Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
CAGL0B00308g1.4ON43043021730.0
YCL063W (VAC17)1.4ON4234524073e-44
Suva_3.1511.4ON4214533976e-43
TDEL0C069801.4ON4264743783e-40
Smik_3.131.4ON4254543766e-40
NDAI0A001301.4ON4784703656e-38
Skud_3.21.4ON4264573241e-32
ZYRO0F18502g1.4ON4504473199e-32
KNAG0C001901.4ON4424253065e-30
Kpol_2002.71.4ON4743093022e-29
SAKL0C00440g1.4ON4623932952e-28
TPHA0E040201.4ON5404002645e-24
TBLA0A075801.4ON5133202343e-20
NCAS0B091201.4ON4334812243e-19
KLLA0C00462g1.4ON4603192211e-18
KAFR0D001201.4ON3994231782e-13
Kwal_33.130031.4ON4493011472e-09
KLTH0F00462g1.4ON4512941284e-07
TPHA0A037103.337ON232166850.044
Skud_12.322singletonON21496750.67
CAGL0K09042g8.695ON15453740.69
Ecym_30426.38ON52099741.3
NCAS0E037007.305ON102350713.6
CAGL0M00990g4.310ON197981705.1
KNAG0B064404.310ON218768689.2
NOTE: 2 genes in the same pillar as CAGL0B00308g were not hit in these BLAST results
LIST: AFR746C Ecym_1007

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0B00308g
         (430 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0B00308g Chr2 (16533..17825) [1293 bp, 430 aa] {ON} similar ...   841   0.0  
YCL063W Chr3 (17290..18561) [1272 bp, 423 aa] {ON}  VAC17Phospho...   161   3e-44
Suva_3.151 Chr3 (227186..228451) [1266 bp, 421 aa] {ON} YCL063W ...   157   6e-43
TDEL0C06980 Chr3 complement(1267077..1268357) [1281 bp, 426 aa] ...   150   3e-40
Smik_3.13 Chr3 (18714..19991) [1278 bp, 425 aa] {ON} YCL063W (REAL)   149   6e-40
NDAI0A00130 Chr1 (6694..8130) [1437 bp, 478 aa] {ON} Anc_1.4 YCL...   145   6e-38
Skud_3.2 Chr3 (5324..6604) [1281 bp, 426 aa] {ON} YCL063W (REAL)      129   1e-32
ZYRO0F18502g Chr6 complement(1527109..1528461) [1353 bp, 450 aa]...   127   9e-32
KNAG0C00190 Chr3 (28746..30074) [1329 bp, 442 aa] {ON} Anc_1.4 Y...   122   5e-30
Kpol_2002.7 s2002 (10372..11796) [1425 bp, 474 aa] {ON} (10372.....   120   2e-29
SAKL0C00440g Chr3 (39662..41050) [1389 bp, 462 aa] {ON} weakly s...   118   2e-28
TPHA0E04020 Chr5 complement(842960..844582) [1623 bp, 540 aa] {O...   106   5e-24
TBLA0A07580 Chr1 complement(1878594..1880135) [1542 bp, 513 aa] ...    95   3e-20
NCAS0B09120 Chr2 complement(1749531..1750832) [1302 bp, 433 aa] ...    91   3e-19
KLLA0C00462g Chr3 (33948..35330) [1383 bp, 460 aa] {ON} weakly s...    90   1e-18
KAFR0D00120 Chr4 (9052..10251) [1200 bp, 399 aa] {ON} Anc_1.4 YC...    73   2e-13
Kwal_33.13003 s33 (35425..36774) [1350 bp, 449 aa] {ON} YCL063W ...    61   2e-09
KLTH0F00462g Chr6 (35640..36995) [1356 bp, 451 aa] {ON} weakly s...    54   4e-07
TPHA0A03710 Chr1 complement(813703..814401) [699 bp, 232 aa] {ON...    37   0.044
Skud_12.322 Chr12 (573502..574146) [645 bp, 214 aa] {ON}  YBR042...    33   0.67 
CAGL0K09042g Chr11 complement(900862..901326) [465 bp, 154 aa] {...    33   0.69 
Ecym_3042 Chr3 (83461..85023) [1563 bp, 520 aa] {ON} similar to ...    33   1.3  
NCAS0E03700 Chr5 (726814..729885) [3072 bp, 1023 aa] {ON}              32   3.6  
CAGL0M00990g Chr13 complement(109609..115548) [5940 bp, 1979 aa]...    32   5.1  
KNAG0B06440 Chr2 complement(1267685..1274248) [6564 bp, 2187 aa]...    31   9.2  

>CAGL0B00308g Chr2 (16533..17825) [1293 bp, 430 aa] {ON} similar to
           uniprot|P25591 Saccharomyces cerevisiae YCL063w
          Length = 430

 Score =  841 bits (2173), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 418/430 (97%), Positives = 418/430 (97%)

Query: 1   MASLEEITERLLERSNEAIEQLDEWILLQNKNRHISENKSGLDSIERLDDKYTEFLEKLN 60
           MASLEEITERLLERSNEAIEQLDEWILLQNKNRHISENKSGLDSIERLDDKYTEFLEKLN
Sbjct: 1   MASLEEITERLLERSNEAIEQLDEWILLQNKNRHISENKSGLDSIERLDDKYTEFLEKLN 60

Query: 61  SLYIRSQYIKDKIRTEKNAKATKRKSELNTSRIQELMLEFKEITLSLNEIAQQDDETNSK 120
           SLYIRSQYIKDKIRTEKNAKATKRKSELNTSRIQELMLEFKEITLSLNEIAQQDDETNSK
Sbjct: 61  SLYIRSQYIKDKIRTEKNAKATKRKSELNTSRIQELMLEFKEITLSLNEIAQQDDETNSK 120

Query: 121 QLSPASTSTKSSLESFTPKPLKILNRASMIRSPINSPPKKRNISFCPIHENLSVTEYEXX 180
           QLSPASTSTKSSLESFTPKPLKILNRASMIRSPINSPPKKRNISFCPIHENLSVTEYE  
Sbjct: 121 QLSPASTSTKSSLESFTPKPLKILNRASMIRSPINSPPKKRNISFCPIHENLSVTEYESL 180

Query: 181 XXXXXXXXXXEEQEQVLHPARSFQTGLRTEKARKPDKNQLDKYFKDKQRLSLTLFGSADA 240
                     EEQEQVLHPARSFQTGLRTEKARKPDKNQLDKYFKDKQRLSLTLFGSADA
Sbjct: 181 PSSPNRSNLLEEQEQVLHPARSFQTGLRTEKARKPDKNQLDKYFKDKQRLSLTLFGSADA 240

Query: 241 DDGESLNNNDYSDEETVIFTSSSNIETDAITDDMKPIRRCNSHESVLSVHNKFVPKNNNN 300
           DDGESLNNNDYSDEETVIFTSSSNIETDAITDDMKPIRRCNSHESVLSVHNKFVPKNNNN
Sbjct: 241 DDGESLNNNDYSDEETVIFTSSSNIETDAITDDMKPIRRCNSHESVLSVHNKFVPKNNNN 300

Query: 301 LQFQNRLEPFGRYLATSNNRNFTIPSIQNIQVSGTSTLSRFSREQDREMTQLGSKTSKDL 360
           LQFQNRLEPFGRYLATSNNRNFTIPSIQNIQVSGTSTLSRFSREQDREMTQLGSKTSKDL
Sbjct: 301 LQFQNRLEPFGRYLATSNNRNFTIPSIQNIQVSGTSTLSRFSREQDREMTQLGSKTSKDL 360

Query: 361 LTSVMTATPITTQRNNKLTFFDKFNSMFNFSTISEEQKTTVEKNRSAESPRNDFVSIEEL 420
           LTSVMTATPITTQRNNKLTFFDKFNSMFNFSTISEEQKTTVEKNRSAESPRNDFVSIEEL
Sbjct: 361 LTSVMTATPITTQRNNKLTFFDKFNSMFNFSTISEEQKTTVEKNRSAESPRNDFVSIEEL 420

Query: 421 NEALTTNMVM 430
           NEALTTNMVM
Sbjct: 421 NEALTTNMVM 430

>YCL063W Chr3 (17290..18561) [1272 bp, 423 aa] {ON}
           VAC17Phosphoprotein involved in vacuole inheritance;
           degraded in late M phase of the cell cycle; acts as a
           vacuole-specific receptor for myosin Myo2p
          Length = 423

