Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
CAGL0B00286g1.3ON36036017460.0
Suva_3.1501.3ON36133611321e-154
Skud_3.11.3ON36033611051e-150
YCL064C (CHA1)1.3ON36035910991e-150
NCAS0B091301.3ON36733910961e-149
NDAI0A001201.3ON37734910961e-149
Smik_3.121.3ON36033410901e-148
TPHA0E040401.3ON35733810711e-145
KAFR0D001101.3ON36535110441e-141
Kpol_2002.61.3ON35033410351e-140
KNAG0C001801.3ON35934710091e-136
ZYRO0F15774gsingletonON4103349931e-133
TBLA0A049201.3ON3603329811e-132
NCAS0A15330singletonON3473429721e-130
KAFR0I00130singletonON3443429331e-124
KAFR0F04430singletonON3433409151e-122
SAKL0C00418g1.3ON3643388781e-116
NDAI0K02950singletonON3343358341e-110
Smik_9.2na 1ON3383298191e-107
ZYRO0F18524g1.3ON3353288061e-105
Skud_9.2na 1ON3393388051e-105
KLLA0C00440g1.3ON3773298031e-104
Scer_YGOB_SDL1 (SDL1)na 1ON3373297941e-104
Ecym_10061.3ON3643577881e-102
KLTH0F00440g1.3ON3413387741e-101
KNAG0D05380singletonON3343377711e-100
AFR747W1.3ON4263497644e-98
SAKL0C13904gsingletonON3393377434e-96
TDEL0D06540singletonON3373367071e-90
KLLA0E01805gsingletonON3223266425e-81
YIL167W (SDL1)singletonOFF2101985386e-67
KNAG0A01150singletonON2312145371e-66
YIL168WsingletonOFF1271242694e-28
SAKL0F11858g7.367ON5622691862e-14
Ecym_47087.367ON5702891641e-11
NCAS0A142307.367ON5692691622e-11
CAGL0I05126g7.367ON5712691595e-11
YKL218C (SRY1)na 2ON3263121566e-11
KAFR0K017007.367ON5792671532e-10
ZYRO0B02772g7.367ON5692671532e-10
Suva_5.1997.367ON5762691524e-10
YER086W (ILV1)7.367ON5762691515e-10
Skud_5.2057.367ON5762691506e-10
TBLA0C050707.367ON5752911497e-10
Smik_5.2257.367ON5762691498e-10
ACR232C7.367ON5602671471e-09
NDAI0A018107.367ON5702691462e-09
KLLA0E19779g7.367ON5672711462e-09
TDEL0C018007.367ON5692691453e-09
SAKL0A10626gsingletonON3203161423e-09
Kpol_530.167.367ON5662691434e-09
Skud_11.2na 2ON3263121353e-08
TPHA0F031307.367ON5682671354e-08
KNAG0C036907.367ON5772671321e-07
Kwal_33.148227.367ON5622691222e-06
KLTH0B04884g7.367ON5732671142e-05
Smik_11.3na 2ON269237830.062
Kwal_23.34422.325ON139690780.44
CAGL0I05852g6.293ON528119721.9
NCAS0G010106.293ON52173703.9
KNAG0C012501.214ON58282694.9
KNAG0C015701.285ON79069695.6
TBLA0A003108.81ON89341687.2
NDAI0H019507.21ON85661678.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0B00286g
         (360 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0B00286g Chr2 complement(12803..13885) [1083 bp, 360 aa] {ON...   677   0.0  
Suva_3.150 Chr3 complement(225656..226741) [1086 bp, 361 aa] {ON...   440   e-154
Skud_3.1 Chr3 complement(3828..4910) [1083 bp, 360 aa] {ON} YCL0...   430   e-150
YCL064C Chr3 complement(15798..16880) [1083 bp, 360 aa] {ON}  CH...   427   e-150
NCAS0B09130 Chr2 (1751219..1752322) [1104 bp, 367 aa] {ON} Anc_1.3    426   e-149
NDAI0A00120 Chr1 complement(4652..5785) [1134 bp, 377 aa] {ON} A...   426   e-149
Smik_3.12 Chr3 complement(17223..18305) [1083 bp, 360 aa] {ON} Y...   424   e-148
TPHA0E04040 Chr5 (846219..847292) [1074 bp, 357 aa] {ON} Anc_1.3...   417   e-145
KAFR0D00110 Chr4 complement(7211..8308) [1098 bp, 365 aa] {ON} A...   406   e-141
Kpol_2002.6 s2002 complement(7840..8892) [1053 bp, 350 aa] {ON} ...   403   e-140
KNAG0C00180 Chr3 complement(27151..28230) [1080 bp, 359 aa] {ON}...   393   e-136
ZYRO0F15774g Chr6 (1300486..1301718) [1233 bp, 410 aa] {ON} simi...   387   e-133
TBLA0A04920 Chr1 complement(1214344..1215426) [1083 bp, 360 aa] ...   382   e-132
NCAS0A15330 Chr1 (3015596..3016639) [1044 bp, 347 aa] {ON}            379   e-130
KAFR0I00130 Chr9 complement(26703..27737) [1035 bp, 344 aa] {ON}...   363   e-124
KAFR0F04430 Chr6 (868691..869722) [1032 bp, 343 aa] {ON}              357   e-122
SAKL0C00418g Chr3 complement(37529..38623) [1095 bp, 364 aa] {ON...   342   e-116
NDAI0K02950 Chr11 (671102..672106) [1005 bp, 334 aa] {ON}             325   e-110
