) [3423 bp, 1140 aa] {O...   278   5e-77
SAKL0C00462g Chr3 complement(41257..44790) [3534 bp, 1177 aa] {O...   276   2e-76
TDEL0C06970 Chr3 (1264155..1266980) [2826 bp, 941 aa] {ON} Anc_1...   271   1e-75
Kpol_2002.8 s2002 complement(11914..14871) [2958 bp, 985 aa] {ON...   271   2e-75
KAFR0D00140 Chr4 complement(13233..16358) [3126 bp, 1041 aa] {ON...   268   3e-74
Smik_3.14 Chr3 complement(20226..23567) [3342 bp, 1113 aa] {ON} ...   265   1e-72
Skud_3.3 Chr3 complement(6855..10313) [3459 bp, 1152 aa] {ON} YC...   264   2e-72
TPHA0E04010 Chr5 (839903..842800) [2898 bp, 965 aa] {ON} Anc_1.5...   255   5e-70
ZYRO0F18480g Chr6 (1524051..1526933) [2883 bp, 960 aa] {ON} weak...   252   7e-69
YCL061C Chr3 complement(18816..22106) [3291 bp, 1096 aa] {ON}  M...   239   3e-64
KLLA0C00484g Chr3 complement(35397..38174) [2778 bp, 925 aa] {ON...   224   9e-60
Ecym_1008 Chr1 complement(13340..16696) [3357 bp, 1118 aa] {ON} ...   220   5e-58
TBLA0A07570 Chr1 (1874419..1878177) [3759 bp, 1252 aa] {ON} Anc_...   214   9e-56
AFR745W Chr6 (1803046..1806102) [3057 bp, 1018 aa] {ON} Syntenic...   208   3e-54
KLTH0F00484g Chr6 complement(37017..39998) [2982 bp, 993 aa] {ON...   177   1e-44
Kwal_33.13005 s33 complement(36797..39709) [2913 bp, 970 aa] {ON...   171   1e-42
KNAG0C00220 Chr3 complement(33011..36496) [3486 bp, 1161 aa] {ON...    60   2e-08
NDAI0B03610 Chr2 (906622..908517) [1896 bp, 631 aa] {ON} Anc_2.2...    33   4.4  

>CAGL0B00330g Chr2 complement(18031..21441) [3411 bp, 1136 aa] {ON}
            similar to uniprot|P25588 Saccharomyces cerevisiae
            YCL061c
          Length = 1136

 Score = 2053 bits (5318), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1036/1136 (91%), Positives = 1036/1136 (91%)

Query: 1    MDFLFDELEQVKIKKRTTYKKVQVVGTGQGDEIAREDTSNQIVPNNASTSSDSERLLNNV 60
            MDFLFDELEQVKIKKRTTYKKVQVVGTGQGDEIAREDTSNQIVPNNASTSSDSERLLNNV
Sbjct: 1    MDFLFDELEQVKIKKRTTYKKVQVVGTGQGDEIAREDTSNQIVPNNASTSSDSERLLNNV 60

Query: 61   NKKGFLLTSDKLDTIRSRLAQSKDSEVVEDRALINPQIEEQSKEKTFSSEQNNIVVNQSD 120
            NKKGFLLTSDKLDTIRSRLAQSKDSEVVEDRALINPQIEEQSKEKTFSSEQNNIVVNQSD
Sbjct: 61   NKKGFLLTSDKLDTIRSRLAQSKDSEVVEDRALINPQIEEQSKEKTFSSEQNNIVVNQSD 120

Query: 121  DISTQIINEYYDGGEDLDATDIIKNSTQVIYEKRKKNSIWINPRNSKPKKINPTYDTSRL 180
            DISTQIINEYYDGGEDLDATDIIKNSTQVIYEKRKKNSIWINPRNSKPKKINPTYDTSRL
Sbjct: 121  DISTQIINEYYDGGEDLDATDIIKNSTQVIYEKRKKNSIWINPRNSKPKKINPTYDTSRL 180

Query: 181  RNRSSYKTVSXXXXXXXXXXXXGVEETQATQIVSTEKDNSVTTVNLNEEHETSSFLFSNI 240
            RNRSSYKTVS            GVEETQATQIVSTEKDNSVTTVNLNEEHETSSFLFSNI
Sbjct: 181  RNRSSYKTVSDDDIDDDLDDNDGVEETQATQIVSTEKDNSVTTVNLNEEHETSSFLFSNI 240

Query: 241  GVGKSLLFDSEPLIPTQKIAASQNDRSVEINKDDDDYRQTMDASTQIIGATQHVPIETQN 300
            GVGKSLLFDSEPLIPTQKIAASQNDRSVEINKDDDDYRQTMDASTQIIGATQHVPIETQN
Sbjct: 241  GVGKSLLFDSEPLIPTQKIAASQNDRSVEINKDDDDYRQTMDASTQIIGATQHVPIETQN 300

Query: 301  SYLQTIKDHEDKTVGSSKDLHTPNFNPNTSILPLFKNNSSEEAQSETQIDVVHEEVHKTK 360
            SYLQTIKDHEDKTVGSSKDLHTPNFNPNTSILPLFKNNSSEEAQSETQIDVVHEEVHKTK
Sbjct: 301  SYLQTIKDHEDKTVGSSKDLHTPNFNPNTSILPLFKNNSSEEAQSETQIDVVHEEVHKTK 360

Query: 361  ENDTQMDDTQITEVLAITKIEQELENDERAITDKQTEYIPKRSPNVLPAKSQFTKEKLLQ 420
            ENDTQMDDTQITEVLAITKIEQELENDERAITDKQTEYIPKRSPNVLPAKSQFTKEKLLQ
Sbjct: 361  ENDTQMDDTQITEVLAITKIEQELENDERAITDKQTEYIPKRSPNVLPAKSQFTKEKLLQ 420

Query: 421  NFDSSSSDEEDTILGEKQKDQNLSDSESLENNDIMTDQKTSVTPSSEYNGSDNEHXXXXX 480
            NFDSSSSDEEDTILGEKQKDQNLSDSESLENNDIMTDQKTSVTPSSEYNGSDNEH     
Sbjct: 421  NFDSSSSDEEDTILGEKQKDQNLSDSESLENNDIMTDQKTSVTPSSEYNGSDNEHSASIS 480

Query: 481  XXXXXXXXXXWKSSSMILPAYVNNLKQKVENKKLQLXXXXXXXXXXAVIYKLSNKSKATL 540
                      WKSSSMILPAYVNNLKQKVENKKLQL          AVIYKLSNKSKATL
Sbjct: 481  LRSSPISKPRWKSSSMILPAYVNNLKQKVENKKLQLSSDSDDEVDSAVIYKLSNKSKATL 540

Query: 541  LNLXXXXXXXXXXXXXXXXXDSTNLLFNNLRKATKQQIMLHRKELMESRGLNFEDLEKQK 600
            LNL                 DSTNLLFNNLRKATKQQIMLHRKELMESRGLNFEDLEKQK
Sbjct: 541  LNLKVRLSKKKPVKKVHNEKDSTNLLFNNLRKATKQQIMLHRKELMESRGLNFEDLEKQK 600

Query: 601  VMVEDLLEKEIERNLKIREREKRKESNEPLAEQEIMESDYEYSGDEXXXXXXXXXXXXXX 660
            VMVEDLLEKEIERNLKIREREKRKESNEPLAEQEIMESDYEYSGDE              
Sbjct: 601  VMVEDLLEKEIERNLKIREREKRKESNEPLAEQEIMESDYEYSGDESDISNSDIVDNSSI 660

Query: 661  XXXXXXYTEEITYGLKNSNESDKGDNSPAVINGPIELELDNVDDEGDIEIKRSHRTSKKP 720
                  YTEEITYGLKNSNESDKGDNSPAVINGPIELELDNVDDEGDIEIKRSHRTSKKP
Sbjct: 661  SSQQINYTEEITYGLKNSNESDKGDNSPAVINGPIELELDNVDDEGDIEIKRSHRTSKKP 720

Query: 721  FLFSDTESDFQNDDIITDASSSAERLPIDESQETSPENEDHDSSEDIDTEQERIAAIKQQ 780
            FLFSDTESDFQNDDIITDASSSAERLPIDESQETSPENEDHDSSEDIDTEQERIAAIKQQ
Sbjct: 721  FLFSDTESDFQNDDIITDASSSAERLPIDESQETSPENEDHDSSEDIDTEQERIAAIKQQ 780

Query: 781  VKRQQEREVKERKKLQELANKGVNQYFXXXXXXXXXXWRGIGGVDGDDFGEYDSEVEKMI 840
            VKRQQEREVKERKKLQELANKGVNQYF          WRGIGGVDGDDFGEYDSEVEKMI
Sbjct: 781  VKRQQEREVKERKKLQELANKGVNQYFEEEAEESDDEWRGIGGVDGDDFGEYDSEVEKMI 840

Query: 841  DDYSKTEVDLTSLRQKIMDENKEMDLKLVNKILYDIKNGGFRKRGRNDMELEFSDDEDAE 900
            DDYSKTEVDLTSLRQKIMDENKEMDLKLVNKILYDIKNGGFRKRGRNDMELEFSDDEDAE
Sbjct: 841  DDYSKTEVDLTSLRQKIMDENKEMDLKLVNKILYDIKNGGFRKRGRNDMELEFSDDEDAE 900

Query: 901  LQEFRRKRRELMKQRMLENEDTDKLTKNPKSKAFFESMIVDLVEDKNNFDDLSDQIELKE 960
            LQEFRRKRRELMKQRMLENEDTDKLTKNPKSKAFFESMIVDLVEDKNNFDDLSDQIELKE
Sbjct: 901  LQEFRRKRRELMKQRMLENEDTDKLTKNPKSKAFFESMIVDLVEDKNNFDDLSDQIELKE 960

Query: 961  ENITQEDNEKEYNEAKSNKRGKIRISEDFVQKTLSFLHNDESTQEFQPSFIMSKEKGIGD 1020
            ENITQEDNEKEYNEAKSNKRGKIRISEDFVQKTLSFLHNDESTQEFQPSFIMSKEKGIGD
Sbjct: 961  ENITQEDNEKEYNEAKSNKRGKIRISEDFVQKTLSFLHNDESTQEFQPSFIMSKEKGIGD 1020

Query: 1021 MNAXXXXXXXXXXXXXXXXRKIINDEEDVIEEFESFKRPSIIQSFSSKFTIDDKFKDGNK 1080
            MNA                RKIINDEEDVIEEFESFKRPSIIQSFSSKFTIDDKFKDGNK
Sbjct: 1021 MNALKSNSSLSFCSKLSTSRKIINDEEDVIEEFESFKRPSIIQSFSSKFTIDDKFKDGNK 1080

Query: 1081 SVKVSTSYKTVGGSKASITYLGKTRKLVPPKNGPTVRKRNSNNTSRLFNIQNDPFD 1136
            SVKVSTSYKTVGGSKASITYLGKTRKLVPPKNGPTVRKRNSNNTSRLFNIQNDPFD
Sbjct: 1081 SVKVSTSYKTVGGSKASITYLGKTRKLVPPKNGPTVRKRNSNNTSRLFNIQNDPFD 1136

>NDAI0A00140 Chr1 complement(8373..11648) [3276 bp, 1091 aa] {ON}
            Anc_1.5 YCL061C
          Length = 1091

 Score =  314 bits (804), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 255/659 (38%), Positives = 361/659 (54%), Gaps = 62/659 (9%)

Query: 498  LPAYVNNLKQKVENK-KLQLXXXXXXXXXXAVIYKLSNKSKATLLNLXXXXXXXXXXXXX 556
            L  Y N LK  + +K +LQL               +S  SKAT+L +             
Sbjct: 411  LSRYENKLKTVLNSKNQLQLGSDDESSDDTENSLPVSRTSKATILTIKARLSKQKSKKNV 470