 Score =  161 bits (407), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 155/452 (34%), Positives = 236/452 (52%), Gaps = 57/452 (12%)

Query: 3   SLEEITERLLERSNEAIEQLDEWILLQNKNRHISENKSGLDSIERLDDKYTEFLEKLNSL 62
           +LE+ITERLL RS EAI QLD WI  Q + R      +  +S+++L  +Y +++ +LNSL
Sbjct: 5   ALEDITERLLIRSQEAILQLDLWI--QRQQRSSICQTTDQESLDKLSQQYNQYMSQLNSL 62

Query: 63  YIRSQYIKDKIRTEKNAKATKRKSELNTSRIQELMLEFKEITLSLNEIAQQDDETNSKQL 122
           Y+RS+ ++DK+  E+  +     +E    RI++L+ EF++ITL LNE+A   +E  +   
Sbjct: 63  YVRSESVRDKLSKEQQRRLITEDNE--HQRIEDLVREFQDITLRLNELATVPNEAPND-- 118

Query: 123 SPASTSTKSSLESFTPKPLKILNRASMIRSPINSPPKKRNISFCPIHENLSVTEYEXXXX 182
           SP S ST+SSL SF P+PLKI+ R  +     + PPKK ++ F PI+E   V        
Sbjct: 119 SPQSQSTRSSLGSFQPRPLKIIERQRLCMVTPSKPPKK-SVGFNPINE---VDCPSKTNS 174

Query: 183 XXXXXXXXEEQEQVLHPARSFQTGLRTEKARKP-DKNQLDKYFKDKQRLSLTLFGSADAD 241
                     + + L  A+S  TGL   K++KP   +  + +FK++QRLSLT F   D +
Sbjct: 175 LPCSPKKQPARNRTLRAAKSHDTGL--NKSKKPSSSDTYESFFKNRQRLSLTFFDEMDDE 232

Query: 242 DGESLNNNDYSDEETVIF---TSSSNIETDAITDDMKPIRRCNSHESVLSVHNKFVPKNN 298
           D         SD++T+I    ++  ++   A   + +P+RR NSHES+LS  NK  P  +
Sbjct: 233 D-------FDSDQDTIILPNISTPPHVGVTAKGAEFEPLRRYNSHESILS--NKPAPSKS 283

Query: 299 NNLQFQNRLEPFGRYLATSNNRNFTIPSIQNIQVSGTSTLSRFSREQDREMTQLGSKTSK 358
            N      L  F       +N  F   SI N+QV+   T++  +    R   ++ S  SK
Sbjct: 284 LN------LGSFSASFFRPSNPTFGT-SISNVQVNCHPTVA-ATMAPSRNGPRISS--SK 333

Query: 359 DLLTSVMTATPITTQRNN-----KLTFFDKFNSMFNFSTISEE-QKTTVEKNRS------ 406
            LL+S +  +   T + N       +F DKFNS  + STISE  Q     KN+       
Sbjct: 334 ALLSSFIARSDTHTVKENNTNLKHASFMDKFNS--SLSTISESFQSKRGRKNKGMNEERI 391

Query: 407 -----AESPRNDF---VSIEELNEALTTNMVM 430
                A+  +N+    VSIEEL +AL T ++ 
Sbjct: 392 SNHNVAQEQKNNMDISVSIEELQDALNTELLF 423

>Suva_3.151 Chr3 (227186..228451) [1266 bp, 421 aa] {ON} YCL063W
           (REAL)
          Length = 421

 Score =  157 bits (397), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 151/453 (33%), Positives = 241/453 (53%), Gaps = 61/453 (13%)

Query: 3   SLEEITERLLERSNEAIEQLDEWILLQNKNRHISENKSGLDSIERLDDKYTEFLEKLNSL 62
           +LE+ITERLL RS EAI QLD WI  Q + R      S  DS+++L  +Y +++ +LNSL
Sbjct: 5   ALEDITERLLTRSEEAILQLDLWI--QRQQRSSVCEPSDRDSLDKLSQQYNQYMSQLNSL 62

Query: 63  YIRSQYIKDKIRTEKNAKATKRKSELNTSRIQELMLEFKEITLSLNEIAQQDDETNSKQL 122
           Y+RS+ ++DK+  E+  +    ++E    RI++L+ EF++IT+ LN++A   ++ ++   
Sbjct: 63  YVRSESVRDKLSKEQWRRLNTEENE--HKRIEDLVHEFQDITVRLNDLATVPNKASND-- 118

Query: 123 SPASTSTKSSLESFTPKPLKILNRASMIRSPINSPPKKRNISFCPIHENLSVTEYEXXXX 182
           SP S ST+SSL+SF P+PLKI+ R  +     + PPKK ++ F PI++   V        
Sbjct: 119 SPQSQSTRSSLDSFQPRPLKIIERQRLCVVTPSKPPKK-SVVFNPIND---VECPSKTNS 174

Query: 183 XXXXXXXXEEQEQVLHPARSFQTGLRTEKARKPDK-NQLDKYFKDKQRLSLTLFGSADAD 241
                     +   L  A+S  TGL   K++KP   +  + +FK+KQRLSLT F      
Sbjct: 175 LPCSPKKQPGKAHTLRAAKSHDTGL--NKSKKPSSTDAYESFFKNKQRLSLTFF------ 226

Query: 242 DGESLNNNDYSDEETVIF---TSSSNIETDAITDDMKPIRRCNSHESVLSVHNKFVPKNN 298
             E  + +  SD++T+I    ++ S+++      + +P+RR NSHES+LS  NK  P  +
Sbjct: 227 -DEMDDEDLDSDQDTIILPNISTPSHMDMATKGAEFEPLRRYNSHESILS--NKPAPAMS 283

Query: 299 NNLQFQNRLEPFGRYLATSNNRNFTIPSIQNIQVSGTSTLSRFSREQDREMTQLGSKTSK 358
            +L      +P      T         S+ N+QV+    ++  S    R  ++  + TSK
Sbjct: 284 LSLGSFPFFKPSNPTFGT---------SVSNVQVNYRPKMAA-SMIPKRNGSR--APTSK 331

Query: 359 DLLTSVMTATP---ITTQRNNKL---TFFDKFNSMFNFSTISE-----EQKTTVEKNRSA 407
            LL+S + A P   +  Q++  L   +F DKFNS  + STISE     + K + + N   
Sbjct: 332 ALLSSFI-AQPDRIVVKQKSTNLKHTSFLDKFNS--SLSTISESFQNKKGKKSSDLNDDR 388

Query: 408 ESPR------NDF----VSIEELNEALTTNMVM 430
             P       N+     VSIEEL +AL T +++
Sbjct: 389 IPPHIMPEHNNNLMDMGVSIEELQDALNTELLL 421

>TDEL0C06980 Chr3 complement(1267077..1268357) [1281 bp, 426 aa]
           {ON} Anc_1.4 YCL063W
          Length = 426

 Score =  150 bits (378), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 139/474 (29%), Positives = 234/474 (49%), Gaps = 101/474 (21%)

Query: 4   LEEITERLLERSNEAIEQLDEWILLQNKNRHISENKSGLDSIERLDDKYTEFLEKLNSLY 63
           LE+++ERLL RS EAI QL+ WI  Q   R + ++     SI++L ++Y  ++ +LNSL 
Sbjct: 3   LEDLSERLLTRSQEAILQLELWIQRQQHLRELEDS-----SIDKLGNQYNVYIAQLNSLC 57

Query: 64  IRSQYIKDKIRTEKNAKATKRKSELNTSR-IQELMLEFKEITLSLNEIAQQDDETNSKQL 122
           +RS+Y++DK+  E+     +R S +N  + I++L+ EF++IT+ LNE+AQ    + S   
Sbjct: 58  VRSEYVRDKLNKERE----RRMSIINDRKYIEDLVFEFQDITVKLNELAQ----SQSIDS 109

Query: 123 SPASTSTKSSLESFTPKPLKILNR-----ASMIRSPINSPPKKRNISFCPIHENLSVTEY 177
           +P+S ST+SSL SF P+PLK+  R      ++  SP+ +    +++ F  +H++      
Sbjct: 110 TPSSKSTRSSLGSFQPRPLKLTERHGPNVKALRESPLKNKSVIKSVKFSGLHDSKEEAVS 169