Smik_9.2 Chr9 (6779..7795) [1017 bp, 338 aa] {ON} YCL064C (REAL)      320   e-107
ZYRO0F18524g Chr6 (1528741..1529748) [1008 bp, 335 aa] {ON} simi...   315   e-105
Skud_9.2 Chr9 (5919..6938) [1020 bp, 339 aa] {ON} YCL064C (REAL)      314   e-105
KLLA0C00440g Chr3 complement(32008..33141) [1134 bp, 377 aa] {ON...   313   e-104
Scer_YGOB_SDL1 Chr9 (29032..29411,29415..30048) [1014 bp, 337 aa...   310   e-104
Ecym_1006 Chr1 complement(9635..10729) [1095 bp, 364 aa] {ON} si...   308   e-102
KLTH0F00440g Chr6 complement(34215..35240) [1026 bp, 341 aa] {ON...   302   e-101
KNAG0D05380 Chr4 complement(986308..987312) [1005 bp, 334 aa] {O...   301   e-100
AFR747W Chr6 (1808016..1809296) [1281 bp, 426 aa] {ON} Syntenic ...   298   4e-98
SAKL0C13904g Chr3 (1223973..1224992) [1020 bp, 339 aa] {ON} simi...   290   4e-96
TDEL0D06540 Chr4 (1175562..1176575) [1014 bp, 337 aa] {ON}            276   1e-90
KLLA0E01805g Chr5 complement(173125..174093) [969 bp, 322 aa] {O...   251   5e-81
YIL167W Chr9 (29416..30048) [633 bp, 210 aa] {OFF}  SDL1Open rea...   211   6e-67
KNAG0A01150 Chr1 (6346..7041) [696 bp, 231 aa] {ON}                   211   1e-66
YIL168W Chr9 (29032..29415) [384 bp, 127 aa] {OFF} Open reading ...   108   4e-28
SAKL0F11858g Chr6 (920767..922455) [1689 bp, 562 aa] {ON} highly...    76   2e-14
Ecym_4708 Chr4 (1386138..1387850) [1713 bp, 570 aa] {ON} similar...    68   1e-11
NCAS0A14230 Chr1 (2801647..2803356) [1710 bp, 569 aa] {ON} Anc_7...    67   2e-11
CAGL0I05126g Chr9 complement(481145..482860) [1716 bp, 571 aa] {...    66   5e-11
YKL218C Chr11 complement(17359..18339) [981 bp, 326 aa] {ON}  SR...    65   6e-11
KAFR0K01700 Chr11 (352943..354682) [1740 bp, 579 aa] {ON} Anc_7....    64   2e-10
ZYRO0B02772g Chr2 (224426..226135) [1710 bp, 569 aa] {ON} highly...    64   2e-10
Suva_5.199 Chr5 (303073..304803) [1731 bp, 576 aa] {ON} YER086W ...    63   4e-10
YER086W Chr5 (328477..330207) [1731 bp, 576 aa] {ON}  ILV1Threon...    63   5e-10
Skud_5.205 Chr5 (322688..324418) [1731 bp, 576 aa] {ON} YER086W ...    62   6e-10
TBLA0C05070 Chr3 (1230732..1232459) [1728 bp, 575 aa] {ON} Anc_7...    62   7e-10
Smik_5.225 Chr5 (337064..338794) [1731 bp, 576 aa] {ON} YER086W ...    62   8e-10
ACR232C Chr3 complement(767330..769012) [1683 bp, 560 aa] {ON} S...    61   1e-09
NDAI0A01810 Chr1 complement(400890..402602) [1713 bp, 570 aa] {O...    61   2e-09
KLLA0E19779g Chr5 complement(1760800..1762503) [1704 bp, 567 aa]...    61   2e-09
TDEL0C01800 Chr3 complement(313699..315408) [1710 bp, 569 aa] {O...    60   3e-09
SAKL0A10626g Chr1 complement(932879..933841) [963 bp, 320 aa] {O...    59   3e-09
Kpol_530.16 s530 complement(41170..42870) [1701 bp, 566 aa] {ON}...    60   4e-09
Skud_11.2 Chr11 complement(1812..2792) [981 bp, 326 aa] {ON} YKL...    57   3e-08
TPHA0F03130 Chr6 complement(685292..686998) [1707 bp, 568 aa] {O...    57   4e-08
KNAG0C03690 Chr3 complement(722238..723971) [1734 bp, 577 aa] {O...    55   1e-07
Kwal_33.14822 s33 complement(830029..831717) [1689 bp, 562 aa] {...    52   2e-06
KLTH0B04884g Chr2 (400193..401914) [1722 bp, 573 aa] {ON} highly...    49   2e-05
Smik_11.3 Chr11 complement(1725..2534) [810 bp, 269 aa] {ON} YKL...    37   0.062
Kwal_23.3442 s23 (291852..296042) [4191 bp, 1396 aa] {ON} YDL112...    35   0.44 
CAGL0I05852g Chr9 complement(554011..555597) [1587 bp, 528 aa] {...    32   1.9  
NCAS0G01010 Chr7 complement(173895..175460) [1566 bp, 521 aa] {O...    32   3.9  
KNAG0C01250 Chr3 complement(241906..243654) [1749 bp, 582 aa] {O...    31   4.9  
KNAG0C01570 Chr3 (310309..312681) [2373 bp, 790 aa] {ON} Anc_1.2...    31   5.6  
TBLA0A00310 Chr1 complement(52232..54913) [2682 bp, 893 aa] {ON}...    31   7.2  
NDAI0H01950 Chr8 complement(474375..476945) [2571 bp, 856 aa] {O...    30   8.4  