Query: 557  XXXXD-STNL--LFNNLRKATKQQIMLHRKELMESRGLNFEDLEKQKVMVEDLLEKEIER 613
                  +TNL  LF NL+K++++QI+ +++EL+E++GLNFED+E +K +VE+LLE+EI+R
Sbjct: 471  QKDGTVNTNLNKLFENLKKSSRKQILENQRELIENKGLNFEDIEMEKELVENLLEQEIKR 530

Query: 614  NLKIREREKRKE--SNEPLAEQEIMESDYEY--SGDEXXXXXXXXXXXXXXXXXXXXYTE 669
            N KIR+REK +E   N       + +SD E+  S +E                      E
Sbjct: 531  NQKIRQREKEREDKKNNANDSDSVNDSDVEFDLSANEQEEQESDAELSDVSKPD---IDE 587

Query: 670  EITYGLKNSNESDKGDNSPAVINGPIELELDNVDDEGDIEI------KRSHRTSKKPFLF 723
            E+ Y  +N +E    D          E  LDNVD + + E       KRS+  + K    
Sbjct: 588  EVVYQRRNIDEDGIQD----------EDVLDNVDADEEEEEAPLQLSKRSNGVTAKIISV 637

Query: 724  SDTESDFQNDDIITDASSSAERLPID--ESQETSPENEDHDSSEDIDT------EQERIA 775
            S+ + D  +     D  +  + L     +SQ+      D D +E++DT      EQERI 
Sbjct: 638  SEDDEDTISKRNAIDLGAYGDNLTTANVKSQDDDDLEVDDDKNENLDTQPLELTEQERID 697

Query: 776  AI---KQQVKRQQEREVKERKKLQELANKGVNQYFXXXXXXXXXXWRGIGGVDGDDFGEY 832
             I   K ++K QQE   K R K +E+  KGV ++F          W GIGG+DG+   EY
Sbjct: 698  IIEAEKTKIKMQQE---KMRHKEKEMMKKGVTKFFEMEAEESEDEWHGIGGIDGEMSDEY 754

Query: 833  DSEVEKMIDDYSKTEVDLTSLRQKIMDENKEMDLKLVNKILYDIKNGGFRKRGRNDMELE 892
            DS+VEKMIDDYSK   D   +R+ +  ENKEMDL ++NKILYDIKNGGFRKR R  +ELE
Sbjct: 755  DSDVEKMIDDYSKANFDPNEIREMLAAENKEMDLNMINKILYDIKNGGFRKRKRGGLELE 814

Query: 893  FSDDEDAE-LQEFRRKRRELMKQRMLE-NEDTDKLTKNPKSKAFFESMIVDLVEDKNNFD 950
             S+DED + L+E+  KR+ELM++R LE  +D  KL KNPKSKAFFESM+ D+ +DKN F+
Sbjct: 815  LSEDEDDDALREYHLKRKELMRKRRLELGDDEKKLVKNPKSKAFFESMVEDITDDKNAFN 874

Query: 951  DLS-DQIELKEENITQEDNE-------KEYNEAKSNKRGKIRISEDFVQKTLSFLHNDES 1002
            D    +   +E N TQ+D +       KE  ++K  K+ K  ISE+FVQ+TLSFL +   
Sbjct: 875  DEPLGETSTQEINNTQDDMKEEDAAVVKENGDSKRIKKKKTIISEEFVQRTLSFLKSSRE 934

Query: 1003 TQEFQPSFIMSKEKGIGD----MNAXXXXXXXXXXXXXXXXRKII-------NDEEDVIE 1051
             +EF  +  ++KE+        ++                  K+I       +D++D   
Sbjct: 935  DEEFAMNENLAKEQHGTKVENLLSLKQQSSIKVFQSPSNNSSKVIKLDDINNDDDDDEDS 994

Query: 1052 EFESFKRPSIIQSFSSKFTIDDKFKDGNKSVKVSTSYKTVGGSKASITYLGKTRKLVPP 1110
                FK PSI++SF SK  I++KF+DGNK+V +S SY+TVG SKASITYLGK+RKL+ P
Sbjct: 995  PIALFKVPSILKSFGSKTDINEKFQDGNKTVTISKSYRTVGSSKASITYLGKSRKLMAP 1053

 Score = 34.3 bits (77), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 41/145 (28%), Positives = 60/145 (41%), Gaps = 36/145 (24%)

Query: 1   MDFLFDELEQVKIKKRTTYKKVQVVGTGQGDEIAREDTSNQIVPNNASTSSDSERLLNNV 60
           MD L D+L+ V   ++TTY K  +      D    E   + I+ +  S  + +  +L   
Sbjct: 1   MDSLIDDLKPVTKVRKTTYNKKSL------DPSIEEQEEDGILTDVTSGGNVTPTILGT- 53

Query: 61  NKKGFLLTSDKLDTIRSRLAQSKDSEVVEDRALINPQIEEQSKEKTFSSEQNNIVVNQSD 120
              GFL  +  +D +R+RL+                   EQ K    SSEQ         
Sbjct: 54  ---GFLFKNSTIDKVRARLS--------------GKNYIEQEKTPLASSEQ--------- 87

Query: 121 DISTQIINEYYDGGEDLDATDIIKN 145
              TQII   Y  GEDL+  D+IK+
Sbjct: 88  --ETQIITNLYTNGEDLEK-DLIKH 109

>NCAS0B09110 Chr2 (1746358..1749420) [3063 bp, 1020 aa] {ON} Anc_1.5
            YCL061C
          Length = 1020

 Score =  306 bits (785), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 246/620 (39%), Positives = 343/620 (55%), Gaps = 30/620 (4%)

Query: 514  LQLXXXXXXXXXXAVIYKLSNKSKATLLNLXXXXXXXXXXXXXXXXXDSTNLLFNNLRKA 573
            +QL          A  + +S  SKATLLNL                  S ++LF NL++A
Sbjct: 379  IQLDSDSDNDSDIAKRFPISRTSKATLLNLKARLSKKKPVKSNKSTNTSLDVLFQNLKQA 438

Query: 574  TKQQIMLHRKELMESRGLNFEDLEKQKVMVEDLLEKEIERNLKIREREKRKESNEPLAEQ 633
            +++QI+ H++EL+E+RG   ED+EK+K +VE+LLE+EI+RN +IR REK+KE +  L+E 
Sbjct: 439  SRKQILDHQRELVENRGFKLEDIEKEKEIVENLLEEEIKRNKRIRMREKQKEKS--LSEN 496

Query: 634  EIMESDYEYSGDEXXXXXXXXXXXXXXXXXXXXYTEEITYG---LKNSNE--SDKGDNSP 688
            E  ++D++ S +E                      EE       L N N    ++GD + 
Sbjct: 497  E--DADFDLSANELEDEEEDGVNDSDNIANSQISDEEDEDSDSVLDNGNHVADEEGDANR 554

Query: 689  AVINGPIELELDNVDDEGDIEIKRSHRTSKKPFLF---SDTESDFQNDDIITDASSSAER 745
               N  I  + + + DE +  I +  R  K P      SD E++    + I D       
Sbjct: 555  EADNSSISSK-NEISDEDEDSIFQLTRKEKHPVRIIQESDDENEINKINTI-DLGVYGGN 612

Query: 746  L--PIDESQETSPENEDHDSSEDID----TEQERIAAIKQQVKRQQEREVKERKKLQELA 799
            L  P   S +T P  +D D     +    TE+ER A I  + KR Q  E K   + +E+ 
Sbjct: 613  LDNPNPLSSQTEPNEDDEDEKSTYENKEITEEERHALILAEKKRIQLIEKKNAARTKEMK 672

Query: 800  NKGVNQYFXXXXXXXXXXWRGIGGVDGDDFGEYDSEVEKMIDDYSKTEVDLTSLRQKIMD 859
             KGVN+ F          W GIGG DG+   EYDSEVEKMIDDYSK+  +   +RQ +  
Sbjct: 673  KKGVNKLFEMEAEESEDEWHGIGGADGEVSDEYDSEVEKMIDDYSKSNFNPDEIRQMLAL 732

Query: 860  ENKEMDLKLVNKILYDIKNG--GFRKRGRNDMELEFSDDEDAELQEFRRKRRELMKQRML 917
            ENKEMDL ++ KILYDIKNG    R+RG  D+EL   D++D EL+E+ +++RELMK+RML
Sbjct: 733  ENKEMDLNMITKILYDIKNGGFRKRRRGGLDLELSDDDEDDEELREYHKRKRELMKKRML 792

Query: 918  ENEDTDKLTKNPKSKAFFESMIVDLVEDKNNFDDLSDQIELKEENITQEDNEKEYNEAKS 977
            E  D  KL KNPKSKAFFESM+ D+V++KN F D+    +   E  TQE+ E++      
Sbjct: 793  EIGDDKKLIKNPKSKAFFESMVEDIVDEKNAFGDIESIEKSSTELDTQEEKEQDVTPGVD 852

Query: 978  NKRGKIRISEDFVQKTLSFLHNDESTQEFQPSFIMSKEK---GIGDMNAXXXXXXXXXXX 1034
             K+    ISE+FVQKTLSFL +    +EF     ++KE+    + D+ +           
Sbjct: 853  KKKN--VISEEFVQKTLSFLRSGRDLEEFNIEEDLAKEQHGENVEDLFSLKQRSTIKEFR 910

Query: 1035 XXXXXRKI--INDEEDV-IEEFESFKRPSIIQSFSSKFTIDDKFKDGNKSVKVSTSYKTV 1091
                   I  IN+ E+V       FK PS+I+SFSS+  I++KFKDGNK+V +S  YKTV
Sbjct: 911  NPSQTNTIDLINNVENVESSPLGGFKPPSVIKSFSSRTDINEKFKDGNKTVTISKVYKTV 970

Query: 1092 GGSKASITYLGKTRKLVPPK 1111
            G SKASITYLGK+RKL+PPK
Sbjct: 971  GSSKASITYLGKSRKLMPPK 990

>Suva_3.152 Chr3 complement(228665..232087) [3423 bp, 1140 aa] {ON}
            YCL061C (REAL)
          Length = 1140

 Score =  278 bits (711), Expect = 5e-77,   Method: Compositional matrix adjust.
 Identities = 176/398 (44%), Positives = 237/398 (59%), Gaps = 46/398 (11%)

Query: 782  KRQQEREVKERKKLQELANKGVNQYFXXXXXXXXXXWRGIGGVDGDDFGEYDSEVEKMID 841
            +RQ+E+E  +  KL+EL +KGV  +F          W G+GG DG+   EYDSEVEKMID
Sbjct: 745  RRQKEKE--QATKLKELKSKGVTNFFEMEAEESEDEWHGVGGADGEGSDEYDSEVEKMID 802

Query: 842  DYSKTEVDLTSLRQKIMDENKEMDLKLVNKILYDIKNGGFR-KRGRNDMELEFSDDEDAE 900
            DYSK + +   +R+ +  ENKEMD+K++NKILYDIKNGGFR KR +N +ELE SDDED  
Sbjct: 803  DYSKNKFNSHEIREMLAAENKEMDVKMINKILYDIKNGGFRNKRAKNSLELELSDDEDDV 862

Query: 901  LQEFRRKRRELMKQRMLENEDTDKLTKNPKSKAFFESMIVDLVEDKNNF--DDLSDQ-IE 957
            LQ++R KRRELM++R LE  D  KL KNPKSKAFFESM+ D++E KN F  +  SDQ + 
Sbjct: 863  LQQYRLKRRELMRKRRLEIGDDTKLVKNPKSKAFFESMVEDIMEFKNPFGAEKESDQDVT 922

Query: 958  LKEENITQEDNEK----------EYNEAKSNKRGKIRISEDFVQKTLSFLHNDESTQEFQ 1007
                ++  +DN+           E+N+   +K  K+ ISEDFVQK+LSFL ++ +  EF+
Sbjct: 923  STATDLDTQDNDNTKPGDNTSNNEHNKHVGDKSKKLIISEDFVQKSLSFLKSN-NYDEFE 981