Query: 178 EXXXXXXXXXXXXEEQEQVLHPARSFQTGL---RTEKARKPDKNQLDKYFKDKQRLSLTL 234
           +                 +   A+S+ TGL    T+K++      +   F++ QRLS+T+
Sbjct: 170 KCLSLPGSPVRVTGPTRSI-RMAKSYDTGLNSKNTKKSKGSRDYDVPSIFRENQRLSITV 228

Query: 235 FGSADADDGESLNNNDYSDEETVIFTSSSNIETDAITDDMK--PIRRCNSHESVLSVHNK 292
           F   D D       +  SD++TVI        +    DD K  P+RR NSHES+LS    
Sbjct: 229 FDDFDED------ADSTSDQDTVI--------SLVPADDGKGLPLRRFNSHESILST--- 271

Query: 293 FVPKNNNNLQFQNRLEPFGRYLATSNNRNFTIPSIQNIQVSGTSTLSRFSREQDREMTQL 352
                   +Q  + L  F  +L  S+NR    PS+++++VS     S+ S          
Sbjct: 272 -------KVQPISSLPLFSSFLLPSSNR----PSMKSVRVSSAPVFSKTS---------- 310

Query: 353 GSKTSKDLLTSVMT-------ATPITTQRNNKLTFFDKFNSMFNFSTISEEQKTTVEKNR 405
              +S+DLL++ +T       AT I  ++ NKL FF  +N     S+ S + + T +K  
Sbjct: 311 APASSRDLLSTFVTRPGKASNATGI--KQENKLGFFANWNFFKGPSSASHDIRATKQKAS 368

Query: 406 SAE---------------------SPR--------NDFVSIEELNEALTTNMVM 430
           ++                      SPR        +  +S E+L EAL+T +++
Sbjct: 369 ASRPESNSADCRSKTLEKMAPRRFSPRSPVKAPVFDSLISYEDLREALSTEIIL 422

>Smik_3.13 Chr3 (18714..19991) [1278 bp, 425 aa] {ON} YCL063W (REAL)
          Length = 425

 Score =  149 bits (376), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 146/454 (32%), Positives = 231/454 (50%), Gaps = 59/454 (12%)

Query: 3   SLEEITERLLERSNEAIEQLDEWILLQNKNRHISENKSGLDSIERLDDKYTEFLEKLNSL 62
           +LE+ITERLL RS EAI QLD WI  Q + R      +  + ++++  +Y +++ +LNSL
Sbjct: 5   ALEDITERLLIRSQEAILQLDLWI--QRQQRSSVCQTTDQELLDKVSKQYNQYMSQLNSL 62

Query: 63  YIRSQYIKDKIRTEKNAKATKRKSELNTSRIQELMLEFKEITLSLNEIAQQDDETNSKQL 122
           Y+RS+ ++DK+  E+  +     +E    RI++L+ EF++ITL LNE+A   +E  +   
Sbjct: 63  YVRSESVRDKLSKEQQRRLITEDNE--HQRIEDLVREFQDITLRLNELATAPNEVAND-- 118

Query: 123 SPASTSTKSSLESFTPKPLKILNRASMIRSPINSPPKKRNISFCPIHENLSVTEYEXXXX 182
           SP S ST+SSLESF P+PLKI+ R  +     + PPKK ++ F PI++   V        
Sbjct: 119 SPQSQSTRSSLESFQPRPLKIIERQRLCMVTPSKPPKK-SVGFNPIND---VDCPSKTNS 174

Query: 183 XXXXXXXXEEQEQVLHPARSFQTGLRTEKARKP-DKNQLDKYFKDKQRLSLTLFGSADAD 241
                     +   L  A+S  TGL   K++KP   +  + +FK++QRLSLT F   D  
Sbjct: 175 LPCSPKKQPAKNHTLRAAKSHDTGL--NKSKKPSSADAYESFFKNRQRLSLTFFDEMDD- 231

Query: 242 DGESLNNNDYSDEETVIF---TSSSNIETDAITDDMKPIRRCNSHESVLSVHNKFVPKNN 298
                  +  SD++TVI    ++  ++   A   + +P+RR NSHES+LS  NK  P   
Sbjct: 232 ------EDFDSDQDTVILPNISTPPHVNVTAKGAEFEPLRRYNSHESILS--NKPAP--- 280

Query: 299 NNLQFQNRLEPFGRYLATSNNRNFTIPSIQNIQVSGTSTLSRFSREQDREMTQLGSKTSK 358
                 + L  F       +N  F   SI N+Q +   T++     +      + + +SK
Sbjct: 281 ---LMSHSLGSFPVSFFKPSNPTFGT-SISNVQANCHPTITATMAPR---RNGVHAPSSK 333

Query: 359 DLLTSVMTAT--PITTQRNNKL---TFFDKFNSMFNFSTISEEQKTTVEK---------- 403
            LL+S +  +  P+  Q    L   +  DKFNS  + +TISE  ++  +K          
Sbjct: 334 ALLSSFIGRSERPMVKQNTPNLKHVSLLDKFNS--SLTTISESFQSKKKKNKDLNDERIS 391

Query: 404 --NRSAESPRNDF-----VSIEELNEALTTNMVM 430
             +      RN+      VSIEEL +AL T +++
Sbjct: 392 SLDHIGAHDRNNCIMDMSVSIEELQDALNTELLL 425

>NDAI0A00130 Chr1 (6694..8130) [1437 bp, 478 aa] {ON} Anc_1.4
           YCL063W
          Length = 478

 Score =  145 bits (365), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 150/470 (31%), Positives = 232/470 (49%), Gaps = 100/470 (21%)

Query: 2   ASLEEITERLLERSNEAIEQLDEWILLQNKNRHISE-NKSGLDSIERLDDK-YTEFLEKL 59
            +L++ITERLL RS EAI QLD WI  + K + +S  N S   + + +D++ Y  +L +L
Sbjct: 3   TTLQDITERLLIRSQEAILQLDLWIQREKKQQELSTLNNSNNITYDHVDNQQYNVYLAQL 62

Query: 60  NSLYIRSQYIKDKIRTEKNAKATKRKSELNTSRIQELMLEFKEITLSLNEIAQQDDETNS 119
           NSL +R QYI+DK     N   + +  +     I+ L+ EFK+ITL LN++++++  T+S
Sbjct: 63  NSLIVRVQYIRDKFLHNINQLDSTQDEQ---KYIENLVYEFKQITLKLNDLSKKNKTTSS 119

Query: 120 KQLSPASTSTKSSLESFTPKPLKILNRA---SMIRSPINSP----------PKKRNISFC 166
            + S  + S+KSS+ESF PKPLKI+ R      + + IN+            +  ++   
Sbjct: 120 SENSSKTASSKSSMESFEPKPLKIIKRTKNDQKVSNTINNDHDLIMQDENLQRPNSLPSS 179

Query: 167 PIHENLSVTEYEXXXXXXXXXXXXEEQEQVLHPARSFQTGLRTEK------ARKPDKNQL 220
           PI ++  VT                EQ   L  ++ F T   T +       RK + + +
Sbjct: 180 PIEKSSYVT------------ISQNEQNLRLMKSQDFSTKKNTSRNTNYNTIRKFENDTI 227

Query: 221 DKYFKDKQRLSLTLF------------GSADADDGESLNNNDYSDEETVIFTSSSNIETD 268
           +++FK +QRLS+ +F            G+A    GE L +N+ SD+ TVI  S   I+ +
Sbjct: 228 NQFFKSQQRLSIGIFDNDDDNIYSTNMGTATRITGEYLTDNN-SDQATVI--SQGTIKRN 284

Query: 269 AITDDMKPIRRCNSHESVLSVHNKFVP--KNNNNLQFQNRLEPFGRYLATSNNRNFTIPS 326
              DD  P+RR NSHES+LS      P   NNNNL F ++L      L +S  R    PS
Sbjct: 285 D--DDFTPLRRYNSHESILSQKISSTPLIDNNNNLTFNSKLP-----LYSSIRR----PS 333

Query: 327 IQNIQVSGTSTLSRFSREQDREMTQLGSKTSKDLLTSVMTA---------------TPIT 371
           +Q+I V+     +R S+           KTSKDLL+S +T+               T   
Sbjct: 334 MQSIHVTSNPIFARSSQ----------GKTSKDLLSSFVTSSIPRNNNRNIQTRTKTRTQ 383