>CAGL0B00286g Chr2 complement(12803..13885) [1083 bp, 360 aa] {ON}
           highly similar to uniprot|P25379 Saccharomyces
           cerevisiae YCL064c CHA1 L-serine/L-threonine deaminase
          Length = 360

 Score =  677 bits (1746), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 332/360 (92%), Positives = 332/360 (92%)

Query: 1   MSVYNKTPLIRQIFPSIPQMYLKHECFQPSGSFKSRGIGHLISKQSQRILGNGLGKKPMV 60
           MSVYNKTPLIRQIFPSIPQMYLKHECFQPSGSFKSRGIGHLISKQSQRILGNGLGKKPMV
Sbjct: 1   MSVYNKTPLIRQIFPSIPQMYLKHECFQPSGSFKSRGIGHLISKQSQRILGNGLGKKPMV 60

Query: 61  FXXXXXXXXXXXXXXXKFLNLPCTVVIPTATKQRMADKIRATGANVIVSGNFWKEADNYL 120
           F               KFLNLPCTVVIPTATKQRMADKIRATGANVIVSGNFWKEADNYL
Sbjct: 61  FASSGGNAGLAAATAAKFLNLPCTVVIPTATKQRMADKIRATGANVIVSGNFWKEADNYL 120

Query: 121 KDNILSKLEELHKNVEPIYVHPFDNPDIWEGHASMVDEIVEDFKNKMIPLNKIKAIVCSV 180
           KDNILSKLEELHKNVEPIYVHPFDNPDIWEGHASMVDEIVEDFKNKMIPLNKIKAIVCSV
Sbjct: 121 KDNILSKLEELHKNVEPIYVHPFDNPDIWEGHASMVDEIVEDFKNKMIPLNKIKAIVCSV 180

Query: 181 XXXXXXXXXXXXXEKYNLADKIPIVGVETKGCHVFNTSLRMNKVVSFKKITSIATSLGTA 240
                        EKYNLADKIPIVGVETKGCHVFNTSLRMNKVVSFKKITSIATSLGTA
Sbjct: 181 GGGGLYNGIIQGLEKYNLADKIPIVGVETKGCHVFNTSLRMNKVVSFKKITSIATSLGTA 240

Query: 241 DISTEAFKYAKRYGTKSVVLSDQDVVKTCLRYTHDFNMVIEPACGAAVHLAYHTEILEKE 300
           DISTEAFKYAKRYGTKSVVLSDQDVVKTCLRYTHDFNMVIEPACGAAVHLAYHTEILEKE
Sbjct: 241 DISTEAFKYAKRYGTKSVVLSDQDVVKTCLRYTHDFNMVIEPACGAAVHLAYHTEILEKE 300

Query: 301 LGTKLNADDIVLVVACGGSSNTVEDMESILQRLSTEENNINIPNVAENIIVRMPEVSVLA 360
           LGTKLNADDIVLVVACGGSSNTVEDMESILQRLSTEENNINIPNVAENIIVRMPEVSVLA
Sbjct: 301 LGTKLNADDIVLVVACGGSSNTVEDMESILQRLSTEENNINIPNVAENIIVRMPEVSVLA 360

>Suva_3.150 Chr3 complement(225656..226741) [1086 bp, 361 aa] {ON}
           YCL064C (REAL)
          Length = 361

 Score =  440 bits (1132), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 210/336 (62%), Positives = 257/336 (76%), Gaps = 5/336 (1%)

Query: 3   VYNKTPLIRQIFP--SIPQMYLKHECFQPSGSFKSRGIGHLISKQSQRILGNGLGKKPMV 60
           VYNKTPL+RQ FP  S+ Q YLK+EC QPSGSFKSRGIG+LI K + RI  NG  + P V
Sbjct: 4   VYNKTPLLRQFFPGKSLAQFYLKYECLQPSGSFKSRGIGNLILKNAIRIQKNG-KRSPQV 62

Query: 61  FXXXXXXXXXXXXXXXKFLNLPCTVVIPTATKQRMADKIRATGANVIVSGNFWKEADNYL 120
           F               + L+LPCTVV+PTATK+RM +KIR TGA VIV+G FWKEAD YL
Sbjct: 63  FASSGGNAGFAAATACQRLSLPCTVVVPTATKERMVEKIRNTGAQVIVNGAFWKEADTYL 122

Query: 121 KDNILSKLEELHKNVEPIYVHPFDNPDIWEGHASMVDEIVEDFKNKMIPLNKIKAIVCSV 180
           K N+++ ++  H+ VEPIYVHPFDNPDIWEGH+SMVDEIV+D K++ +P+ K+K IVCSV
Sbjct: 123 KTNVMNLID--HQAVEPIYVHPFDNPDIWEGHSSMVDEIVQDLKSQRVPMEKVKGIVCSV 180