Query: 1008 PSFIMSK---EKGIGDM----------NAXXXXXXXXXXXXXXXXRKIINDEEDVIEEFE 1054
                +++     G GD+          +                   +IN EE      E
Sbjct: 982  MDRELARIQHGNGEGDVVDLFTLKQHSSIKSFTNSQTNSLSSRTMNTVINLEEHTEGNDE 1041

Query: 1055 S----------FKRPSIIQSFSSKFTIDDKFKDGNKSVKVSTSYKTVGGSKASITYLGKT 1104
                       FK PS+I+SF+S+  I+DKFK+GNK+VK+S SYKTVG SKASITY+GKT
Sbjct: 1042 GENGDQSLIGGFKHPSVIKSFASRTDINDKFKEGNKTVKISKSYKTVGSSKASITYMGKT 1101

Query: 1105 RKLVPPK------NGPTVRKRNSNNTSRLFNIQNDPFD 1136
            RKL+ PK      + P   K++    S+LF    D FD
Sbjct: 1102 RKLMAPKRKTEENHHPNHIKKSKTQKSKLFENGQDSFD 1139

 Score = 70.1 bits (170), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 97/355 (27%), Positives = 156/355 (43%), Gaps = 73/355 (20%)

Query: 291 TQHVPIETQNSYLQTIKDHEDKTVGSSKDLHTPNFNP--NTSILPLFKNNSSEEAQSETQ 348
           TQ +P  T+ S  QT  D     V ++ D  T    P   T   PLF+  +  +    TQ
Sbjct: 237 TQQIP-PTKPSEAQTQAD-----VATANDSDTQQKVPMLTTETSPLFQ--TVPDQSPSTQ 288

Query: 349 IDVVHEEVHKTKENDTQMDDT------QITEVLAITKIEQELE----NDERAITDKQTEY 398
           ++     VH   ++ TQMD        ++   L I +++ EL     N ++A   + TEY
Sbjct: 289 MNTPPPTVH---DDRTQMDTVAQTMQDKVPPTLKIHELQSELALEDFNRKKA---QNTEY 342

Query: 399 IPKRSPNVLPAKSQFTKEKLLQNFDSSSSDEEDTI-LGEKQKDQNLSDSESLENNDIMTD 457
             ++    +P   +F+KE  L +FD+SSSDE+    L   Q  Q  +  E +   DI   
Sbjct: 343 --RKLQKTIPIVKRFSKESFLADFDNSSSDEDTNFKLESSQPKQQQNGYEMI---DI--- 394

Query: 458 QKTSVTPSSEYNGSDNEHXXXXXXXXXXXXXXXWKSSSMILPAYVNNLKQKVENKK---L 514
            +++  P+ + N  D +                      +L  Y NNLK+++++ K   L
Sbjct: 395 SQSNPQPAEKENKKDKK--------------------VPLLSTYANNLKREIDSSKCITL 434

Query: 515 QLXXXXXXXXXXAV----------IYKLSNKSKATLLNLXXXXXXXXXXXXXXXXXDS-- 562
            L           +             +S  SKAT+ NL                 +   
Sbjct: 435 DLDSGSDKDNDNHMDTDKLNEDESALPISQLSKATIFNLKARLSKQNQKLAQGSNKNKDF 494

Query: 563 ---TNLLFNNLRKATKQQIMLHRKELMESRGLNFEDLEKQKVMVEDLLEKEIERN 614
               N L N LRKA+++QI+ H++E++E++G   ED+ K+K +VEDLLE+EI RN
Sbjct: 495 KSDHNKLINTLRKASRKQILDHQREIVETKGFKLEDMVKEKEIVEDLLEQEILRN 549

>SAKL0C00462g Chr3 complement(41257..44790) [3534 bp, 1177 aa] {ON}
            some similarities with uniprot|P25588 Saccharomyces
            cerevisiae YCL061C MRC1 S-phase checkpoint protein found
            at replication forks required for DNA replication also
            required for Rad53p activation during DNA replication
            stress where it forms a replication-pausing complex with
            Tof1p and is phosphorylated by Mec1p protein involved in
            replication checkpoint
          Length = 1177

 Score =  276 bits (707), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 161/374 (43%), Positives = 228/374 (60%), Gaps = 26/374 (6%)

Query: 768  DTEQERIAAIKQQVKRQQEREVKERKKLQELANKGVNQYFXXXXXXXXXXWRGIGGVDGD 827
            D ++E   A++Q + R++E+E K R+K +E+  KGV++ F          W G+GG DG+
Sbjct: 780  DDKEEYEKAMRQVLARKREQEHKIRQKRKEMKRKGVSKMFEMEAEESEDEWHGVGGADGE 839

Query: 828  DFGEYDSEVEKMIDDYSKTEVDLTSLRQKIMDENKEMDLKLVNKILYDIKNGGFRKRGRN 887
               EYDSE+EKM+DDY+KT  D   +RQ +  E+KE D K+VNKIL+DIKNGGFR+RG+ 
Sbjct: 840  LSDEYDSELEKMVDDYTKTTFDPAEIRQMLAAEDKEYDEKIVNKILHDIKNGGFRRRGKG 899

Query: 888  DMELEFSDDEDAELQEFRRKRRELMKQRMLENEDTDKLTKNPKSKAFFESMIVDLVEDKN 947
             +++E SDDED ELQ +  KRREL++Q++LEN +  KL  NPKS AFFESM+ DLVE KN
Sbjct: 900  ALDIELSDDEDDELQRYHAKRRELLRQKVLENGEASKLVSNPKSHAFFESMVEDLVESKN 959

Query: 948  NFD------------DLSDQIELKEENITQEDNEKEYNEAKSNKRGKIRISEDFVQKTLS 995
             F               +D+++   E+ TQ D      +    +R +I+IS++FVQ++LS
Sbjct: 960  PFSIGETADPDSGAISENDKVDNASEHGTQPD---AGGQPVRTERKRIKISQEFVQRSLS 1016

Query: 996  FLHN-DESTQEFQPSFIMSKEKG--IGDMN--------AXXXXXXXXXXXXXXXXRKIIN 1044
            FL++ DE   EF+    ++K +   +GD N                          + ++
Sbjct: 1017 FLNSKDELDNEFELDRRLAKHQHSTLGDDNDDLEDLFTLKQNSCIKTLHTPARTSSRTVD 1076

Query: 1045 DEEDVIEEFESFKRPSIIQSFSSKFTIDDKFKDGNKSVKVSTSYKTVGGSKASITYLGKT 1104
             E D       FK PS+I SFSS+  I++KFK+G K+VKVS SYKT+GGS+ASITYLGK 
Sbjct: 1077 LEVDGNSPANGFKLPSVISSFSSRIDINEKFKEGTKTVKVSKSYKTIGGSRASITYLGKV 1136

Query: 1105 RKLVPPKNGPTVRK 1118
            RKL  PK   + RK
Sbjct: 1137 RKLNAPKRKESGRK 1150

 Score = 87.4 bits (215), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 130/482 (26%), Positives = 202/482 (41%), Gaps = 102/482 (21%)

Query: 237 FSNIGVGKSLLFDSE---PLIPTQKIAASQNDRSVEINKDDDDYRQTMDASTQIIGATQH 293
            SN G G+    DSE    L+PTQ+  A               Y   +      +  ++ 
Sbjct: 106 VSNTGHGQDCDCDSEEQTQLMPTQETGA---------------YESQVVPVIAPVQVSET 150

Query: 294 VPIETQNSYL-----QTIKDHEDKTVG-SSKDLHTPNFNPNTSILPLFKNNSSEEAQSET 347
           +P+   +  L     +T KD      G ++++L  P +   T I+P  +  +S++ Q ET
Sbjct: 151 IPVSINDGLLGESLFKTSKDEVKGNGGNTTRNLAEPCYG-LTQIIPSPQYKNSQQMQLET 209

Query: 348 QIDVVHEEVHKTK-------------END--------------TQMD----------DTQ 370
           Q     +EV KT+             E D              TQ+D          D Q
Sbjct: 210 QEAGETQEVDKTQRILEATARDPTLSEEDFVAATVADGSEAVTTQLDTCVPDTSALGDVQ 269

Query: 371 IT----------EVLAITKIEQEL---ENDERAITDKQTEYIPKRSPNVLPAKSQFTKEK 417
            T          + L I +IE++L   E  E+ IT+ +   +      VL  K +F KE 
Sbjct: 270 PTAPDQSAHRNSQRLLIHEIEKDLDAEEEREKRITEAKPHDV------VLVVKKKFDKEA 323

Query: 418 LLQNFDSSSSDEEDTILGEKQKDQNLSDSESLENNDIMTDQKTSVTPS--SEYNGSDN-- 473
            L NFD SSS+ E+    E+++  +L    + +   + T    +   S  SE  GS N  
Sbjct: 324 FLNNFDCSSSEGEEQEQEEQEEQTHLESEPASKRRKLFTSVPGNPLDSKDSEAGGSGNFA 383

Query: 474 ----EHXXXXXXXXXXXXXXXWKSSSMILPAYVNNLKQKVENKK-LQLXXXXXXXXXXAV 528
                                 ++  + L +Y N LK ++++K+ + L            
Sbjct: 384 SAIAATIGTTTDEGRSTRKDKEEAGWVPLNSYKNQLKARLDSKEHIDLDSSSDEDENSVP 443

Query: 529 IYKLSNKSKATLLNLXXXXXX-----XXXXXXXXXXXDSTNLLFNNLRKATKQQIMLHRK 583
             K+S   KA +L +                       S   LF++L+KA K+QI+ HR+
Sbjct: 444 ASKMS---KAAVLEIKARTSKRQGIKKTRQQPSTPRAPSLKELFSSLKKANKKQILDHRR 500

Query: 584 ELMESRGLNFEDLEKQKVMVEDLLEKEIERNLKIREREKRKESNEPLAEQEIMESDYEYS 643
           E+ E RGLN ED+E++K  VE+LLE+EIERN KIR REK++E  + L EQ+    D  Y 
Sbjct: 501 EITEKRGLNLEDIEREKKEVENLLEQEIERNRKIRLREKQREKKKELDEQQ----DGGYP 556

Query: 644 GD 645
           GD
Sbjct: 557 GD 558

>TDEL0C06970 Chr3 (1264155..1266980) [2826 bp, 941 aa] {ON} Anc_1.5
            YCL061C
          Length = 941

 Score =  271 bits (693), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 229/642 (35%), Positives = 347/642 (54%), Gaps = 69/642 (10%)

Query: 494  SSMILPAYVNNLKQKVE-NKKLQLXXXXXXXXXXAVIYKLSNKSKATLLNLXXXXXXXXX 552
            SS  L AY   LK+K E  K + L          AV    S+++KAT+L L         
Sbjct: 315  SSGALTAYQRELKEKAEIAKGVMLLSESDDEEDLAV--STSHEAKATVLKLKARLSKRRP 372

Query: 553  XXXXXXXXDSTNLLFNNLRKATKQQIMLHRKELMESRGLNFEDLEKQKVMVEDLLEKEIE 612
                     S + L  NLR +TK+QI+  +KE +E +GL FED+EK+K +VE+LLE+EI 
Sbjct: 373  PVESQHGKASLSALMKNLRNSTKRQILDRQKEGIERQGLKFEDVEKEKEIVENLLEQEIA 432

Query: 613  RNLKIREREKRK-ESNE------PLAEQEIMESDYEYSGDEXXXXXXXXXXXXXXXXXXX 665
            RN +IR +EK K + N+      P   +E  +S+Y  S ++                   
Sbjct: 433  RNKRIRMKEKEKAQMNDVPSLALPNRVEEDNDSNYSVSDEDSV----------------- 475

Query: 666  XYTEEITYGLKNSNESDKGDNSPAVINGPIELELDNVDDEGDIEI--KRSHRTSKKPFLF 723
               E++ Y    S+  D G N P + +    +E+D+  DE DI     ++H+ S    L 
Sbjct: 476  -IKEDLDYSDLESD--DSGSNEPKIASDSAGVEIDS--DEDDIRFMKGKAHKIS----LL 526