Query: 372 TQRNNKL-----------TFFDKFNSMFNFSTISEEQKTTVEKNRSAESP 410
           ++RNN+L           +FF  +N +  F+ I+ E  TT  + R+   P
Sbjct: 384 SRRNNQLRDHTINQTSTSSFFGNWNFLNRFNMITSETNTTTNRKRNYNIP 433

>Skud_3.2 Chr3 (5324..6604) [1281 bp, 426 aa] {ON} YCL063W (REAL)
          Length = 426

 Score =  129 bits (324), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 147/457 (32%), Positives = 224/457 (49%), Gaps = 64/457 (14%)

Query: 3   SLEEITERLLERSNEAIEQLDEWILLQNKNRHISENKSGLDSIERLDDKYTEFLEKLNSL 62
           +LE+ITERLL RS EAI QLD WI  Q + R      S  +S+++L  +Y +++ +LNSL
Sbjct: 5   ALEDITERLLIRSQEAILQLDLWI--QRQQRSSVCQTSDQESLDKLSQQYNQYMSQLNSL 62

Query: 63  YIRSQYIKDKIRTEKNAKATKRKSELNTSRIQELMLEFKEITLSLNEIAQQDDETNSKQL 122
           Y+RS+ ++DK+  E+  +     +E    RI++L+ EF++IT  LNE+A      ++   
Sbjct: 63  YVRSESVRDKLSKEQQRRLITEDNE--HQRIEDLVHEFQDITSRLNELATVPHGVSNDSP 120

Query: 123 SPASTSTKSSLESFTPKPLKILNRASMIRSPINSPPKKRNISFCPIHENLSVTEYEXXXX 182
              S ST+SS  SF P+PLKI+ R  +     + PPKK ++ F PI++   V        
Sbjct: 121 --QSQSTRSSSGSFQPRPLKIIERQRVCMVTPSKPPKK-SVGFNPIND---VDCPSKTNS 174

Query: 183 XXXXXXXXEEQEQVLHPARSFQTGLRTEKARKPDKNQLDKYFKDKQRLSLTLFGSADADD 242
                     + + L  A+S  TGL   K +    +  + +FK+KQRLSLT F       
Sbjct: 175 LPCSPKKPPAKNRTLRAAKSHDTGLNKSK-KMSSTDAYESFFKNKQRLSLTFF------- 226

Query: 243 GESLNNNDYSDEETVIF---TSSSNIETDAITDDMKPIRRCNSHESVLSVHNKFVPKNNN 299
            E  + +  SD++T+I    ++  ++   A   + +P+RR NSHES+LS  NK  P    
Sbjct: 227 DEMDDEDLDSDQDTIILPNISTPPHMNVTAKGAEFEPLRRYNSHESILS--NKPAPI--- 281

Query: 300 NLQFQNRLEPFGRYLATSNNRNFTIPSIQNIQVSG--TSTLSRFSREQDREMTQLGSKTS 357
                  L  F       ++  F   S  N+QV    T T+S  SR          + +S
Sbjct: 282 ---MSLSLGGFPGSFYKPSHPTFGT-STSNVQVDCHPTITVSMASRRNG-----CYAPSS 332

Query: 358 KDLLTSVMTATP--ITTQRN----NKLTFFDKFNSMFNFSTISEE-QKTTVEKNRSAESP 410
           K LL+S + A P  I  +++       +F DKFNS  + STISE  Q    +KN+     
Sbjct: 333 KALLSSFI-ARPDRIAAKQDPTNLKHTSFLDKFNS--SLSTISESFQNKKGKKNKDVNDG 389

Query: 411 R-----------------NDFVSIEELNEALTTNMVM 430
           R                 +  VSIEEL +AL T ++ 
Sbjct: 390 RISNLNHIATQEQKKNIMDMSVSIEELQDALNTELLF 426

>ZYRO0F18502g Chr6 complement(1527109..1528461) [1353 bp, 450 aa]
           {ON} similar to uniprot|P25591 Saccharomyces cerevisiae
           YCL063W VAC17 vacuole inheritance
          Length = 450

 Score =  127 bits (319), Expect = 9e-32,   Method: Compositional matrix adjust.
 Identities = 137/447 (30%), Positives = 223/447 (49%), Gaps = 68/447 (15%)

Query: 1   MASLEEITERLLERSNEAIEQLDEWILLQNKNRHISENKSGLDSIERLDDKYTEFLEKLN 60
           M SL++I+ERL  RS EA+ QL+ WI  Q   +H+SE +    + +++ D+Y  ++ +LN
Sbjct: 1   MPSLDDISERLFIRSQEAVLQLELWIRRQ---QHLSEIEHE-HARDKIADQYNLYMAQLN 56

Query: 61  SLYIRSQYIKDKIRTEKNAKATKRKSEL--NTSRIQELMLEFKEITLSLNEIAQQDDETN 118
           SL +RS+Y++DK+    NA    RK  +    + I++L+ EF++IT+ LNE+AQ   E  
Sbjct: 57  SLCVRSEYVRDKL----NAGYQNRKPPIVNEQNYIEDLVYEFQDITVKLNELAQNQKE-- 110

Query: 119 SKQLSPASTSTKSSLESFTPKPLKILNR-----ASMIRSPINSPPKKRNISFC--PIHEN 171
             Q++P+S  +  S+ SF P+PLKI  R      +  +SP     K +N++F    + E 
Sbjct: 111 --QVTPSSKHSNGSVNSFQPRPLKITERYRTDIGATRQSPTRINGKLKNVNFVEESLPEL 168

Query: 172 LSVTEYEXXXXXXXXXXXXEE-QEQVLHPARSFQTGLRT---EKARKPDKNQLDKYFKDK 227
              ++              +   ++ L  A+S+ TGL      K +K  + ++   FK+ 
Sbjct: 169 FCPSKCTSLPGSPLKMRSPDRLPDRPLRVAKSYDTGLNPNSRAKLKKQKEEEMLSVFKEN 228

Query: 228 QRLSLTLFGSADADDGESLNNNDYSDEETVIFTS----SSNIETDAITDDMKPIRRCNSH 283
           QRLS+T     D D+G    ++  SD+ TVI TS    S  I+ D +  +  P+RR NSH
Sbjct: 229 QRLSITFCD--DIDEG----SDSASDQNTVISTSPIPPSHPIQYD-VQSEKPPLRRYNSH 281

Query: 284 ESVLSVHNKFVPKNNNNLQFQNRLEPFGRYLATSNNRNFTIPSIQNIQVSGTSTLSRFSR 343
           +SVLS   K  P ++          P    + T+N      PS++++ VS    +S    
Sbjct: 282 DSVLST--KVQPISSAKC-------PTFLTIPTANR-----PSMKSVTVSSAPIISSTG- 326

Query: 344 EQDREMTQLGSKTSKDLLTSVMTATPITTQRNNKLTFFDKF-NSMFNFSTISEEQKTTVE 402
                    G  +SKDLL+S ++     TQ  +K    D   N+ F+ + I    K   +
Sbjct: 327 ---------GKASSKDLLSSFIS----NTQDYDKKARNDNGNNNRFSSNLIWNLFKQKSQ 373

Query: 403 KNRSAES---PRNDFVSIEELNEALTT 426
           KNR+      P+ D  S  + N+ LTT
Sbjct: 374 KNRNPTPLRVPQQDVTSERKENQLLTT 400

>KNAG0C00190 Chr3 (28746..30074) [1329 bp, 442 aa] {ON} Anc_1.4
           YCL063W
          Length = 442

 Score =  122 bits (306), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 129/425 (30%), Positives = 200/425 (47%), Gaps = 62/425 (14%)

Query: 1   MASLEEITERLLERSNEAIEQLDEWILLQNK---NRHISENKSGLDSIERLDDKYTEFLE 57
           M  LE++T+RLL RS +AI QL+ W+  Q K     H S ++   ++I +  + +   L 
Sbjct: 1   MDCLEDVTDRLLIRSQDAILQLELWVQQQEKLLLTDHASVDRKKFEAIAQQRNLH---LS 57

Query: 58  KLNSLYIRSQYIKDKIRTEKNAKATKRKSELNTSRIQELMLEFKEITLSLNEIAQQDDET 117
           +LNSL +RS+YIK+K+ +E+N  + ++      S I+ L+ EF++I +SLNE++    ET
Sbjct: 58  QLNSLCLRSRYIKEKLASERNICSIRKGRR---SYIENLVYEFQDIAMSLNELS----ET 110