Query: 181 XXXXXXXXXXXXXEKYNLADKIPIVGVETKGCHVFNTSLRMNKVVSFKKITSIATSLGTA 240
                        E++ LADKIPIVGVETKGCHVFNTSLR+ + V FKKITSIATSLGTA
Sbjct: 181 GGGGLYNGIIQGLERHGLADKIPIVGVETKGCHVFNTSLRIGQPVQFKKITSIATSLGTA 240

Query: 241 DISTEAFKYAKRYGTKSVVLSDQDVVKTCLRYTHDFNMVIEPACGAAVHLAYHTEILEKE 300
           +IS + F+YA++Y TKSVV+ D+DV++TCL+Y+H FNMV EPACGAA+HL YHT+ILE  
Sbjct: 241 NISNQTFEYARKYNTKSVVVEDKDVIETCLKYSHQFNMVTEPACGAALHLGYHTDILETA 300

Query: 301 LGTKLNADDIVLVVACGGSSNTVEDMESILQRLSTE 336
           L TKL ADDIVL++ACGGSSNTV+D+E  L  +  E
Sbjct: 301 LDTKLAADDIVLIIACGGSSNTVQDLEETLASMKKE 336

>Skud_3.1 Chr3 complement(3828..4910) [1083 bp, 360 aa] {ON} YCL064C
           (REAL)
          Length = 360

 Score =  430 bits (1105), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 208/336 (61%), Positives = 256/336 (76%), Gaps = 5/336 (1%)

Query: 3   VYNKTPLIRQIFPSI--PQMYLKHECFQPSGSFKSRGIGHLISKQSQRILGNGLGKKPMV 60
           VYNKTPL+RQ FPS    Q +LK+EC QPSGSFKSRGIG+LI K + RI  +G  + P V
Sbjct: 4   VYNKTPLLRQFFPSKSPAQFFLKYECLQPSGSFKSRGIGNLILKNAIRIQKDGR-RSPQV 62

Query: 61  FXXXXXXXXXXXXXXXKFLNLPCTVVIPTATKQRMADKIRATGANVIVSGNFWKEADNYL 120
           F               + L+LPCTVV+PTATK+RM +KIR TGA VIV+G +WKEAD +L
Sbjct: 63  FASSGGNAGLAAATTCQRLSLPCTVVVPTATKKRMVEKIRNTGAQVIVNGAYWKEADTFL 122

Query: 121 KDNILSKLEELHKNVEPIYVHPFDNPDIWEGHASMVDEIVEDFKNKMIPLNKIKAIVCSV 180
           K NI+++++   + VEPIYVHPFDNPDIWEGH+SMVDEIV+D K++ I +NK+K IVCSV
Sbjct: 123 KANIMNQIDS--QVVEPIYVHPFDNPDIWEGHSSMVDEIVQDLKSQRISMNKVKGIVCSV 180

Query: 181 XXXXXXXXXXXXXEKYNLADKIPIVGVETKGCHVFNTSLRMNKVVSFKKITSIATSLGTA 240
                        E+Y+LADKIPIVGVET GCHVFNTSLR+ + V FKKITSIATSLGTA
Sbjct: 181 GGGGLYNGIIQGLERYHLADKIPIVGVETNGCHVFNTSLRIGQPVQFKKITSIATSLGTA 240

Query: 241 DISTEAFKYAKRYGTKSVVLSDQDVVKTCLRYTHDFNMVIEPACGAAVHLAYHTEILEKE 300
            IS + F+YA +Y TKSVV+ D+DV++TCL+YTH  NMV EPACGAA+HL YHTEILEK 
Sbjct: 241 VISNQTFEYAHKYNTKSVVIEDKDVIETCLKYTHQCNMVAEPACGAALHLGYHTEILEKA 300

Query: 301 LGTKLNADDIVLVVACGGSSNTVEDMESILQRLSTE 336
           LG+KL ADDIV+++ACGGSSNTV+D+E  L+ L  +
Sbjct: 301 LGSKLAADDIVIIIACGGSSNTVQDLEETLEDLKKQ 336

>YCL064C Chr3 complement(15798..16880) [1083 bp, 360 aa] {ON}
           CHA1Catabolic L-serine (L-threonine) deaminase,
           catalyzes the degradation of both L-serine and
           L-threonine; required to use serine or threonine as the
           sole nitrogen source, transcriptionally induced by
           serine and threonine
          Length = 360

 Score =  427 bits (1099), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 208/359 (57%), Positives = 268/359 (74%), Gaps = 9/359 (2%)

Query: 3   VYNKTPLIRQIFP--SIPQMYLKHECFQPSGSFKSRGIGHLISKQSQRILGNGLGKKPMV 60
           VYNKTPL+RQ FP  +  Q +LK+EC QPSGSFKSRGIG+LI K + RI  +G  + P V
Sbjct: 4   VYNKTPLLRQFFPGKASAQFFLKYECLQPSGSFKSRGIGNLIMKSAIRIQKDG-KRSPQV 62