Query: 724  SDTESDFQNDDIITDASSSAERLPIDESQETSPENEDHDSSEDIDTEQERIAAIKQQVKR 783
            +D ES+ + D  +  A +        ++  T+ ++E H S+E+  T+   +  I +   R
Sbjct: 527  NDDESEEEEDLTVNSAINLG---AYGDNLITTTKDEAHTSAEEHTTQ--LVNEISESQYR 581

Query: 784  QQERE------VKERKKLQELANKGVNQYFXXXXXXXXXXWRGIGGVDGDDFGEYDSEVE 837
              E+E       +E+++L+++   GV   F          WRG+GGVDG+   +YDS++E
Sbjct: 582  TMEKEKSKIRAQEEKQRLKQMKESGVTNMFDMEAEESDDEWRGVGGVDGETIDDYDSDLE 641

Query: 838  KMIDDYSKTEVDLTSLRQKIMDENKEMDLKLVNKILYDIKNGGFRKRGRNDMELEFSDDE 897
            KMIDD+S T  +   +RQ +M ENKE DLK VNKIL+DIKNGGFRKR +N+++LE SDDE
Sbjct: 642  KMIDDFSNTTSNADQIRQLLMAENKETDLKTVNKILHDIKNGGFRKRRQNNLQLELSDDE 701

Query: 898  DAELQEFRRKRRELMKQRMLE-NEDTDKLTKNPKSKAFFESMIVDLVEDKNNFDDLSDQI 956
            D EL  +++++ ELM++R L+   D  KL KN +SKAFFESM+ D+++ K+ F   S+Q 
Sbjct: 702  DDELLNYKKRKLELMRKRRLQFGADDKKLLKNSRSKAFFESMVEDIIDLKDPF---SNQA 758

Query: 957  ELKEENITQEDNEKEYNEAKSNKRGKIRISEDFVQKTLSFLHNDESTQEFQPSFIMSKEK 1016
            E      T E ++K      ++ + K  IS +FVQ++LSFL +     EF+ + +  + +
Sbjct: 759  E------TSEKDKKSEGLVDASNKQKDTISHEFVQQSLSFLSSSRDFSEFEVARVSQEGE 812

Query: 1017 GIGDMNAXXXXXXXXXXXXXXXXRKIINDEEDV-IEEFESFKRP------SIIQSFSSKF 1069
               D+N+                  II++ E    EEF++   P      S+++SF    
Sbjct: 813  RNTDLNSLKQDSTVKTLYAPSN---IISESERADHEEFDNSVLPVESSYSSVVKSFGFDL 869

Query: 1070 TIDDKFKDGNKSVKVSTSYKTVGGSKASITYLGKTRKLVPPK 1111
              +DK K+G K+V VS SY+TVGG+KASITYLGK RKLV PK
Sbjct: 870  NANDKLKEGRKTVTVSKSYRTVGGNKASITYLGKMRKLVAPK 911

>Kpol_2002.8 s2002 complement(11914..14871) [2958 bp, 985 aa] {ON}
            complement(11914..14871) [2958 nt, 986 aa]
          Length = 985

 Score =  271 bits (693), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 183/402 (45%), Positives = 252/402 (62%), Gaps = 23/402 (5%)

Query: 751  SQETSPE--NEDHDSSEDIDTEQERIAAIKQQVKRQQEREVKERKKLQELANKGVNQYFX 808
            SQE + E  N D D SED +  +E    +K+++ R++++E K+R+KL+EL +KG+   F 
Sbjct: 590  SQENNNERNNIDSDESEDEELYKE---MVKKEIDRRRDQERKQRQKLRELKDKGITDMFE 646

Query: 809  XXXXXXXXXWRGIGGVDGDDFGEYDSEVEKMIDDYSKTEVDLTSLRQKIMDENKEMDLKL 868
                     W GIGGVDG+   EYDSEVEKMIDDYSK   +   +R+K+  ENK+MDLK+
Sbjct: 647  VEAEESEDEWHGIGGVDGELSDEYDSEVEKMIDDYSKENFNAGEIREKLAAENKDMDLKM 706

Query: 869  VNKILYDIKNGGFRKRGRNDMELEFSDDEDAELQEFRRKRRELMKQRMLENEDTDKLTKN 928
            VN+IL DIKNGGFRKR RN +E+E SDDED +L+ +R KRR+LMK++ LE +   KL  N
Sbjct: 707  VNRILNDIKNGGFRKR-RNALEIELSDDEDDDLKAYRAKRRQLMKEKRLETDHNKKLMTN 765

Query: 929  PKSKAFFESMIVDLVEDKNNFDDLSDQIELKEENITQEDNEKEYNEAK-SNKRGKIRISE 987
             KS AF ESM+ D+VE KN FD+  D I    ++  + D E + N  +  NK+ K  +SE
Sbjct: 766  KKSHAFLESMVDDIVEVKNPFDERDDNI---MDDTPETDAEGDVNSNELLNKKKKFILSE 822

Query: 988  DFVQKTLSFLHNDESTQEFQPSFIMSKEK---GIGDMNAXXXXXXXXXXXXXXXXR-KII 1043
             FVQK+LSFL +  + +EF+ +  ++KE+      DM A                    I
Sbjct: 823  AFVQKSLSFLSSSRNLEEFEMNNNLAKEQHSHAATDMFALKSHCSIKSLESLPGSHNNSI 882

Query: 1044 NDEEDVIEE------FESFKRPSIIQSFSSKFTIDDKFKDGNKSVKVSTSYKTVGGSKAS 1097
            + + D++ E      F   K+ S+I+SFSS   ID KFKDGNK+VKVS SY+TVG +KAS
Sbjct: 883  SSKLDLLHEEIVSTPFSGLKQTSVIKSFSSSIDIDSKFKDGNKTVKVSKSYRTVGSAKAS 942

Query: 1098 ITYLGKTRKLVPPK---NGPTVRKRNSNNTSRLFNIQNDPFD 1136
            ITYLGK RKLVPPK   + P   K  + + SRLF+ Q++ F+
Sbjct: 943  ITYLGKARKLVPPKKKEHKPHSHKSKTASASRLFDEQDNSFE 984

 Score = 40.4 bits (93), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 47/160 (29%), Positives = 67/160 (41%), Gaps = 52/160 (32%)

Query: 1   MDFLFDELEQVKIKKRTTYKKVQVVGTGQGDEIAREDTSNQIVPNNASTSSDSERLLNNV 60
           MDF+FD L+ +K KKRTTYKKV     G  ++  +    N  +P    +           
Sbjct: 1   MDFVFDGLDALKGKKRTTYKKVT---DGDVEDEPKISEFNIELPGLGQS----------- 46

Query: 61  NKKGFLLTSDKLDTIRSRL-AQSKDSEVVEDRALINPQIEEQSKEKTFSSEQNNIVVNQS 119
                L  + KL  IR+RL   + DSE                     SS+    V+   
Sbjct: 47  ----ILFNNSKLKQIRNRLEGNNNDSE-------------------NDSSQAETQVI--- 80

Query: 120 DDISTQIINEYYDGGEDLD---------ATDIIKNSTQVI 150
               TQII+  Y+GGEDL+          T I+++ TQ+I
Sbjct: 81  --ADTQIISNLYEGGEDLEEKEERRFLQRTQIVEDHTQII 118

>KAFR0D00140 Chr4 complement(13233..16358) [3126 bp, 1041 aa] {ON}
            Anc_1.5 YCL061C
          Length = 1041

 Score =  268 bits (686), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 163/387 (42%), Positives = 235/387 (60%), Gaps = 23/387 (5%)

Query: 770  EQERIAAIKQQVKRQQEREVKERKKLQELANKGVNQYFXXXXXXXXXXWRGIGGVDGDDF 829
            E++RI  I+++ + + ER+ K+ KK +E+  KG+  +           W GIGG+DG+  
Sbjct: 657  EKDRIRLIEEKKQHELERQRKQMKKRKEMKAKGITNFLEEEAEESEDEWHGIGGIDGEMS 716

Query: 830  GEYDSEVEKMIDDYSKTEVDLTSLRQKIMDENKEMDLKLVNKILYDIKNGGFRKRGRNDM 889
             EYDSEVEKMIDDYSK   +   +RQ + DENKE D+K+V KILYDIKNGGFRKR +  M
Sbjct: 717  DEYDSEVEKMIDDYSKANFNPDEIRQMLADENKETDIKMVEKILYDIKNGGFRKRRKGAM 776

Query: 890  ELEFSDDEDAELQEFRRKRRELMKQRMLENEDTDKLTKNPKSKAFFESMIVDLVEDKNNF 949
            +LE SD+ED EL+++R KRRELM+Q+ LE  + + L KNPKSKAFFESM+ D+VE KN F
Sbjct: 777  DLELSDEEDDELKQYRLKRRELMRQKRLEVGEAETLVKNPKSKAFFESMVDDIVEVKNPF 836

Query: 950  DDLSDQIE--LKEENITQEDNEKEYNEAKSNKRGKIRISEDFVQKTLSFLHNDESTQEFQ 1007
                 Q    +  ++ TQE+       A  N   K+ +SE+FVQ+TLSFL++ +   +F 
Sbjct: 837  AVFEPQRSGTITTDDGTQENANSNEGAASQNPSKKVMLSEEFVQRTLSFLNSSKDMDQFA 896

Query: 1008 PSFIMSKEKG---IGDMNAXXXXXXXXXXXXXXXXRKIINDE--------EDVIEEF--E 1054
            P+  M  E     I D+ A                R  ++ E        +D  ++    
Sbjct: 897  PARSMRAEANDELIEDLTA---LKKQSSIKSFKTTRASVSQEPTDFDKENDDSFDDLLNS 953

Query: 1055 SFKRPSIIQSFSSKFTIDDKFKDGNKSVKVSTSYKTVGGSKASITYLGKTRKLVPPK--- 1111
                 SI+++FS+   I+DKF++G K+VKVS +YK+V  SKASITY+GK RKLV P+   
Sbjct: 954  RVGTSSIMKTFSATVDINDKFQEGVKTVKVSKAYKSVSSSKASITYMGKMRKLVAPQKKV 1013

Query: 1112 -NGPTVRKRNSNN-TSRLFNIQNDPFD 1136
             N  +   +N+N+ TS+LF+ Q++ F+
Sbjct: 1014 ANLSSSDIKNTNSRTSKLFSRQDESFE 1040

 Score = 82.4 bits (202), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 49/118 (41%), Positives = 73/118 (61%), Gaps = 23/118 (19%)

Query: 529 IYKLSNKSKATLLNLXXXXXXXXXXXXXXXXXDSTNLLFNNLRKATKQQIMLHRKELMES 588
           I K+SN SK TL                       + LFN L+KA++QQI+ H+KE++E 
Sbjct: 452 IVKISNDSKTTL-----------------------HTLFNKLQKASRQQIIEHQKEVIEK 488

Query: 589 RGLNFEDLEKQKVMVEDLLEKEIERNLKIREREKRKESNEPLAEQEIMESDYEYSGDE 646
           +GLN ED+EK+K +VE+LLE+EI RN KIR+REK +E     A+ +  + D+++S +E
Sbjct: 489 KGLNLEDIEKEKKIVENLLEQEINRNKKIRQREKEREKQLADAQDDENDLDFDHSANE 546

 Score = 42.0 bits (97), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 40/154 (25%), Positives = 66/154 (42%), Gaps = 48/154 (31%)

Query: 1   MDFLFDELEQVKIKKRTTYKKVQVVGTGQGDEIAREDTSNQIVPNNASTSSDSERLLNNV 60
           MD +F  L+ +K KKRTTYKK+        D++           N+ S S++    L   
Sbjct: 1   MDGIFGNLQALKPKKRTTYKKI-------SDDLE----------NDTSESNNDPPALTG- 42