Query: 118 NSKQLSPASTSTKSSLESFTPKPLKILNRASMIRSPINSPPKKRNISFCPIHENL----- 172
           N K  SP S +T +S +SF PKPL+IL R    R+     P KRN +   I         
Sbjct: 111 NRKNGSPVSQATTNSSDSFEPKPLRILERQ---RTCNAKSPTKRNSNHIKIPRETEKSDF 167

Query: 173 --SVTEYEXXXXXXXXXXXXEEQEQVLHPARSFQTGLRTEKARKPDKNQLDKYFKDKQRL 230
             +V +                 +Q +   +S+   L  +K      + L   F  K RL
Sbjct: 168 TENVADCLHSSLPSSPLRGSNGSQQTIRLTKSYHESLNGQKPT--SHSPLMNPFNAKNRL 225

Query: 231 SLTLFGSADADDGESLNNNDYSDEETVIFTSSSNIETDAITDDMKPIRRCNSHESVLSVH 290
           SL LF + D  +     ++D SD+ETV++ S    +  A     +P+RR NSHES+LSV 
Sbjct: 226 SLYLFDNIDEKELTPC-DDDNSDQETVMYNSPVVSKGAA----FEPLRRYNSHESILSVA 280

Query: 291 NKF-VPKNNNNLQFQNRLEPFGRYLATSNNRNFTIPSIQNIQVSGTSTLSRFSREQDREM 349
            K  +  +   LQF         Y + +N       S Q++ VS     ++    Q R  
Sbjct: 281 KKAPIHSSAQKLQF---------YPSATNGTT----SAQSVFVSSKPVYTKPLSVQSR-- 325

Query: 350 TQLGSKTSKDLLTSVMTATPI----TTQRNNKLTFFDK-----FNSMFNFSTISEEQKTT 400
                  SKDLL+S+  A       TT   N    F K       S      IS+++ + 
Sbjct: 326 -------SKDLLSSIAHAEASKDTKTTSVFNGWNLFGKSSTAAITSEVGTCAISQKKHSA 378

Query: 401 VEKNR 405
           ++ NR
Sbjct: 379 IKTNR 383

>Kpol_2002.7 s2002 (10372..11796) [1425 bp, 474 aa] {ON}
           (10372..11796) [1425 nt, 475 aa]
          Length = 474

 Score =  120 bits (302), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 111/309 (35%), Positives = 173/309 (55%), Gaps = 38/309 (12%)

Query: 2   ASLEEITERLLERSNEAIEQLDEWILLQNKNRHISENKSGLDSIERLDDKYTEFLEKLNS 61
           +++++++ERLL RS EAI QLD WI  Q +     +N    D +E++ D Y  ++ +LNS
Sbjct: 4   SNIDDLSERLLVRSQEAILQLDLWIQRQQQWAESDDNHDEND-LEKVTDTYNLYMSQLNS 62

Query: 62  LYIRSQYIKDKIRTEKNAKATKRK----SELNT---SRIQELMLEFKEITLSLNEIAQQD 114
           LYIRSQ ++DK+ T+K ++    K    S++N    S I++L+ EF++IT  LN +A   
Sbjct: 63  LYIRSQNVRDKLNTKKKSRTNTIKYVSPSKVNMNGQSDIEDLIFEFQDITRKLNVLASSR 122

Query: 115 DETNSKQLSPASTSTKSSLESFTPKPLKILNRASMIRSPINSPPKKRNISFCPIHENLSV 174
              +S +   +S+S  SS+ SF PKPLKI    S+ R+       K+ ++F  + E   V
Sbjct: 123 RRCSSSK---SSSSRSSSIGSFQPKPLKI----SLKRNKSLKEQNKKTVTF-DVEE---V 171

Query: 175 TEYEXXXXXXXXXXXXEEQE------QVLHPARSFQTGLRTEKARKPDKNQLDKY----F 224
           T+                ++        L  A+S+ TGL ++++ KP K+++D      F
Sbjct: 172 TDLNINSVISLPGSPLRNEQSSPPMNHHLRQAKSYDTGLNSKRSIKPKKSKIDSVYDSTF 231

Query: 225 KDKQRLSLTLFGSADADDGESLNNNDYSDEETVIFTSSSNI-ETDAITDD----MKPIRR 279
           K+ QRLS++LF   D D  E+   N  SD+ETVI +SS  + E   I DD    +KP+RR
Sbjct: 232 KNTQRLSISLF---DIDTNENDITN-ISDQETVISSSSLTMDEPLEIIDDQKNNLKPLRR 287

Query: 280 CNSHESVLS 288
            NSHES+LS
Sbjct: 288 YNSHESILS 296

>SAKL0C00440g Chr3 (39662..41050) [1389 bp, 462 aa] {ON} weakly
           similar to uniprot|P25591 Saccharomyces cerevisiae
           YCL063W VAC17 vacuole inheritance
          Length = 462

 Score =  118 bits (295), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 125/393 (31%), Positives = 184/393 (46%), Gaps = 66/393 (16%)

Query: 1   MASLEEITERLLERSNEAIEQLDEWILLQNK---NRHISENKSGLDSIERLDDKYTEFLE 57
           M  L EI+++LL RS EAI QLD +I  Q +      + +  +GL  + +L + Y   L 
Sbjct: 1   MEGLHEISQKLLVRSQEAILQLDLYIQRQQRLYEYETLDQPDNGL--LTKLQE-YQTCLA 57

Query: 58  KLNSLYIRSQYIKDKIRTEKNAKATKRKSELNTSRIQELMLEFKEITLSLNEIAQQDDET 117
           +LNSL+IRS++++D+I       +T  ++  +   I  L+ EF++IT  LNE+A   D  
Sbjct: 58  QLNSLHIRSEHLRDRI------ASTDHRASQDGDSIGHLVTEFQKITTKLNELAATQDRA 111

Query: 118 NSKQLSPASTSTKSSLESFTPKPLKILNRASMIR--SP---INSPPKKRNISFCPIHENL 172
                SP S STKS + SF PKPLKIL R  +    SP   + +PPKK      P+ +N 
Sbjct: 112 YQ---SPGSQSTKS-VSSFEPKPLKILERTKLQHPTSPTKRVATPPKK----IAPLRKNP 163

Query: 173 SV------------TEYEXXXXXXXXXXXXEEQEQVLHPARSFQTGLRTEKARKPDKNQL 220
                         T                +QE+    A+S   GL  ++ R+ D +  
Sbjct: 164 PFDKKVMFSGHSKSTSLPGSPSMAASSPVSIQQERFPRHAKSCDAGLNKQQRRRQDSDNR 223

Query: 221 DKYFKDKQRLSLTLFGSADADDGESLNNNDY-SDEETVIFTSSSNIETDAITDDMKPIRR 279
             +FK+ QRLS++ F     DD       DY SDE+TVI  S     +       +P+RR
Sbjct: 224 LNFFKENQRLSISFF-----DD-----EIDYSSDEDTVISVSPPETTSFKGFPKAEPLRR 273

Query: 280 CNSHESVLSVHNKFVPKNNNNLQFQNRLEPFGRYLATSNNRNFTIP---SIQNIQVSGTS 336
            NSHESVLS   + +P          R   F  + A  NN+   +    SI +  V  T+
Sbjct: 274 YNSHESVLS-RKEVLPA-----ALPARAGWFSLW-AGRNNKPKPMAESVSINDKPVYSTA 326

Query: 337 TLSRFSREQDREMTQLGSKTSKDLLTSVMTATP 369
            L R   +         ++TSKDLL   ++A P
Sbjct: 327 ALLRSHSKT--------TETSKDLLAQFVSAAP 351

>TPHA0E04020 Chr5 complement(842960..844582) [1623 bp, 540 aa] {ON}
           Anc_1.4 YCL063W
          Length = 540

 Score =  106 bits (264), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 117/400 (29%), Positives = 188/400 (47%), Gaps = 86/400 (21%)

Query: 2   ASLEEITERLLERSNEAIEQLDEWILLQ----NKNRHISENKSG---LDSIERLD---DK 51
           ++LEE++E+LL RS EAI QLD WIL Q    N +R  +   +G    DS E L+     
Sbjct: 6   SNLEELSEKLLIRSQEAILQLDLWILRQQQQHNDHRFGTATDTGNKTKDSNEALNALRST 65