Query: 61  FXXXXXXXXXXXXXXXKFLNLPCTVVIPTATKQRMADKIRATGANVIVSGNFWKEADNYL 120
           F               + L+LPCTVV+PTATK+RM DKIR TGA VIVSG +WKEAD +L
Sbjct: 63  FASSGGNAGFAAATACQRLSLPCTVVVPTATKKRMVDKIRNTGAQVIVSGAYWKEADTFL 122

Query: 121 KDNILSKLEELHKNVEPIYVHPFDNPDIWEGHASMVDEIVEDFKNKMIPLNKIKAIVCSV 180
           K N+++K++   + +EPIYVHPFDNPDIWEGH+SM+DEIV+D K++ I +NK+K IVCSV
Sbjct: 123 KTNVMNKIDS--QVIEPIYVHPFDNPDIWEGHSSMIDEIVQDLKSQHISVNKVKGIVCSV 180

Query: 181 XXXXXXXXXXXXXEKYNLADKIPIVGVETKGCHVFNTSLRMNKVVSFKKITSIATSLGTA 240
                        E+Y LAD+IPIVGVET GCHVFNTSL++ + V FKKITSIATSLGTA
Sbjct: 181 GGGGLYNGIIQGLERYGLADRIPIVGVETNGCHVFNTSLKIGQPVQFKKITSIATSLGTA 240

Query: 241 DISTEAFKYAKRYGTKSVVLSDQDVVKTCLRYTHDFNMVIEPACGAAVHLAYHTEILEKE 300
            IS + F+YA++Y T+SVV+ D+DV++TCL+YTH FNMVIEPACGAA+HL Y+T+ILE  
Sbjct: 241 VISNQTFEYARKYNTRSVVIEDKDVIETCLKYTHQFNMVIEPACGAALHLGYNTKILENA 300

Query: 301 LGTKLNADDIVLVVACGGSSNTVEDMESILQRLSTEENNINIPNVAENIIVRMPEVSVL 359
           LG+KL ADDIV+++ACGGSSNT++D+E  L   S  + +  +  VA+N I   PE +++
Sbjct: 301 LGSKLAADDIVIIIACGGSSNTIKDLEEALD--SMRKKDTPVIEVADNFI--FPEKNIV 355

>NCAS0B09130 Chr2 (1751219..1752322) [1104 bp, 367 aa] {ON} Anc_1.3
          Length = 367

 Score =  426 bits (1096), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 208/339 (61%), Positives = 252/339 (74%), Gaps = 11/339 (3%)

Query: 3   VYNKTPLIRQIFP--------SIPQMYLKHECFQPSGSFKSRGIGHLISKQSQRILGNGL 54
           VYNKTPL+RQ FP        SIPQ +LK+EC QPSGSFKSRGIG+LI K + RI  +G 
Sbjct: 4   VYNKTPLLRQFFPAVSTKPSTSIPQFFLKYECLQPSGSFKSRGIGNLIMKNAIRIKKSG- 62

Query: 55  GKKPMVFXXXXXXXXXXXXXXXKFLNLPCTVVIPTATKQRMADKIRATGANVIVSGNFWK 114
            K P VF               + L+LPCTVV+PTATKQRM +KIRATGANVI++G  WK
Sbjct: 63  NKSPQVFSSSGGNAGFAAATASQRLSLPCTVVVPTATKQRMVEKIRATGANVIINGAHWK 122

Query: 115 EADNYLKDNILSKLEELHKNVEPIYVHPFDNPDIWEGHASMVDEIVEDFKNKMIPLNKIK 174
           EAD YLK ++++ ++      EPIYVHPFDNPDIWEGH++MVDEIV+    + I LNKIK
Sbjct: 123 EADTYLKSSVMNSID--LNTTEPIYVHPFDNPDIWEGHSTMVDEIVDTLNEQNIALNKIK 180

Query: 175 AIVCSVXXXXXXXXXXXXXEKYNLADKIPIVGVETKGCHVFNTSLRMNKVVSFKKITSIA 234
            IVCSV             EK+ LADKIPIVGVETKGCHVFNTSL++ K + F KITSIA
Sbjct: 181 GIVCSVGGGGLYNGIIQGLEKHKLADKIPIVGVETKGCHVFNTSLKLGKQIEFSKITSIA 240

Query: 235 TSLGTADISTEAFKYAKRYGTKSVVLSDQDVVKTCLRYTHDFNMVIEPACGAAVHLAYHT 294
           TSLGTA IS++ F+YAK+Y T+SVV+ D DV++TCL+YT DFNMV EPACGA++HLAY+T
Sbjct: 241 TSLGTASISSQTFEYAKKYHTRSVVVEDTDVIETCLKYTQDFNMVAEPACGASLHLAYNT 300

Query: 295 EILEKELGTKLNADDIVLVVACGGSSNTVEDMESILQRL 333
            ILE  LG KL++DDI+LV+ACGGSSNTV+D+E  L RL
Sbjct: 301 NILENALGHKLSSDDIILVIACGGSSNTVQDLEETLVRL 339

>NDAI0A00120 Chr1 complement(4652..5785) [1134 bp, 377 aa] {ON}
           Anc_1.3
          Length = 377

 Score =  426 bits (1096), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 203/349 (58%), Positives = 263/349 (75%), Gaps = 18/349 (5%)