Query: 61  NKKGFLLTSDKLDTIRSRLAQSKDSEVVEDRALINPQIEEQSKEKTFSSEQNNIVVNQSD 120
             +GFL  +  L+ I+ RL                              E+ ++V    +
Sbjct: 43  --EGFLFDNPTLNRIKKRL----------------------------DGEEKDVVQYTMN 72

Query: 121 DISTQIINEYYDGGEDLDATDIIKNSTQVIYEKR 154
              TQ+I+  Y GGEDLDA ++ +   Q ++E++
Sbjct: 73  FSQTQLISNLYGGGEDLDAPEVERREKQQLHEQQ 106

>Smik_3.14 Chr3 complement(20226..23567) [3342 bp, 1113 aa] {ON}
            YCL061C (REAL)
          Length = 1113

 Score =  265 bits (677), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 162/365 (44%), Positives = 221/365 (60%), Gaps = 41/365 (11%)

Query: 785  QEREVKERKKLQELANKGVNQYFXXXXXXXXXXWRGIGGVDGDDFGEYDSEVEKMIDDYS 844
            +++E+++  KL+EL +KGV  +F          W GIGG DG+   EYDS+VEKMIDDYS
Sbjct: 720  RQKELEKAIKLKELKHKGVTNFFEMEAEESDDEWHGIGGADGEGSDEYDSDVEKMIDDYS 779

Query: 845  KTEVDLTSLRQKIMDENKEMDLKLVNKILYDIKNGGFR-KRGRNDMELEFSDDEDAELQE 903
            K   +   +R+ +  ENKEMD+K++NKILYDIKNGGFR KR +N +ELE SDDED  LQ+
Sbjct: 780  KNNFNSHEIREMLAAENKEMDVKMINKILYDIKNGGFRNKRAKNSLELELSDDEDDVLQQ 839

Query: 904  FRRKRRELMKQRMLENEDTDKLTKNPKSKAFFESMIVDLVEDKNNF--DDLSDQ-IELKE 960
            +R KRRELM++R LE  D  KL KNPKSKAFFESM+ D++E KN F  ++ S+Q I    
Sbjct: 840  YRLKRRELMRKRRLEIGDGTKLVKNPKSKAFFESMVEDIMEYKNPFRAEEESNQDITSTA 899

Query: 961  ENITQEDNEK--EYNEAKSNKRG-------KIRISEDFVQKTLSFL-------------- 997
             ++   DN      +  ++N++G       KI ISEDFVQK+LSFL              
Sbjct: 900  TDLDTLDNNSLNVRDSTRNNEKGPVDDKSKKIIISEDFVQKSLSFLKSNNYNEFEMDKEL 959

Query: 998  ------HNDESTQEFQPSFIMSKEKGIGDMNAXXXXXXXXXXXXXXXXRKIINDEEDVIE 1051
                  ++DE  ++    F + +   I                      +   ++ED +E
Sbjct: 960  AKMQHGNDDEPIEDL---FTLKQHSSIKSFTNSQTDSFTSRTVTTMIDLEKRTEDEDEME 1016

Query: 1052 EFES-----FKRPSIIQSFSSKFTIDDKFKDGNKSVKVSTSYKTVGGSKASITYLGKTRK 1106
              +S     FK PSI++SF+S+  I+DKFK+GNK+VK+S SYK VG SKASITY+GKTRK
Sbjct: 1017 NGDSSLVSGFKHPSIVKSFASRTDINDKFKEGNKTVKISKSYKMVGSSKASITYMGKTRK 1076

Query: 1107 LVPPK 1111
            L+ PK
Sbjct: 1077 LMAPK 1081

 Score = 35.0 bits (79), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 39/142 (27%), Positives = 61/142 (42%), Gaps = 37/142 (26%)

Query: 1   MDFLFDELEQVKIKKR-TTYKKVQVVGTGQGDEIAREDTSNQIVPNNASTSSDSERLLNN 59
           MD   + L  ++ KKR TTYKKV +      D       +N IV   A T +        
Sbjct: 1   MDDALNALSSLRSKKRVTTYKKVAIHIPDDNDNTDGNLYTNDIVAPPALTGN-------- 52

Query: 60  VNKKGFLLTSDKLDTIRSRLAQSKDSEVVEDRALINPQIEEQSKEKTFSSEQNNIVVNQS 119
               GFL  +  L+ +++RL   K            P+ E  +K+            ++ 
Sbjct: 53  ----GFLFANATLNRVKNRLEGGK-----------APEQEHDNKD------------DED 85

Query: 120 DDIST-QIINEYYDGGEDLDAT 140
           +D+S+ Q+I   Y+GGEDL+ T
Sbjct: 86  EDVSSSQLIANLYEGGEDLEET 107

>Skud_3.3 Chr3 complement(6855..10313) [3459 bp, 1152 aa] {ON} YCL061C
            (REAL)
          Length = 1152

 Score =  264 bits (675), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 174/424 (41%), Positives = 241/424 (56%), Gaps = 57/424 (13%)

Query: 760  DHDSSEDIDTEQERIAAIKQQVKRQQEREVKERKKLQELANKGVNQYFXXXXXXXXXXWR 819
            D + SE I   +E I   K Q+++++++ V E   L+E  +KG+  +F          W 
Sbjct: 738  DEEVSEAI--RRELIDKKKSQLRQKEKKHVAE---LKEFKSKGITNFFEMEAEESEDEWH 792

Query: 820  GIGGVDGDDFGEYDSEVEKMIDDYSKTEVDLTSLRQKIMDENKEMDLKLVNKILYDIKNG 879
            G+GG DG+   EYDSEVEKMIDDYSK   +   +R+ +  ENKEMD+K++N+ILYDIKNG
Sbjct: 793  GVGGADGEGSEEYDSEVEKMIDDYSKNSFNSHEIREMLAAENKEMDVKMINRILYDIKNG 852

Query: 880  GFR-KRGRNDMELEFSDDEDAELQEFRRKRRELMKQRMLENEDTDKLTKNPKSKAFFESM 938
            GFR KR +N +ELE SDDED  LQ++R KRRELM++R LE  D  KL KNPKSKAFFESM
Sbjct: 853  GFRNKRAKNSLELELSDDEDDVLQQYRLKRRELMRKRRLEIGDDTKLVKNPKSKAFFESM 912

Query: 939  IVDLVEDKNNF-------DDLSDQ---IELKEENITQEDNEKEYNEAKS--NKRGKIRIS 986
            + D++E KN F        DL+     ++ ++ +  Q  +    NE +   ++  K  IS
Sbjct: 913  VEDIMEFKNPFKAEEESHQDLTSTATDLDTQDNDSIQIGDSTRNNEHRRVDDRSKKTIIS 972

Query: 987  EDFVQKTLSFLHNDESTQEFQPSFIMSKEKG-----IGD--------MNAXXXXXXXXXX 1033
            EDFVQK+LSFL ++   +     F M KE+      IGD        +            
Sbjct: 973  EDFVQKSLSFLRSNNYDE-----FEMDKERARIQHDIGDEGVEDLFTLKQHSSIKSFTNS 1027

Query: 1034 XXXXXXRKIINDEEDVIEEFE--------------SFKRPSIIQSFSSKFTIDDKFKDGN 1079
                   K +N   D+ +  E               FK PSII+SF+S+  I+DKFK+GN
Sbjct: 1028 PTDSLSSKRVNSMIDLEQPTEDNNEVENEDPSLIGGFKHPSIIKSFASRTDINDKFKEGN 1087

Query: 1080 KSVKVSTSYKTVGGSKASITYLGKTRKLVPPKNGPTVRKRNSNNT-------SRLFNIQN 1132
            K+VK+S +YKTVG SKASITY+GKTRKL+ PK        +++++       S+LF    
Sbjct: 1088 KTVKISKTYKTVGSSKASITYMGKTRKLMAPKKKADRDHHHNHHSKAWKTQKSKLFESGQ 1147

Query: 1133 DPFD 1136
            D FD
Sbjct: 1148 DSFD 1151

 Score = 32.7 bits (73), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 41/141 (29%), Positives = 63/141 (44%), Gaps = 35/141 (24%)

Query: 1   MDFLFDELEQVKIKKR-TTYKKVQVVGTGQGDEIAREDTSNQIVPNNASTSSDSERLLNN 59
           MD + + L  +  KKR TTYKK+        D++  +  SN +    A T +        
Sbjct: 56  MDNVLEVLSSLTSKKRVTTYKKIASPIPDGDDDVDGDLLSNNMGAPPALTGN-------- 107

Query: 60  VNKKGFLLTSDKLDTIRSRLAQSKDSEVVEDRALINPQIEEQSKEKTFSSEQNNIVVNQS 119
               GFL  +  L+ +++RL   +  +V ED    + QI++   E               
Sbjct: 108 ----GFLFGNATLNRVKNRL---EGIDVPED----DRQIKDNENE--------------- 141

Query: 120 DDISTQIINEYYDGGEDLDAT 140
           D +STQ+I   YDGGEDL+ T
Sbjct: 142 DAVSTQLIANLYDGGEDLEET 162

>TPHA0E04010 Chr5 (839903..842800) [2898 bp, 965 aa] {ON} Anc_1.5
            YCL061C
          Length = 965

 Score =  255 bits (651), Expect = 5e-70,   Method: Compositional matrix adjust.
 Identities = 161/378 (42%), Positives = 223/378 (58%), Gaps = 16/378 (4%)

Query: 775  AAIKQQVKRQQEREVKERKKLQELANKGVNQYFXXXXXXXXXXWRGIGGVDGDDFGEYDS 834
            A I + +++Q+E E +E K+L+E+   GV++ F          W GIGGVD D    YDS
Sbjct: 588  AIISEGIRKQKELEKREAKRLKEMKTSGVSKMFEVEAEESEDEWHGIGGVDSDFSDAYDS 647

Query: 835  EVEKMIDDYSKTEVDLTSLRQKIMDENKEMDLKLVNKILYDIKNGGFRKRGRNDMELEFS 894
            EVEKMIDDYS+   + + +R+ +  ENKE DL LVNKILYDIKNGGFR R R D +LEFS
Sbjct: 648  EVEKMIDDYSRQNFNPSEIREMLAKENKETDLALVNKILYDIKNGGFRTRKRRDRDLEFS 707

Query: 895  DDEDAELQEFRRKRRELMKQRMLENEDTDKLTKNPKSKAFFESMIVDLVEDKNNFDDLSD 954
            DD+D +L+ +R KRR LM+++ L+ E   K+ KNPKSKAFFES++ D++E KN FDD++ 
Sbjct: 708  DDDDDDLKAYRAKRRALMREKRLDIEGDKKIVKNPKSKAFFESIVDDIIETKNPFDDMNT 767

Query: 955  QIEL---KEENITQEDNEKEYNEAKSNKRGKIRISEDFVQKTLSFLHNDESTQEFQPSFI 1011
             IE    KE      DN+++     + K+ KI ISE+FVQ++LSFL++     EF+ +  
Sbjct: 768  SIEQIVEKETPTVDIDNDEKLATNVTKKKKKIVISEEFVQRSLSFLNSCREQDEFEINNQ 827

Query: 1012 M-SKEKGIGDMNAXXXXXXXXXXXXXXXXRKIINDEEDVIEE---------FESFKRPSI 1061
                EK     +                     +     + E         F   ++ S+
Sbjct: 828  HNGGEKATSTADLYTLKRYSSIKTLQSVTSSRSSSIASNLNEQPSQSSGSLFNDLRKTSV 887

Query: 1062 IQSFSSKFTIDDKFKDGNKSVKVSTSYKTVGGSKASITYLGKTRKLVPPKNG--PTVRKR 1119
            + SFSS   I+ KFK+G KSVKVS +YKTVG ++ASITY+G +R+LV PK     T  K 
Sbjct: 888  LNSFSSDVDINSKFKEGTKSVKVSNAYKTVGSARASITYMGTSRRLVAPKKSRLTTSSKA 947