Query: 52  YTEFLEKLNSLYIRSQYIKDKIRTEKNAKATKRKSELNTSRIQELMLEFKEITLSLNEIA 111
           Y  ++ +LNSLY+RS++I+DK+ +EKN      K  L+   I+EL+ EF+ I   LN++A
Sbjct: 66  YDLYMSQLNSLYVRSEFIRDKLNSEKN---NVNKFNLDHRNIEELVFEFQNIREKLNQLA 122

Query: 112 QQDDETNSKQLSPASTSTK-SSLESFTPKPLKILNRA-SMIRSPINSPPKKRNISF---- 165
                +   + SP  TST+ SS+ES   KPLK++ +    +   +    K+++++F    
Sbjct: 123 AS---SKLDKHSPPKTSTRSSSMESMNLKPLKVVAKHEKRMSKELELKNKEKSVTFGKET 179

Query: 166 -CPIHENLSVTEYEXXXXXXXXXXXXEEQEQVLHPARSFQTGLRTE---------KARKP 215
              +  N    +              +++ +VL  A S+ TGL ++         + RK 
Sbjct: 180 RISLTTNGIGGKLMIKDDSDASPQLIDKKYKVLRNAISYDTGLNSKSKSNKRSNREYRKK 239

Query: 216 DKNQLDKYFKDKQRLSLTLF----------------GSADAD-DGESLNNNDYSDEETVI 258
           +    D  FK+KQR S++LF                 + DA  + E + NN  SD+ETVI
Sbjct: 240 NDAAYDSLFKNKQRFSISLFEDYVDTTTNTNYNEFNPTVDASINTELIENN--SDQETVI 297

Query: 259 FTSSSNIETDAITDDM---------------------KPIRRCNSHESVLS--VHNKFVP 295
            +S     T+   DD                        +RRCNSHES+LS  + N F  
Sbjct: 298 SSSHLPCITNEPLDDYILSNSIQLDKNNNSGNNEGKKSHLRRCNSHESILSTKLENTFYK 357

Query: 296 KNNNNLQFQNRLEPFGRYLATSNNRNFTIPSIQNIQVSGT 335
              +N         + R++ +S    F  P++ ++  + T
Sbjct: 358 NVGSNF--------YDRFIFSS----FYRPTVASVSTTST 385

>TBLA0A07580 Chr1 complement(1878594..1880135) [1542 bp, 513 aa]
           {ON} Anc_1.4 YCL063W
          Length = 513

 Score = 94.7 bits (234), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 102/320 (31%), Positives = 168/320 (52%), Gaps = 42/320 (13%)

Query: 1   MASLEEITERLLERSNEAIEQLDEWILLQNKNRHISENKSGL-----DSIERLDDKYTEF 55
           MA  EE++ RLL ++ EA+ QLD WI    K++   +N+ GL     +S+E+ +  Y  +
Sbjct: 1   MALQEEVSIRLLTKAQEAVLQLDLWI----KDQQGFQNRDGLRASTSESLEQAERDYNRY 56

Query: 56  LEKLNSLYIRSQYIKDKIRTEKN---AKATKRKSELNT-SRIQELMLEFKEITLSLNEI- 110
           + +LNSLY+R+QYI+DKI  +     A +    ++ N+ + +Q+L+ EF  +++ +NE+ 
Sbjct: 57  MFQLNSLYLRAQYIRDKIEKQNAYNLADSDVAGNDTNSHAYVQQLVTEFYSLSIKMNELS 116

Query: 111 AQQDDETN-SKQLSPASTSTKSSL----ESFTPKPLKIL-------NRASMIRSPINSPP 158
           A Q++ TN S  LS  S+ +  SL    + F P+PLKIL       N+ +  +  + SP 
Sbjct: 117 AIQENVTNGSSPLSNKSSHSNDSLSKITDGFQPRPLKILQRQKHNNNQNTHPQPDLESPL 176

Query: 159 K-KRNISFCPIHENLSVTEYEXXXXXXXXXXXXEEQEQV--LHPAR--SFQTGLRTEKAR 213
           K K   S+  +   LS  + E            +  E +  + P +  SF+    +  A 
Sbjct: 177 KLKHRSSYNKL---LSSNKKESKPYKNFNSKKSKNNELLSDISPVKIQSFEEPTFS-VAN 232

Query: 214 KPDKNQLDKY----FKDKQRLSLTLFGSADADDGESLNNNDYSDEETVIFTSSSNIETDA 269
             +KN +D      FK   RLS+      D DD E  +    SD++T IF S+  I + +
Sbjct: 233 TRNKNSMDPLHYSLFKTNNRLSIQFPDGYDNDD-EYDDPTCISDQDT-IFVSTPKIAS-S 289

Query: 270 ITDDMKPIRRCNSHESVLSV 289
           I +  +P+R+ NSHES+LSV
Sbjct: 290 IKNTSEPLRKFNSHESILSV 309

>NCAS0B09120 Chr2 complement(1749531..1750832) [1302 bp, 433 aa]
           {ON} Anc_1.4 YCL063W
          Length = 433

 Score = 90.9 bits (224), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 131/481 (27%), Positives = 205/481 (42%), Gaps = 99/481 (20%)

Query: 1   MASLEEITERLLERSNEAIEQLDEWILLQNKNRHIS----------ENKSGLD---SIER 47
           M+ L++I+ERLL RS EAI QLD WI  Q + + +           +  + +D   ++ +
Sbjct: 1   MSLLQDISERLLVRSQEAILQLDVWIQRQRRLQELMEGEEEQEQGGDTNTNMDIRGTLPQ 60

Query: 48  LDDKYTEFLEKLNSLYIRSQYIKDKIRTEKNAKATKRKSELNTS-----RIQELMLEFKE 102
             ++Y  ++ +LNSL +R ++I+D +  +KN     ++ E N S      IQ+L+ EF++
Sbjct: 61  FLEQYNTYMAQLNSLQVRVEFIRDTLVNKKNTGIRNQQLESNNSVDEQKYIQDLVHEFQD 120

Query: 103 ITLSLNEIAQQDDETNSKQLSPASTSTKSSLESFTPKPLKILNRASMIRSPINSPPKKRN 162
           IT  L+E++      N    S  STSTKSS+ESF PKPL+I++R++            + 
Sbjct: 121 ITQKLSELST---VRNPSTASSRSTSTKSSIESFKPKPLRIISRSNTHSHLHQQTSLDKK 177

Query: 163 ISFCPIHENLSVTEYEXXXXXXXXXXXXEEQEQVLHPARSFQTGLRTEKARKPDKNQLDK 222
           +SF       +  E               E  + L   +S     R+      D     K
Sbjct: 178 VSF-------NEDESNSSISHSRSMESLHENSKSLRNTKSMDVLKRSTFKNHSD---FSK 227

Query: 223 YFKDKQRLSLTLFGS---ADADDGESLNNNDYSDEETVIFTSSSNIETDAITDDMKPIRR 279
               +QRLS+ +F     A+ D  E  N    SD+ TVI        T     D   +RR
Sbjct: 228 LLNSRQRLSINIFDDDLIANEDGNEFYNQYSDSDQATVISHG-----TPIRGADTPLLRR 282

Query: 280 CNSHESVLSVHNKFVPKNNNNLQFQNRLEPFGRYLATSNNRNFTIPSIQNIQVSGTSTLS 339
            NSHES+LS       +  N +            L  S+ R    PS+Q++ V+     S
Sbjct: 283 YNSHESILSFRKPTQSRQPNQI------------LPYSSVRQ---PSMQSVAVNSNPIFS 327

Query: 340 RFSREQDREMTQLGSKTSKDLLTSVMT-----------ATPITTQRNNKLTFFDKFNSMF 388
           R             + TSKDLL+S +              P +     K  FF+KFNS+ 
Sbjct: 328 RMR----------PNATSKDLLSSFINKPQPNRLHQQKPKPNSNSLFGKWNFFNKFNSV- 376

Query: 389 NFSTISEEQKTTVEKNRSAESPRNDF-------------------VSIEELNEALTTNMV 429
                SE   TT +   +  S  N F                   + +E+LN+AL T ++
Sbjct: 377 ----TSEIGTTTTQLYPTNSSMSNKFNPNDIPSSASIREPVFDDSLHLEDLNDALNTELL 432

Query: 430 M 430
           +
Sbjct: 433 L 433

>KLLA0C00462g Chr3 (33948..35330) [1383 bp, 460 aa] {ON} weakly
           similar to uniprot|P25591 Saccharomyces cerevisiae
           YCL063W VAC17 vacuole inheritance
          Length = 460