Query: 3   VYNKTPLIRQIF-------------PSIPQMYLKHECFQPSGSFKSRGIGHLISKQSQRI 49
           VYNKTPL+RQ F              + PQ ++K+EC QPSGSFKSRGIG+LI K +  I
Sbjct: 4   VYNKTPLLRQFFQNSVAKSSATASVTATPQFFVKYECLQPSGSFKSRGIGNLILKSAMNI 63

Query: 50  LGNGLGKK-PMVFXXXXXXXXXXXXXXXKFLNLPCTVVIPTATKQRMADKIRATGANVIV 108
             N +G+K P VF               + L+LPCTVV+PTATKQRM +KI++TGANVI+
Sbjct: 64  --NKIGQKTPQVFASSGGNAGFAAATACQRLSLPCTVVVPTATKQRMVEKIKSTGANVII 121

Query: 109 SGNFWKEADNYLKDNILSKLEELHKNVEPIYVHPFDNPDIWEGHASMVDEIVEDFKNKMI 168
           +G  WKEAD +LK++I++K++  H  +EPIYVHPFDNP IWEGHA+MVDEI++   ++ I
Sbjct: 122 NGAHWKEADMFLKNSIMNKIDTNH--IEPIYVHPFDNPLIWEGHATMVDEIMDSLNDQNI 179

Query: 169 PLNKIKAIVCSVXXXXXXXXXXXXXEKYNLADKIPIVGVETKGCHVFNTSLRMNKVVSFK 228
           P+NK+K IVCSV             +KYNLADKIPIVGVETKGCHVFNTSL++NK + F 
Sbjct: 180 PINKVKGIVCSVGGGGLYNGIIQGLQKYNLADKIPIVGVETKGCHVFNTSLKLNKQIEFS 239

Query: 229 KITSIATSLGTADISTEAFKYAKRYGTKSVVLSDQDVVKTCLRYTHDFNMVIEPACGAAV 288
           KITSIATSLGTA+IS + F+YA++Y T+SVV+ D++V++TCL+YT D+NMV+EPACGA++
Sbjct: 240 KITSIATSLGTANISKKTFEYAQKYKTRSVVIEDKNVIETCLKYTQDYNMVVEPACGASI 299

Query: 289 HLAYHTEILEKELGTKLNADDIVLVVACGGSSNTVEDMESILQRLSTEE 337
           HLAYHT+ILEK LG KLN+DDI+LV+ACGGSSNT  D+ES+L  +  +E
Sbjct: 300 HLAYHTDILEKSLGHKLNSDDIILVIACGGSSNTTHDLESLLLNMKADE 348

>Smik_3.12 Chr3 complement(17223..18305) [1083 bp, 360 aa] {ON}
           YCL064C (REAL)
          Length = 360

 Score =  424 bits (1090), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 202/334 (60%), Positives = 252/334 (75%), Gaps = 5/334 (1%)

Query: 3   VYNKTPLIRQIFP--SIPQMYLKHECFQPSGSFKSRGIGHLISKQSQRILGNGLGKKPMV 60
           VYNKTPL+RQ FP  S  Q +LK+EC QPSGSFKSRGIG+LI K + RI  +G  K P +
Sbjct: 4   VYNKTPLLRQFFPGKSPAQFFLKYECLQPSGSFKSRGIGNLIMKSAIRIQKDG-KKSPQI 62

Query: 61  FXXXXXXXXXXXXXXXKFLNLPCTVVIPTATKQRMADKIRATGANVIVSGNFWKEADNYL 120
           F               + L+LPCTVV+PTATK+RM +KIR TGA VIVSG +WKEAD +L
Sbjct: 63  FASSGGNAGFAAATACQRLSLPCTVVVPTATKKRMVEKIRNTGAQVIVSGAYWKEADTFL 122

Query: 121 KDNILSKLEELHKNVEPIYVHPFDNPDIWEGHASMVDEIVEDFKNKMIPLNKIKAIVCSV 180
           K +++ K++   + VEPIYVHPFDNPDIWEGH+SMVDE+V+D + + I +NK+K IVCSV
Sbjct: 123 KADVMQKIDT--QVVEPIYVHPFDNPDIWEGHSSMVDEMVQDLEFQRISMNKVKGIVCSV 180

Query: 181 XXXXXXXXXXXXXEKYNLADKIPIVGVETKGCHVFNTSLRMNKVVSFKKITSIATSLGTA 240
                        E+Y LADKIPIVGVET GCHVFNTSLR+ + V FKKITSIATSLGTA
Sbjct: 181 GGGGLYNGIVQGLERYGLADKIPIVGVETNGCHVFNTSLRIGQPVQFKKITSIATSLGTA 240

Query: 241 DISTEAFKYAKRYGTKSVVLSDQDVVKTCLRYTHDFNMVIEPACGAAVHLAYHTEILEKE 300
            IS + F YA++Y T+SVV+ D+DV+ TCL+YTH FNMV+EPACGAA+HL Y+TEILE+ 
Sbjct: 241 VISNQTFDYARKYNTRSVVIEDKDVIDTCLKYTHQFNMVVEPACGAALHLGYNTEILERA 300

Query: 301 LGTKLNADDIVLVVACGGSSNTVEDMESILQRLS 334
           LG+KL ADDIV+++ACGGSSNT++D+E  L   +
Sbjct: 301 LGSKLAADDIVIIIACGGSSNTIQDLEEALDHFN 334