Query: 1120 NSNNT-SRLFNIQNDPFD 1136
            NS  T SRLF+ Q   F+
Sbjct: 948  NSRTTPSRLFDNQEGSFE 965

 Score = 40.0 bits (92), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 53/159 (33%), Positives = 68/159 (42%), Gaps = 41/159 (25%)

Query: 1   MDFLFDELEQVKIKKRTTYKKVQVVGTGQGDEIAREDTSNQIVPNNASTSSDSERLLNNV 60
           MD LFD+L   K KKRTTY K+        D +  E  S  I+ N   T+ +  +L    
Sbjct: 1   MDSLFDQLNHFK-KKRTTYDKIP------HDLLEEEQESEDILKN--KTAKEISQL---- 47

Query: 61  NKKGFLLTSDKLDTIRSRLA------QSKDSEVVEDRALINPQIEEQSKEKTFSSEQNNI 114
              G L  +  L  IR+RL       + K  E  E    I  +  EQ   + F       
Sbjct: 48  -DGGILFGNSILGQIRNRLNNIDNEDKDKGKEASES---ITSKDNEQDSTQIFPQ----- 98

Query: 115 VVNQSDDISTQIINEYYDGGEDLDATDIIKNS---TQVI 150
                    TQIIN  YDGGEDL+  +I  NS   TQ+I
Sbjct: 99  ---------TQIINNLYDGGEDLE-NEIFHNSFKKTQII 127

>ZYRO0F18480g Chr6 (1524051..1526933) [2883 bp, 960 aa] {ON} weakly
            similar to uniprot|P25588 Saccharomyces cerevisiae
            YCL061C MRC1 S-phase checkpoint protein found at
            replication forks required for DNA replication also
            required for Rad53p activation during DNA replication
            stress where it forms a replication-pausing complex with
            Tof1p and is phosphorylated by Mec1p protein involved in
            replication checkpoint
          Length = 960

 Score =  252 bits (643), Expect = 7e-69,   Method: Compositional matrix adjust.
 Identities = 158/392 (40%), Positives = 235/392 (59%), Gaps = 32/392 (8%)

Query: 762  DSSEDIDTEQERI-AAIKQQVKRQQEREVKERKKLQELANKGVNQYFXXXXXXXXXXWRG 820
            DS+E    E+E+    I +++++ + R+ K+ ++L+++  KG+N+            W+G
Sbjct: 583  DSAEIDAAEEEKTNELIMEKIRKIEMRKKKKEQRLKDMKAKGLNKMLEMEAEESEDEWKG 642

Query: 821  IGGVDGDDFGEYDSEVEKMIDDYSKTEVDLTSLRQKIMDENKEMDLKLVNKILYDIKNGG 880
            +GGVDGD   E+DS++E+MIDD++K+  +   +RQ +  ENKE+D K+VNKILYDIKNGG
Sbjct: 643  VGGVDGDLSDEHDSDLEEMIDDFTKSNENFDDVRQLLAKENKELDEKMVNKILYDIKNGG 702

Query: 881  FRKRGRNDMELEFSDDEDAELQEFRRKRRELMKQRMLENEDTDKLTKNPKSKAFFESMIV 940
            FRKRGRN ++LE SDDED +L+ +R KRRELMK+  +E +D +K  +N KSKAF ESM+ 
Sbjct: 703  FRKRGRNALDLELSDDEDEDLRNYRLKRRELMKKSRIEGKDKEKAFRNAKSKAFLESMVD 762

Query: 941  DLVEDKNNFDDLSDQIELKEENITQEDNEKEYNEAKSNKRGKIRISEDFVQKTLSFLHND 1000
            D+ E KN F D    +E   +  TQE      N+   NK  K  +S++FVQ++LSFL N+
Sbjct: 763  DIDESKNPFGDPEMDVEDNTDVDTQE------NDYPKNKE-KNTLSQEFVQRSLSFLSNN 815

Query: 1001 ESTQEFQPSFIMSKEKGIGD---------MNAXXXXXXXXXXXXXXXXRKIINDEEDVIE 1051
             S++EF+    + ++  +GD          N+                 K  N +ED I 
Sbjct: 816  NSSREFE----LGEQITLGDEEQDVSSLKRNSSIHALHNSSSPIKEDLEK-ENQDEDFI- 869

Query: 1052 EFESFKRPSIIQSFSSKFTIDDKFKDGNKSVKVSTSYKTVGGSKASITYLGKTRKLVPPK 1111
               +FK PS+I+S +  F  ++KF+ G K+V VS SY+ VGGS++SITY GK RKLV PK
Sbjct: 870  TLPNFKPPSLIKSLAGGFDPNNKFQSGKKTVTVSKSYRAVGGSRSSITYFGKMRKLVGPK 929

Query: 1112 N-------GPTVRKRNSNNTSRLFNIQNDPFD 1136
            N       GP  R  +     +L+  Q + FD
Sbjct: 930  NRNSTLSKGP--RPASKPTMGKLWESQQNSFD 959

 Score = 71.6 bits (174), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 89/314 (28%), Positives = 139/314 (44%), Gaps = 58/314 (18%)

Query: 347 TQIDVVHEEVHKTKENDTQMDDTQITEVLAITKIEQELENDERAITD--KQTEY-IPKRS 403
           TQ+D+ +  + +  ++D      Q    L +  IE+ELE ++R   D  +  EY  P++ 
Sbjct: 213 TQLDISNSLLFQATDSDIPKSPPQ---RLKMHDIEKELE-EKRQERDHRRNIEYRAPEKP 268

Query: 404 PNVLPAKSQFTKEKLLQNFDSSSSDEEDTI-LGEK--QKDQNLSDSESLENNDIMTDQKT 460
            NV   K  F+KE  L+NFD  SS E++ I L  +  +K     D  +LEN         
Sbjct: 269 VNV---KRVFSKEAFLKNFDEESSSEDELIELRSRDIEKKHTEKDKSTLEN--------- 316

Query: 461 SVTPSSEYNGSDNEHXXXXXXXXXXXXXXXWKSSSMILPAYVNNLKQKVENKKLQLXXXX 520
             T SS+                             +   Y   LK ++++K+       
Sbjct: 317 -TTESSQ--------------------------RQRVFSVYEYKLKGELDSKRCIQLDDD 349

Query: 521 XXXXXXAVIYKLSNKSKATLLNLXXXXXXXXXXXXXXXXXDSTNLLFNNLRKATKQQIML 580
                  V   LS  SKAT+L++                  + N L   L+KA+K+QI  
Sbjct: 350 EDESDEDVEVPLSRVSKATVLDIKARRSKQEPLSKIKQKKTTLNDLICTLKKASKKQITD 409

Query: 581 HRKELMESRGLNFEDLEKQKVMVEDLLEKEIERNLKIREREKRKESNEPLAEQEIME--- 637
           H+ ELM+SRG   ED+EKQK  +E+LLE+EI RN ++  RE  ++++  L ++       
Sbjct: 410 HQNELMKSRGYKLEDIEKQKEEIENLLEQEIARNKRLARRENEEDNSNDLEDRSYGSGNE 469

Query: 638 ------SDYEYSGD 645
                 SD E+SGD
Sbjct: 470 SENSAFSDIEFSGD 483

>YCL061C Chr3 complement(18816..22106) [3291 bp, 1096 aa] {ON}
            MRC1S-phase checkpoint protein required for DNA
            replication; interacts with and stabilizes Pol2p at
            stalled replication forks during stress, where it forms a
            pausing complex with Tof1p and is phosphorylated by
            Mec1p; protects uncapped telomeres
          Length = 1096

 Score =  239 bits (611), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 162/390 (41%), Positives = 230/390 (58%), Gaps = 47/390 (12%)

Query: 765  EDIDTEQERIAAIKQQVKRQQEREVKERKK-----LQELANKGVNQYFXXXXXXXXXXWR 819
            +D+   +E   AI++Q+  +++ ++K+++K     ++EL  +GV  +F          W 
Sbjct: 672  DDVYVNEEADEAIRRQLIDKEKLQLKQKEKEHEAKIKELKKRGVTNFFEMEAEESEDEWH 731

Query: 820  GIGGVDGDDFGEYDSEVEKMIDDYSKTEVDLTSLRQKIMDENKEMDLKLVNKILYDIKNG 879
            GIGG DG+   +YDS++EKMIDDYSK   +   +R+ +  ENKEMD+K++NKILYDIKNG
Sbjct: 732  GIGGADGEGSDDYDSDLEKMIDDYSKNNFNPHEIREMLAAENKEMDIKMINKILYDIKNG 791

Query: 880  GFR-KRGRNDMELEFSDDEDAE-LQEFRRKRRELMKQRMLENEDTDKLTKNPKSKAFFES 937
            GFR KR +N +ELE SDD++ + LQ++R KRRELM++R LE  D  KL KNPKS AFFES
Sbjct: 792  GFRNKRAKNSLELELSDDDEDDVLQQYRLKRRELMRKRRLEIGDDAKLVKNPKSSAFFES 851

Query: 938  MIVDLVEDKN--------NFDDLSDQIEL--KEENITQEDNEKEYNEAKS--NKRGKIRI 985
            M+ D++E KN        N D  S   +L  ++ +I   DN    NE K    K  K+ I
Sbjct: 852  MVEDIIEYKNPFGAEEEYNLDITSTATDLDTQDNSINVGDNTGN-NEQKPVDQKNKKVII 910

Query: 986  SEDFVQKTLSFLH-------------------NDESTQEFQPSFIMSKEKGIGDMNAXXX 1026
            SEDFVQK+LSFL                    NDE+ ++    + + +   I        
Sbjct: 911  SEDFVQKSLSFLKSNNYEDFETDKELSRIQHGNDEAIEDL---YTLKQNSSIKSFTNSQT 967

Query: 1027 XXXXXXXXXXXXXRKIINDEEDVIEEFES-----FKRPSIIQSFSSKFTIDDKFKDGNKS 1081
                          +   ++ED +E  ++     FK PSII+SF+S+  I+DKFK+GNK+
Sbjct: 968  DSTTSKTVNTIIDLEKRPEDEDEVENGDTSLVGVFKHPSIIKSFASRTDINDKFKEGNKT 1027

Query: 1082 VKVSTSYKTVGGSKASITYLGKTRKLVPPK 1111
            VK+  SYKTVG SKASITY+GKTRKL+ PK
Sbjct: 1028 VKILKSYKTVGSSKASITYMGKTRKLIAPK 1057

 Score = 35.0 bits (79), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 38/147 (25%), Positives = 58/147 (39%), Gaps = 36/147 (24%)

Query: 1   MDFLFDELEQVKIKKRTT-YKKVQVVGTGQGDEIAREDTSNQIVPNNASTSSDSERLLNN 59
           MD     L  +  KKRTT YKKV V        +   D +N   PN+     +       
Sbjct: 1   MDDALHALSSLTAKKRTTTYKKVAVPI------LDENDNTNGNGPNDIDNPPE------- 47

Query: 60  VNKKGFLLTSDKLDTIRSRLAQSKDSEVVEDRALINPQIEEQSKEKTFSSEQNNIVVNQS 119
           +   GFL  +  L+ +++RL   K  E                         NN      
Sbjct: 48  LTGNGFLFANATLNRVKNRLEGKKAPE----------------------QNHNNGKDRSE 85

Query: 120 DDISTQIINEYYDGGEDLDATDIIKNS 146
           + + TQ+I+  YDGGE+L+ +++  NS
Sbjct: 86  NSLPTQLISNLYDGGEELEKSEVKDNS 112

>KLLA0C00484g Chr3 complement(35397..38174) [2778 bp, 925 aa] {ON}
            weakly similar to uniprot|P25588 Saccharomyces cerevisiae
            YCL061C MRC1 S-phase checkpoint protein found at
            replication forks required for DNA replication also
            required for Rad53p activation during DNA replication
            stress where it forms a replication-pausing complex with
            Tof1p and is phosphorylated by Mec1p protein involved in
            replication checkpoint
          Length = 925