 Score = 89.7 bits (221), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 101/319 (31%), Positives = 153/319 (47%), Gaps = 57/319 (17%)

Query: 1   MASLEEITERLLERSNEAIEQLDEWILLQNKNRHISENKSGLDSIERLDDKYTEFLEKLN 60
           M  +  + ERL+ R NEA+ QL+  + +Q K      N S      ++ + Y+ FL +L+
Sbjct: 1   MEDMRYVAERLVIRCNEAVMQLE--LSIQRKMCEFDPNNS--HCFIQVQEYYS-FLARLS 55

Query: 61  SLYIRSQYIKDKIRTEKNAKATKRKSELNTSRIQELMLEFKEITLSLNEIAQQDDETNSK 120
           SL +R++++++ +R ++          +    +++L+ EF++IT+SLNE+A+      S 
Sbjct: 56  SLKLRAEHVQESLRHQRK---DPNDVCIEYETLEKLIYEFQDITMSLNEVAR---AYQSP 109

Query: 121 QLSPASTSTKSSLESFTP-KPLKIL--NRASMIR-SPI-------------NSPPKKRNI 163
             S  S S+K S  S  P K LKI+  NR S+I  SP+              S P KRN+
Sbjct: 110 TKSARSGSSKES--SVIPLKTLKIIERNRDSLIGTSPMKKSLSQLKKEEHNQSLPAKRNV 167

Query: 164 SFCP-----IHENLSVTEYEXXXXXXXXXXXXEEQ-----EQVLHPARSFQTGLRTEKAR 213
            F       +H   SV                E Q      + L  A+S+  GL     +
Sbjct: 168 RFQEDDLDILHHLHSVKRANSLPGSPMPDTLLESQMFSREHKTLRMAKSYDVGLNGRAKK 227

Query: 214 KPDKNQLDKYFKDKQRLSLTLFGSADADDGESLNNNDYSDEETVIFTSSSNIETD-AITD 272
             D     ++FK+K RLSL++F     DD     N D SDEETVI  S  NI    +  +
Sbjct: 228 NADW----EFFKNKNRLSLSVF-----DDV----NTDASDEETVISVSPPNISYYLSQNE 274

Query: 273 DMKP---IRRCNSHESVLS 288
           D  P   +RRCNSHES+LS
Sbjct: 275 DQYPSKQVRRCNSHESILS 293

>KAFR0D00120 Chr4 (9052..10251) [1200 bp, 399 aa] {ON} Anc_1.4
           YCL063W
          Length = 399

 Score = 73.2 bits (178), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 113/423 (26%), Positives = 186/423 (43%), Gaps = 93/423 (21%)

Query: 1   MASLEEITERLLERSNEAIEQLDEWILLQNKNRHISENKSGLDSIERLDDKYTEFLEKLN 60
           MASL  +++ LL+RS EA+ QL+ W+  Q                E+L     E+ ++LN
Sbjct: 1   MASL--VSDTLLQRSEEAVSQLESWLKQQ----------------EQLHQTTAEY-KQLN 41

Query: 61  SLYIRSQYIKDKIRTEKNAKATKRKSELNTSRIQE-LMLEFKEITLSLNEIAQQDDETNS 119
           SL  +S+YI + ++ + ++       +   S I E L+ EF EI+  LNEI         
Sbjct: 42  SLCAKSKYISNLLKDDSSSIPHDLMEQKERSFIVESLIHEFNEISTKLNEIVTH------ 95

Query: 120 KQLSPASTSTKSSLESFTPKPLKILNRASMIRSPINSPP-------KKRNISFCPIHENL 172
                  TS +S+++SF PKPL +L +  ++ SP  S P       +K +I+  P+H   
Sbjct: 96  -------TSPQSTIDSFEPKPLNLLRKNKILESPTRSSPVTRGRLERKISINLFPMH--- 145

Query: 173 SVTEYEXXXXXXXXXXXXEEQEQVLHPARSFQTGLRTEKARKPDKNQLDKYFKDKQRLSL 232
           + T+                 ++ L   +S+  GL  +             FK+  RLS+
Sbjct: 146 TTTKCNSVPTSPKCKSTSTLNQRTLRNIKSYHYGLNGDYINP---------FKENNRLSI 196

Query: 233 TLF-GSADADDGESLNNNDYSDEETVIFTSSSNIETDAITDDMKPIRRCNSHESVLSVHN 291
           + F G    +D  S + +D  D++TV+ TS        +T+  + ++R NS +SV     
Sbjct: 197 SFFNGDNTFNDNNSDSESDIDDDDTVLVTS------PFLTNPKQKLKRSNSQDSVF---- 246

Query: 292 KFVPKNNNNLQ---FQNRLEPFGRYLATSNNRNFTIPSIQNIQVSGTSTLSRFSREQDRE 348
                N N L+   FQ +L  F              PS      +  S+   F +   R 
Sbjct: 247 ----WNENYLRKPSFQKQLNLF--------------PSTLTKPTAELSSTQVFLKNTGR- 287

Query: 349 MTQLGSKTSKDLLTSVMTATPITTQRNNKLTFFDKFNSMFNFSTISEEQKTTVEKNRSAE 408
              LGS +SK LLTS +       QR +  +    FN++FN S  SE  K+ ++K++   
Sbjct: 288 ---LGS-SSKALLTSFVKDNLQQQQRTHNAS---SFNNIFN-SVTSEIGKSKLDKSQIIH 339

Query: 409 SPR 411
           + R
Sbjct: 340 TER 342

>Kwal_33.13003 s33 (35425..36774) [1350 bp, 449 aa] {ON} YCL063W -
           Hypothetical ORF [contig 123] FULL
          Length = 449

 Score = 61.2 bits (147), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 79/301 (26%), Positives = 133/301 (44%), Gaps = 57/301 (18%)

Query: 1   MASLEEITERLLERSNEAIEQLDEWILLQNKNRHISENKSGLDSIERLDD----KYTEFL 56
           M  L +I +  LERS EA+ +L++ +    K R + E++     +         +Y  +L
Sbjct: 1   MEQLAKIAQCALERSEEALVRLEKCV---GKQRRLYESERSDQCLSEESSSTIVQYYSYL 57

Query: 57  EKLNSLYIRSQYIKDKIRTEKNAKATKRKSELNTS---RIQELMLEFKEITLSLNEIA-- 111
            +LN LYI++Q +KD +          R   L  S    I+ L  ++K +    NE+   
Sbjct: 58  GQLNCLYIKAQSLKDMM--------GNRCGHLPNSTQEAIERLEHDYKALCNHANELGIR 109

Query: 112 QQDDETNSKQLSPASTSTKSSLESFTPKPLKILNRASMIRSPINSPPKKRNI------SF 165
           +++ E +   LSPAS S      SF PKPLKI+ R     +  N+ P K         SF
Sbjct: 110 EKNLEDSPSCLSPASVS------SFQPKPLKIIERR---LAQTNTSPTKVCTATVMAKSF 160

Query: 166 CPIHENLS-------VTEYEXXXXXXXXXXXXEEQEQVLHPARSFQTGLRTEKARKPDKN 218
           C    + +       + +              +++ + +   +S  TGL   K   P +N
Sbjct: 161 CRSGTDKNSDYIPDEIGKTNSCNTNSPCTNEAKKEPKFIRVVKSCGTGL--NKHSNPHEN 218

Query: 219 QLDKYFKDKQRLSLTLFGSADADDGESLNNNDYSDEETVIFTSSSNIETDAITDDMKPIR 278
           +L  +F+D+QRLS++       +D E L     SDEET+  TS S +    + +D   + 
Sbjct: 219 RLS-FFRDRQRLSISFI-----EDDEYL-----SDEETI--TSGSPLNASFLLNDFAKVA 265

Query: 279 R 279
           +
Sbjct: 266 K 266

>KLTH0F00462g Chr6 (35640..36995) [1356 bp, 451 aa] {ON} weakly
           similar to uniprot|P25591 Saccharomyces cerevisiae
           YCL063W VAC17 vacuole inheritance
          Length = 451

 Score = 53.9 bits (128), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 84/294 (28%), Positives = 130/294 (44%), Gaps = 74/294 (25%)

Query: 1   MASLEEITERLLERSNEAIEQLDEWILLQNKNRHISENKSGLDSIERLDDK-------YT 53
           M  L+EI +  L  S  A+ +LD  +    + R + E  SG    + L DK       Y 
Sbjct: 1   MEQLQEIAQESLALSQSALARLDSCL---ERQRRLYE--SGFPD-QCLSDKSSTNMAQYY 54