>TPHA0E04040 Chr5 (846219..847292) [1074 bp, 357 aa] {ON} Anc_1.3
           YCL064C
          Length = 357

 Score =  417 bits (1071), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 202/338 (59%), Positives = 251/338 (74%), Gaps = 5/338 (1%)

Query: 3   VYNKTPLIRQIFP--SIPQMYLKHECFQPSGSFKSRGIGHLISKQSQRILGNGLGKKPMV 60
           VYNKTPL+R +FP  ++PQ++LK+ECFQPSGSFKSRGIG+LI   S  I  N   K P V
Sbjct: 4   VYNKTPLLRHLFPGKNLPQVFLKYECFQPSGSFKSRGIGNLIQSTSLEIQKNS-KKSPEV 62

Query: 61  FXXXXXXXXXXXXXXXKFLNLPCTVVIPTATKQRMADKIRATGANVIVSGNFWKEADNYL 120
           F               K L+LPCTVV+PTATK RM +KI+ATGANVIV GN WKEAD YL
Sbjct: 63  FSSSGGNAGLAAATASKMLSLPCTVVVPTATKLRMVEKIKATGANVIVKGNHWKEADTYL 122

Query: 121 KDNILSKLEELHKNVEPIYVHPFDNPDIWEGHASMVDEIVEDFKNKMIPLNKIKAIVCSV 180
           K N+LS +++  K +EPIYVHPFDN  IWEGHA+M+DEIVE F  + IP+ K+KAIVCSV
Sbjct: 123 KTNVLSNIDK--KLIEPIYVHPFDNKKIWEGHATMIDEIVETFGQQHIPIEKVKAIVCSV 180

Query: 181 XXXXXXXXXXXXXEKYNLADKIPIVGVETKGCHVFNTSLRMNKVVSFKKITSIATSLGTA 240
                        EK++LA KIP+VGVET GCHVFNTSL+M KV+ F+KI +IATSLGTA
Sbjct: 181 GGGGLYNGIIQGLEKHDLATKIPVVGVETLGCHVFNTSLKMGKVIQFEKINTIATSLGTA 240

Query: 241 DISTEAFKYAKRYGTKSVVLSDQDVVKTCLRYTHDFNMVIEPACGAAVHLAYHTEILEKE 300
           +IS + F+YAK+Y TKS+V+ D  VV+TCL++T D NMV EPACGAA+H+ Y+ +ILEK 
Sbjct: 241 NISNQTFEYAKKYNTKSIVVDDLKVVETCLKFTRDSNMVAEPACGAALHMGYNMDILEKS 300

Query: 301 LGTKLNADDIVLVVACGGSSNTVEDMESILQRLSTEEN 338
           LG KL  DDIVL++ACGGSSNTV+++E+ L  L  + N
Sbjct: 301 LGKKLATDDIVLIIACGGSSNTVQELEASLTELKNKSN 338

>KAFR0D00110 Chr4 complement(7211..8308) [1098 bp, 365 aa] {ON}
           Anc_1.3 YCL064C
          Length = 365

 Score =  406 bits (1044), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 197/351 (56%), Positives = 255/351 (72%), Gaps = 12/351 (3%)

Query: 3   VYNKTPLIRQIFP--------SIPQMYLKHECFQPSGSFKSRGIGHLISKQSQRILGNGL 54
           VYNKTPL+RQ FP        S+PQ +LK+EC QPSGSFKSRGIG+LI KQ+ +I   G 
Sbjct: 4   VYNKTPLLRQFFPGTKSRKSNSLPQFFLKYECLQPSGSFKSRGIGNLILKQAMQIHKKGT 63

Query: 55  GKKPMVFXXXXXXXXXXXXXXXKFLNLPCTVVIPTATKQRMADKIRATGANVIVSGNFWK 114
            K+P VF               + L+LPCTVV+PTATKQRM +KI+ TGANVI+ G FWK
Sbjct: 64  -KRPEVFASSGGNAGYAAAVACQRLSLPCTVVVPTATKQRMIEKIKDTGANVIIDGAFWK 122

Query: 115 EADNYLKDNILSKLEELHKNVEPIYVHPFDNPDIWEGHASMVDEIVEDFKNKMIPLNKIK 174
           EAD YLK ++++K+ +    ++PIYVHPFDNP IWEGH+S+VDEI++  + + +  + IK
Sbjct: 123 EADQYLKKSVMNKINK--NEIDPIYVHPFDNPLIWEGHSSIVDEIMDTLREQKVQPSNIK 180

Query: 175 AIVCSVXXXXXXXXXXXXXEKYNLADKIPIVGVETKGCHVFNTSLRMNKVVSFKKITSIA 234
            IVCSV             E++ L DKIP+VGVET+GCHVFNTSL++ K V F+KITSIA
Sbjct: 181 GIVCSVGGGGLYNGIIQGLERHKLVDKIPVVGVETEGCHVFNTSLKLGKQVEFEKITSIA 240

Query: 235 TSLGTADISTEAFKYAKRYGTKSVVLSDQDVVKTCLRYTHDFNMVIEPACGAAVHLAYHT 294
           TSL TA IS + F+ A +YGT+SV++ D DV++TCL+YT D+NMV EPACGA++HLAY+ 
Sbjct: 241 TSLATASISAKTFENALKYGTRSVIVKDADVIETCLKYTKDYNMVTEPACGASIHLAYNI 300