 Score =  224 bits (570), Expect = 9e-60,   Method: Compositional matrix adjust.
 Identities = 141/368 (38%), Positives = 208/368 (56%), Gaps = 44/368 (11%)

Query: 778  KQQVKRQQEREVKERKKLQELANKGVNQYFXXXXXXXXXXWRGIGGVDGDDFGEYDSEVE 837
            + +++R+ E E  +++K Q L + G+N+            W G+GG DG++  +YDS+++
Sbjct: 591  RAKMRRRMEIEAAKKRK-QVLKSTGLNKILEMEAEESEDEWHGVGGADGENSDDYDSDLD 649

Query: 838  KMIDDYSKTEVDLTSLRQKIMDENKEMDLKLVNKILYDIKNGGFRKRGRNDMELEFSDDE 897
             MIDD+SK++ D  S+R+++  ENKEMD +++NKIL+DI  GGFRKRGR  ++LE SDDE
Sbjct: 650  TMIDDFSKSKFDTASIRERLALENKEMDERMINKILHDINTGGFRKRGRGALDLELSDDE 709

Query: 898  DAELQEFRRKRRELMKQRMLENEDTDKLTKNPKSKAFFESMIVDL----VEDKNNFDDLS 953
            D  L++FR KRRE+MKQ++LEN   D +  N KSKAFF+SM+ D+    +    +F +  
Sbjct: 710  DELLRQFREKRREIMKQKLLEN--VDGVVNNSKSKAFFDSMVEDITRKSIPAVTSFSNTR 767

Query: 954  DQIELKEENITQEDNEKEYNEAKSNKRGKIRISEDFVQKTLSFLH-NDESTQEFQPSFIM 1012
            D++  K                      KI ISE+FVQ +LSFL   D+   EF+     
Sbjct: 768  DEMGKK----------------------KIVISEEFVQSSLSFLSAKDDDINEFE--VTE 803

Query: 1013 SKEKGIGDMNAXXXXXXXXXXXXXXXXRKIINDE--EDVIEEFESFKRPSIIQSFSSKFT 1070
            +      D+ +                R   N    +DV      FK PSI++SFSS   
Sbjct: 804  AAHDATEDLESLKQRSNIKSLDSPQRNR---NSAFFDDVDGTSLDFKLPSIVKSFSSNSD 860

Query: 1071 IDDKFKDGNKSVKVSTSYKTVGGSKASITYLGKTRKLVPP---KNGPTVRKRNSNNTSRL 1127
            ++DKFK G K+V +S SY+   GS+++IT+LGK RKL  P   K+ P VRK     TS L
Sbjct: 861  VNDKFKTGIKTVTISKSYRVASGSRSAITFLGKKRKLKAPQGRKSTPLVRK----PTSSL 916

Query: 1128 FNIQNDPF 1135
            F+  +D F
Sbjct: 917  FDSNSDSF 924

>Ecym_1008 Chr1 complement(13340..16696) [3357 bp, 1118 aa] {ON}
            similar to Ashbya gossypii AFR745W
          Length = 1118

 Score =  220 bits (560), Expect = 5e-58,   Method: Compositional matrix adjust.
 Identities = 133/342 (38%), Positives = 195/342 (57%), Gaps = 27/342 (7%)

Query: 777  IKQQVKRQQEREVKERKKLQELANKGVNQYFXXXXXXXXXXWRGIGGVDGDDFGEYDSEV 836
            +++++KRQ+++E++   KL      GVN+            W G+GGVD +   EYDS++
Sbjct: 765  LQEKIKRQKQKEMR---KL------GVNKMVELEADESEDEWHGVGGVDYEASDEYDSDL 815

Query: 837  EKMIDDYSKTEVDLTSLRQKIMDENKEMDLKLVNKILYDIKNGGFRKRGRNDMELEFSDD 896
            +KMIDDY+K E D   +R+ +  E+ + D  +VNKIL+DIK GGFRKRGR +++LE S+D
Sbjct: 816  DKMIDDYNKNEFDPVEIRKILASEDLQHDKNMVNKILHDIKTGGFRKRGRGELDLELSED 875

Query: 897  EDAELQEFRRKRRELMKQRMLENEDTDKLTKNPKSKAFFESMIVDLVEDKNNFDDLSDQI 956
            ED  LQ +R KR    KQ+ML++E    +  NPKS  FFESM+ +            D  
Sbjct: 876  EDGILQSYRAKRWNEQKQKMLDSEHNTSVKSNPKSLPFFESMVDEFTIPVERALGTPDSP 935

Query: 957  ELKEENITQEDNEKEYNEAKSNKRGKIRISEDFVQKTLSFLHNDESTQEFQPSFIMSKEK 1016
              +  N+          E K N + KI ISE FV++TLSFL +DE+    +    + K  
Sbjct: 936  PAQSTNVL---------ELKQNTKQKIVISEHFVKQTLSFLTSDENMTNMRSEINVEKPN 986

Query: 1017 GIGDMNAXX-------XXXXXXXXXXXXXXRKIINDEEDVIEEFESFKRPSIIQSFSSKF 1069
               D+ +                       + I+N++ED   EF  FK PS++Q+F S+ 
Sbjct: 987  NDNDIYSSEVEDLYTLKETSTIKVLNTYSGKPIVNEDEDG-AEF-GFKAPSVMQTFGSRN 1044

Query: 1070 TIDDKFKDGNKSVKVSTSYKTVGGSKASITYLGKTRKLVPPK 1111
             ++DKFKDG KSVK+S  YKT+G S+A+IT+LGK RKL+ PK
Sbjct: 1045 DVNDKFKDGFKSVKISNKYKTLGSSRAAITFLGKKRKLIIPK 1086

 Score = 68.9 bits (167), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 54/70 (77%)

Query: 566 LFNNLRKATKQQIMLHRKELMESRGLNFEDLEKQKVMVEDLLEKEIERNLKIREREKRKE 625
           LF +L+KA K+QI+ HR+E+ E RG++ E LE+++  VEDLLE++I+RN +IR REK+KE
Sbjct: 475 LFISLKKANKKQILDHRREITEKRGISLEQLEQEREKVEDLLEQKIKRNRRIRLREKKKE 534

Query: 626 SNEPLAEQEI 635
           +   L  ++I
Sbjct: 535 NELRLRYEDI 544

>TBLA0A07570 Chr1 (1874419..1878177) [3759 bp, 1252 aa] {ON} Anc_1.5
            YCL061C
          Length = 1252

 Score =  214 bits (544), Expect = 9e-56,   Method: Compositional matrix adjust.
 Identities = 161/391 (41%), Positives = 222/391 (56%), Gaps = 48/391 (12%)

Query: 777  IKQQVKRQQEREVKERKKLQELANKGVNQYFXXXXXXXXXXWRGIGGVDGDDFGEYDSEV 836
            IKQ++++Q+ +E K++ KL+EL   G ++ F          W GIGG DG+   EYDSEV
Sbjct: 847  IKQELEKQKLKEAKKKAKLRELKKVGASKMFDMEAEESEDEWFGIGGADGEVSDEYDSEV 906

Query: 837  EKMIDDYSKTEVDLTSLRQKIMDENKEMDLKLVNKILYDIKNGGFRKRGRNDMELEFSDD 896
            EK+IDDYS+ + +   +R K+M+ENKEMD+K+VN+ILYDIKNGGFRKR RN+++LE SDD
Sbjct: 907  EKLIDDYSRQDFNPDEIRNKLMNENKEMDIKMVNRILYDIKNGGFRKRNRNNIDLELSDD 966

Query: 897  EDAELQEFRRKRRELMKQRMLENEDTDKLTKNPKSKAFFESMIVDLVEDKNNF----DDL 952
            ED EL+E+R KRRE+MK++ LE  +TDK+ K  KSKAFF SM+ D+VE  N F       
Sbjct: 967  EDDELREYRIKRREIMKKKRLEVTNTDKILKTSKSKAFFMSMVDDIVETSNPFMITQPSD 1026

Query: 953  SDQIELKEENITQEDNEK--------------EYNEAKSNKRGKIRISEDFVQKTLSFLH 998
             D  +   ++I+ ++++               ++     + R K  +SEDFV KTLSFL 
Sbjct: 1027 DDSDDNNMDSISNKNHKDANNAKKDKKDKRTDDHARLSQSSRKKFVMSEDFVHKTLSFLT 1086

Query: 999  NDESTQEFQPSFIMSKEKGIGDMNAXXXXXXXXXXXXXXXXRKIIND-----------EE 1047
              +   EFQ      K + IG +N                   +  D           ++
Sbjct: 1087 KSKEVNEFQHVNEHYKSQ-IGTINDIQSLKQKSSIKTMHVLSMMSQDTNVDLDASDKDDD 1145

Query: 1048 DVIEEFESF------------KRPSIIQSFSSKFTIDDKFKDGNKSVKVSTSYKTVGGSK 1095
            D+I    SF            K PSII+ F S   I+DKFKDGNK+V +S SYKTVGG K
Sbjct: 1146 DMIHHAGSFDNSFDDPLSSVSKAPSIIKIFGSTHDINDKFKDGNKTVTISNSYKTVGGMK 1205

Query: 1096 ASITYLGKTRKLVPPKNGPTVRKRNSNNTSR 1126
             SIT  G+ RKLV P     V+  N+ N +R
Sbjct: 1206 TSITSFGR-RKLVAP-----VKTHNNFNKNR 1230

 Score = 46.2 bits (108), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 31/80 (38%), Positives = 46/80 (57%), Gaps = 17/80 (21%)

Query: 1  MDFLFDELEQVKIKKRTTYKKVQVVGTGQGDEIARE-DTSNQIVPNNASTSSDSERLLNN 59
          MD +FD L+++KIKKRTTYKKV        +++A E D +   + N   + + SE     
Sbjct: 3  MDAVFDSLDELKIKKRTTYKKV-------PEQVATELDKAATTISNPVPSFNLSE----- 50

Query: 60 VNKKGFLLTSDKLDTIRSRL 79
              GFL  +DKL+ I++RL
Sbjct: 51 ----GFLFANDKLEKIKNRL 66

>AFR745W Chr6 (1803046..1806102) [3057 bp, 1018 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YCL061C (MRC1)
          Length = 1018

 Score =  208 bits (529), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 132/341 (38%), Positives = 187/341 (54%), Gaps = 35/341 (10%)

Query: 787  REVKERKKLQ--ELANKGVNQYFXXXXXXXXXXWRGIGGVDGDDFGEYDSEVEKMIDDYS 844
            R+  ER KL+  E+  KG+ +            W GIGG D +   +YDSEVEKMIDDYS
Sbjct: 668  RKRAERNKLRRREMKKKGITKMLEMEAEESEDEWHGIGGSDNELSEDYDSEVEKMIDDYS 727

Query: 845  KTEVDLTSLRQKIMDENKEMDLKLVNKILYDIKNGGFRKRGRNDMELEFSDDEDAELQEF 904
                +   LR  +    ++ D  +VNKIL+DI  GGFR+RG+  ++LE S++ED ELQ+F
Sbjct: 728  VHSSNADHLRAILAKNERQHDENIVNKILHDISTGGFRRRGKGALDLEMSENEDQELQQF 787

Query: 905  RRKRRELMKQRMLENEDTDKLTKNPKSKAFFESMIVDLVEDK--NNFDDLSDQIELKEEN 962
            R+KRREL+KQ++LEN DT KL  NPKS AFF++M+ D+ E    N FD            
Sbjct: 788  RQKRRELLKQKILENGDTSKLVSNPKSYAFFQTMVDDVTEASFGNTFDA----------- 836

Query: 963  ITQEDNEKEYNEAKSNKRGKIRISEDFVQKTLSFLHNDESTQEFQP------SFIMSKEK 1016
                 N  E  +  +  R KI ISE FV++TLSFL +     E         S  + +E+
Sbjct: 837  -----NIDEKTDPSAAGR-KIVISEQFVKETLSFLSSKSGDSEIPAETKSISSSTVEREE 890