Query: 54  EFLEKLNSLYIRSQYIKDKIRTEKNAKATKRKSELNTSRIQELMLEFKEITLSLNEIAQQ 113
           E++ +L SLY ++Q + D +        +K  S +    I+ L+ EF+EI         +
Sbjct: 55  EYIGQLYSLYTKAQKLSDTVILSD----SKSLSSVQQRAIENLIQEFQEIA--------K 102

Query: 114 DDE---TNSKQLSPASTSTKSSLESFTPKPLKILNRASMIRSPINSPPKKRNISFCPIHE 170
           +DE   + S + SP S S +S + SF PKPLKIL R    ++ + SP K+   SF P   
Sbjct: 103 NDENFISYSMRESPNSMSVQS-ICSFQPKPLKILQRR---QAQLESPTKR---SFRP--- 152

Query: 171 NLSVTEYEXXXXXXXXXXXXEEQEQVL----------------------HPARSFQTGLR 208
           ++S+ +                QE++L                        A+S   GL 
Sbjct: 153 SMSLLD-NRGDETNLATASDRSQERLLGSSPSSIHFFRPSHTNADTLFIRSAKSCDAGL- 210

Query: 209 TEKARKPDKNQLDKYFKDKQRLSLTLFGSADADDGESLNNNDYSDEETVIFTSS 262
             +   P +N+L+ +FKD+QRLS++       +D E     D SDE TVI   S
Sbjct: 211 -NRRSNPHENRLN-FFKDRQRLSISFI-----EDEE-----DVSDEATVISAGS 252

>TPHA0A03710 Chr1 complement(813703..814401) [699 bp, 232 aa] {ON}
           Anc_3.337 YBR096W
          Length = 232

 Score = 37.4 bits (85), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 38/166 (22%), Positives = 65/166 (39%), Gaps = 30/166 (18%)

Query: 206 GLRTEKARK--PDKNQLDKYFKDKQRLSLTLFGSADADDGESLNNNDYSD-EETVIFTSS 262
           GL    + K  P    +  YF   +RL L +F + + ++ + L N++Y       ++T +
Sbjct: 13  GLYLASSYKTLPGVYFIRFYFYAVRRLLLPIFTTKNTENMKHLENHEYGAFAHATLYTYA 72

Query: 263 SNIETDAITDDMKP-------IRRCNSHESVLSVHNK---------FVPKNNNNLQFQNR 306
           S +E D               I RC   E + S+  K         +VP  N    F   
Sbjct: 73  SPLECDVYLHKNNATYFSELDINRC---ELMCSIFQKLFLESKRWPYVPVANVFTNFLKD 129

Query: 307 LEPFGRYLATSNNRNFTIPSIQNIQVSGTSTLSRFSREQDREMTQL 352
           ++PF +Y  TSN        I          +S+F ++ D+ +  L
Sbjct: 130 IKPFDKYSVTSN--------ILCWDQKWIYVISKFKKDNDKTLCSL 167

>Skud_12.322 Chr12 (573502..574146) [645 bp, 214 aa] {ON}  YBR042C
           (NOVEL)
          Length = 214

 Score = 33.5 bits (75), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 29/96 (30%), Positives = 44/96 (45%), Gaps = 14/96 (14%)

Query: 247 NNNDYSDEETVIFTSSSNIETDAITDDMKPIRRCNSHESVLSVHNKFVPKNNNNLQFQNR 306
             N YSD + +I ++        ITD M+  R CN     +S HN F    N + ++++ 
Sbjct: 93  GGNTYSDIDDIIVSN--------ITDCMR--RNCNITNISISCHNPFALSANTDEEYEDH 142

Query: 307 LEPFGRYLATSNNRNFTIPSIQNIQVSGT--STLSR 340
              +GR      +R++   SI     SGT  STL R
Sbjct: 143 FAYYGRGYPIDYDRDY--ESIGEPTDSGTDQSTLVR 176

>CAGL0K09042g Chr11 complement(900862..901326) [465 bp, 154 aa] {ON}
           similar to uniprot|Q08687 Saccharomyces cerevisiae
           YOR252w
          Length = 154

 Score = 33.1 bits (74), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 29/53 (54%), Gaps = 1/53 (1%)

Query: 250 DYSDEETVIFTSSSNIETDAITDDMKPIRRCNSHESVLSVHNKFVPKNNNNLQ 302
           D +DE++V+F  + N    A++   K IR  N  + V+  HNKF    NN ++
Sbjct: 101 DLADEQSVVFLRNWNGTFGAMST-FKMIRINNEGKQVVGGHNKFTGSENNEIE 152

>Ecym_3042 Chr3 (83461..85023) [1563 bp, 520 aa] {ON} similar to
           Ashbya gossypii ACL014C
          Length = 520

 Score = 33.1 bits (74), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 29/99 (29%), Positives = 48/99 (48%), Gaps = 13/99 (13%)

Query: 46  ERLDDKYTEFLEKLNSLYIRSQYIKDKIRTEKNAKATKRKSELNTSRIQEL-------ML 98
           ERL  K+  F++ + SL  R  + + KI    N    +RK E+N  ++Q L         
Sbjct: 382 ERLSVKFKTFIDIIISL--RGVFERYKIMAGNNIPQLQRKLEINMEKLQTLSNKPDVKGA 439

Query: 99  EFKEITLSLNEIAQQDDETNSKQLSPASTSTKSSLESFT 137
           E++ I     +I Q+D  T ++Q++ +    K  LE FT
Sbjct: 440 EYERI----KQIVQRDKRTIAEQVNRSWLIRKGILEEFT 474

>NCAS0E03700 Chr5 (726814..729885) [3072 bp, 1023 aa] {ON} 
          Length = 1023

 Score = 32.0 bits (71), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 27/50 (54%)

Query: 356 TSKDLLTSVMTATPITTQRNNKLTFFDKFNSMFNFSTISEEQKTTVEKNR 405
            SK+LL +++    I  +  +   F+DKFNS +  S I EE   T+ K +
Sbjct: 673 VSKNLLYALLDFYVIVEKTGSSSQFYDKFNSRYAISIILEEIYQTIPKYK 722

>CAGL0M00990g Chr13 complement(109609..115548) [5940 bp, 1979 aa] {ON}
            similar to uniprot|Q00416 Saccharomyces cerevisiae
            YLR430w SEN1 positive effector of tRNA-splicing
            endonuclease
          Length = 1979

 Score = 31.6 bits (70), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 24/81 (29%), Positives = 43/81 (53%), Gaps = 10/81 (12%)

Query: 46   ERLDDKYTEFL------EKLNSLYIRSQYIKDKIRTEKNAKATKRKSELNTSRIQELMLE 99
            ++L DK  EF       +K  SL    + ++DK+    NA+     S ++T+ I  L ++
Sbjct: 1422 KKLGDKSYEFTNNPDIEKKFQSLLSERRQLRDKL----NAENGSPDSSMSTNDIANLQMK 1477

Query: 100  FKEITLSLNEIAQQDDETNSK 120
             +E+T S+NE+ ++ DE   K
Sbjct: 1478 IRELTKSINELGREKDEMREK 1498

>KNAG0B06440 Chr2 complement(1267685..1274248) [6564 bp, 2187 aa] {ON}
            Anc_4.310 YLR430W
          Length = 2187

 Score = 30.8 bits (68), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 19/68 (27%), Positives = 36/68 (52%), Gaps = 4/68 (5%)

Query: 53   TEFLEKLNSLYIRSQYIKDKIRTEKNAKATKRKSELNTSRIQELMLEFKEITLSLNEIAQ 112
            +E   K N+   + + ++D++  E  +  +K  SE     I +L LE +E++  +NE+ +
Sbjct: 1438 SELDRKFNNAVTKRRQLRDQLNAEDGSPVSKLSSE----DITKLQLEIRELSKEINELGK 1493

Query: 113  QDDETNSK 120
            Q DE   K
Sbjct: 1494 QRDEIREK 1501

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.309    0.125    0.332 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 46,362,918
Number of extensions: 2180905
Number of successful extensions: 11643
Number of sequences better than 10.0: 382
Number of HSP's gapped: 12279
Number of HSP's successfully gapped: 397
Length of query: 430
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 318
Effective length of database: 40,638,807
Effective search space: 12923140626
Effective search space used: 12923140626
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 67 (30.4 bits)