Query: 1017 GIGDM-----NAXXXXXXXXXXXXXXXXRKIINDEEDVIEEFESFKRPSIIQSFSSKFTI 1071
             I D+     N+                     DE D     + F+  S  +SF++   +
Sbjct: 891  -IQDLHTLKQNSNIKHLKGSLELPAQMAELSSGDEGDYGFSLDRFR--SAAKSFNNGTNV 947

Query: 1072 DDKFKDGNKSVKVSTSYKTVGGSKASITYLGKTRKLVPPKN 1112
            DDKFK G K+V++  + KT+GGSKA+IT++G+ R+L+PPKN
Sbjct: 948  DDKFKSGTKAVRILKANKTIGGSKAAITFIGRKRRLIPPKN 988

 Score = 44.7 bits (104), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 38/51 (74%)

Query: 563 TNLLFNNLRKATKQQIMLHRKELMESRGLNFEDLEKQKVMVEDLLEKEIER 613
           +N LF  LRKA ++Q++  R+  +E RG+N ++LE+++  + +LLE+E+ER
Sbjct: 413 SNELFAKLRKANREQLLEQRRNAIERRGINMQNLEQEREQLGNLLEQELER 463

>KLTH0F00484g Chr6 complement(37017..39998) [2982 bp, 993 aa] {ON}
            weakly similar to uniprot|P25588 Saccharomyces cerevisiae
            YCL061C MRC1 S-phase checkpoint protein found at
            replication forks required for DNA replication also
            required for Rad53p activation during DNA replication
            stress where it forms a replication-pausing complex with
            Tof1p and is phosphorylated by Mec1p protein involved in
            replication checkpoint
          Length = 993

 Score =  177 bits (450), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 125/359 (34%), Positives = 194/359 (54%), Gaps = 40/359 (11%)

Query: 775  AAIKQQVKRQQEREVKERKKLQELANKGVNQYFXXXXXXXXXXWRGIGGVDGDDFGEYDS 834
              I++ +++ + +E+    KL++L     ++            W GIGGVDG+ F ++DS
Sbjct: 623  GVIRELIEKHKRKELLREAKLEKLHQSKASRIIDYEAEESDDEWHGIGGVDGERFDDHDS 682

Query: 835  EVEKMIDDYSKTEVDLTSLRQKIMDENKEMDLKLVNKILYDIKNGGFRKRGRNDMELEFS 894
            ++EKMIDDYS +  D + +R++ ++E    D  +VNKIL+DI+ GGFRKRGRN ++LE S
Sbjct: 683  DLEKMIDDYSNSRFDSSEVRKRQIEEEISEDKSMVNKILHDIETGGFRKRGRNALDLELS 742

Query: 895  DDEDAELQEFRRKRRELMKQRMLENEDTDKLTKNPKSKAFFESMIVDLVEDKNNFDDLSD 954
            DD+D EL ++  +R+EL++Q++    +   L +NPKSKAFFE+    +VED  +   L D
Sbjct: 743  DDDDEELLKYHSRRKELLRQKVSAQGEAKLLAENPKSKAFFET----IVEDIRSKGALED 798

Query: 955  QIELKEENITQEDNEKEYNEAKSNKRGKIRISEDFVQKTLSFLHNDE------------- 1001
            +        +  +  +E N     K  K  +SE FVQ+TLSFL + E             
Sbjct: 799  EGPPPVRGFSSVNAPEEKNSDSDKKGKKTVLSEAFVQQTLSFLTSGEVGEEKGPENNLGS 858

Query: 1002 --------STQEFQPSFIMSKEKGIGDMNAXXXXXXXXXXXXXXXXRKIINDEEDVIEEF 1053
                    +T+E Q  F + +   I  ++A                  +I+D+ED++   
Sbjct: 859  LPTHVPSFNTEETQDIFALKQNSSIKSLSAPTRNSSNM----------LIDDQEDLL--- 905

Query: 1054 ESFKRP-SIIQSFSSKFTIDDKFKDGNKSVKVSTSYKTVGGSKASITYLGKTRKLVPPK 1111
             S KR  S    F+ +   ++KF++G K+V+   SYK  G SKASITYLGK RKL  PK
Sbjct: 906  -SRKRACSFFARFTKRVDANEKFEEGKKTVRSLNSYKVAGSSKASITYLGKARKLNAPK 963

 Score = 59.7 bits (143), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 35/87 (40%), Positives = 56/87 (64%), Gaps = 6/87 (6%)

Query: 562 STNLLFNNLRKATKQQIMLHRKELMESRGLNFEDLEKQKVMVEDLLEKEIERNLKIRERE 621
           S  +LF +LRKA K QI+ +RKE  +S+G++++ + ++K  +E LLE+E+ RN KIR RE
Sbjct: 390 SHQILFASLRKANKSQILDYRKEKYQSKGIDYDKITEEKNSIESLLERELARNKKIRLRE 449

Query: 622 ---KRKESNEPLAEQEIMESDYEYSGD 645
              +R+   +   EQ    S ++YS D
Sbjct: 450 IEQERQNERKDFGEQ---SSAFDYSND 473

>Kwal_33.13005 s33 complement(36797..39709) [2913 bp, 970 aa] {ON}
            YCL061C (MRC1) - protein involved in replication
            checkpoint [contig 123] FULL
          Length = 970

 Score =  171 bits (433), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 131/365 (35%), Positives = 190/365 (52%), Gaps = 26/365 (7%)

Query: 765  EDIDTEQE-RIAAIKQQVKRQQEREVKERKKLQELANKGVNQYFXXXXXXXXXXWRGIGG 823
            E ID ++E R   IK  +++++ +E     K++EL     N             W G+GG
Sbjct: 596  EKIDQDEETRNPIIKNLIEKRKLKEALREAKMKELNRSKANGMIDFEAEESDDEWFGVGG 655

Query: 824  VDGDDFGEYDSEVEKMIDDYSKTEVDLTSLRQKIMDENKEMDLKLVNKILYDIKNGGFRK 883
             DG++   YDSE+++MIDDYS T+ D   LR+K+M+E K  D  +V++IL+DI+NGGFRK
Sbjct: 656  ADGENSDGYDSELDRMIDDYSNTKSDPEFLRKKLMEEEKLHDKDMVDRILHDIENGGFRK 715

Query: 884  RGRNDMELEFSDDEDAELQEFRRKRRELMKQRMLENEDTDKLTKNPKSKAFFESMIVDLV 943
            RGR  M+L  SDDED +L  +  +R+EL+ +R   N++   L  NPKSKAFF+S+     
Sbjct: 716  RGRYAMDLTLSDDEDDDLLRYHARRKELLNERKSGNQEISVLATNPKSKAFFDSIFE--- 772

Query: 944  EDKNNFDDLSDQIELKEENITQEDNEKEYNEAKSNKRGKIRISEDFVQKTLSFLHNDEST 1003
                  DDL   I   +E  +     K   +  S KR + RISE FVQKTLSFL + E  
Sbjct: 773  ------DDLKGGIANLKEYQSHASPLKAAKDEISGKR-ETRISEQFVQKTLSFLKSKEDE 825

Query: 1004 Q---EFQPSFIMSKEKGIGDMNAXX--------XXXXXXXXXXXXXXRKIINDEEDVIEE 1052
            Q   EF  S   ++E   GD                           R  + +++ V+  
Sbjct: 826  QGDAEF-VSVADTQESSSGDFAEATDFYRLKQLSGIKSFSAPLRSSIRLQVRNKDGVL-- 882

Query: 1053 FESFKRPSIIQSFSSKFTIDDKFKDGNKSVKVSTSYKTVGGSKASITYLGKTRKLVPPKN 1112
                   ++++ F      ++KF++G K+VK   SYK  G S+ASIT+LGK R L   K 
Sbjct: 883  -SGKANTTLVERFVRSVDTNEKFEEGRKTVKSLNSYKIAGSSRASITFLGKARSLKARKR 941

Query: 1113 GPTVR 1117
            GP  R
Sbjct: 942  GPHAR 946

 Score = 52.8 bits (125), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 25/59 (42%), Positives = 42/59 (71%)

Query: 566 LFNNLRKATKQQIMLHRKELMESRGLNFEDLEKQKVMVEDLLEKEIERNLKIREREKRK 624
           LF++LRKA + Q++ HR  L+  RG++  ++ K+K  VE LLE+E+ RN K+++ E +K
Sbjct: 373 LFSSLRKANRDQLVEHRNGLLLLRGVDLAEIAKEKESVESLLERELARNKKVKQEEIQK 431

>KNAG0C00220 Chr3 complement(33011..36496) [3486 bp, 1161 aa] {ON}
           Anc_1.5 YCL061C
          Length = 1161

 Score = 60.5 bits (145), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 33/85 (38%), Positives = 54/85 (63%), Gaps = 1/85 (1%)

Query: 531 KLSNKSKATLLNLXXXXXXXXXXXXXXXXXDST-NLLFNNLRKATKQQIMLHRKELMESR 589
           K+S  SKA +LN+                  +T + LF++L+K  +QQI+ H+ E++ ++
Sbjct: 547 KVSQASKAAVLNIKAKALKKKAIVKAANTNKTTLDSLFSDLKKKNRQQILSHQAEIIGTK 606

Query: 590 GLNFEDLEKQKVMVEDLLEKEIERN 614
           G+N +DLE++K +VEDLLE+EI RN
Sbjct: 607 GINHKDLEREKEIVEDLLEQEILRN 631

 Score = 49.3 bits (116), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 45/139 (32%), Positives = 65/139 (46%), Gaps = 38/139 (27%)

Query: 1   MDFLFDELEQVKIKKRTTYKKVQVVGTGQGDEIAREDTSNQIVPNNASTSSDSERLLNNV 60
           MD L +    VK+K+RTTYKKVQ   T   DE A +D     VP + + +          
Sbjct: 1   MDDLLERFNSVKVKRRTTYKKVQQNST---DEAAGDD---DCVPTSLAGN---------- 44

Query: 61  NKKGFLLTSDKLDTIRSRLAQSKDSEVVEDRALINPQIEEQSKEKTFSSEQNNIVVNQSD 120
              GFL  +  +D I++RL               N      S + T SS ++ I V+QS 
Sbjct: 45  ---GFLFGNATVDKIKNRLN--------------NEDHPNSSIDVTKSSSEDQIPVSQS- 86

Query: 121 DISTQIINEYYDGGEDLDA 139
               Q+++  YDGGEDL++
Sbjct: 87  ----QLLSTLYDGGEDLES 101

>NDAI0B03610 Chr2 (906622..908517) [1896 bp, 631 aa] {ON} Anc_2.274
           YIL101C
          Length = 631

 Score = 33.1 bits (74), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 23/63 (36%), Positives = 34/63 (53%), Gaps = 4/63 (6%)

Query: 257 QKIAAS-QNDRSV---EINKDDDDYRQTMDASTQIIGATQHVPIETQNSYLQTIKDHEDK 312
           +K+A S QN RSV     N DD  + +T+D S         VP++ +NS LQ+ K+H   
Sbjct: 225 RKVAISPQNSRSVTNTNYNYDDSGFIKTLDYSKYKDFQWNKVPLDLRNSILQSFKNHLVS 284

Query: 313 TVG 315
            +G
Sbjct: 285 ELG 287

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.306    0.126    0.333 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 122,736,346
Number of extensions: 6074255
Number of successful extensions: 43153
Number of sequences better than 10.0: 1360
Number of HSP's gapped: 43574
Number of HSP's successfully gapped: 1709
Length of query: 1136
Length of database: 53,481,399
Length adjustment: 121
Effective length of query: 1015
Effective length of database: 39,606,813
Effective search space: 40200915195
Effective search space used: 40200915195
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 43 (22.0 bits)
S2: 71 (32.0 bits)