Query: 295 EILEKELGTKLNADDIVLVVACGGSSNTVEDMESILQRLSTEEN-NINIPN 344
           +ILE  LGTKL  DD V+V+ACGGSSNT++DME  L RL +EEN  + +PN
Sbjct: 301 DILENALGTKLTKDDTVVVIACGGSSNTLQDMEETLLRLRSEENAAMTLPN 351

>Kpol_2002.6 s2002 complement(7840..8892) [1053 bp, 350 aa] {ON}
           complement(7840..8892) [1053 nt, 351 aa]
          Length = 350

 Score =  403 bits (1035), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 203/334 (60%), Positives = 252/334 (75%), Gaps = 5/334 (1%)

Query: 3   VYNKTPLIRQIFP--SIPQMYLKHECFQPSGSFKSRGIGHLISKQSQRILGNGLGKKPMV 60
           VYNKTPL++  FP  ++PQ YLK+E  QPSGSFKSRGIG+LI K + RI    + KKP V
Sbjct: 4   VYNKTPLLKHFFPGKNLPQFYLKYESLQPSGSFKSRGIGNLILKNAIRIKKINV-KKPYV 62

Query: 61  FXXXXXXXXXXXXXXXKFLNLPCTVVIPTATKQRMADKIRATGANVIVSGNFWKEADNYL 120
           F               + L+LPCTVV+PTATK+RM  KIRATGANVI+ GN WKEADN+L
Sbjct: 63  FSSSGGNAGLAAATASQRLSLPCTVVVPTATKERMVQKIRATGANVIIKGNHWKEADNFL 122

Query: 121 KDNILSKLEELHKNVEPIYVHPFDNPDIWEGHASMVDEIVEDFKNKMIPLNKIKAIVCSV 180
           K NI++++ +    +EPIYVHPFDNP IWEGH++MVDEI+E F  +   +  +KAIVCSV
Sbjct: 123 KQNIMNEINK--DKIEPIYVHPFDNPLIWEGHSTMVDEIMETFSQQKFNIKNLKAIVCSV 180

Query: 181 XXXXXXXXXXXXXEKYNLADKIPIVGVETKGCHVFNTSLRMNKVVSFKKITSIATSLGTA 240
                        EKYNLADKIP+VGVET+GCHVFNTSL++NK V F KI++IATSLGTA
Sbjct: 181 GGGGLYNGIIQGLEKYNLADKIPVVGVETQGCHVFNTSLKLNKPVEFTKISTIATSLGTA 240

Query: 241 DISTEAFKYAKRYGTKSVVLSDQDVVKTCLRYTHDFNMVIEPACGAAVHLAYHTEILEKE 300
           +IS + F YAK+Y TKSVV+ D+DVV+TCL++THD NMVIEPACGAA+HL YHT++LE  
Sbjct: 241 NISNQMFDYAKKYNTKSVVVEDKDVVETCLKFTHDHNMVIEPACGAAIHLGYHTDLLETA 300

Query: 301 LGTKLNADDIVLVVACGGSSNTVEDMESILQRLS 334
           LGTKL  DD VL+VACGGSSNTV+++E+ L  L+
Sbjct: 301 LGTKLTCDDAVLIVACGGSSNTVKELETALLELN 334

>KNAG0C00180 Chr3 complement(27151..28230) [1080 bp, 359 aa] {ON}
           Anc_1.3 YCL064C
          Length = 359

 Score =  393 bits (1009), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 195/347 (56%), Positives = 249/347 (71%), Gaps = 9/347 (2%)

Query: 3   VYNKTPLIRQIFP--SIPQMYLKHECFQPSGSFKSRGIGHLISKQSQRILGNGLGKKPMV 60
           VYNKTPL+RQ FP  ++PQ++LK+EC QPSGSFKSRGIG+LI K + RI   G  ++  V
Sbjct: 4   VYNKTPLLRQFFPGKNLPQLFLKYECLQPSGSFKSRGIGNLILKNAMRIQKIG-ERRAHV 62

Query: 61  FXXXXXXXXXXXXXXXKFLNLPCTVVIPTATKQRMADKIRATGANVIVSGNFWKEADNYL 120
           F               + L+LPCTVV+PTATK RM +KIR TGA VIV+G  WKEAD +L
Sbjct: 63  FASSGGNAGFAAATACQRLSLPCTVVVPTATKTRMVEKIRNTGAKVIVNGAHWKEADQHL 122

Query: 121 KDNILSKLEELHKNVEPIYVHPFDNPDIWEGHASMVDEIVEDFKNKMIPLNKIKAIVCSV 180
           K  ++S+++   K  EPIYVHPFDNPDIWEGHA++VDEI+E   ++ I    +K IVCSV
Sbjct: 123 KKTVMSQID--LKTTEPIYVHPFDNPDIWEGHATLVDEIMETLNSQKIQTENVKGIVCSV 180

Query: 181 XXXXXXXXXXXXXEKYNLADKIPIVGVETKGCHVFNTSLRMNKVVSFKKITSIATSLGTA 240
                        EK+ LA+KIPIVGVET+GCHV NTSL +NK + F+KITSIATSLGTA
Sbjct: 181 GGGGLYNGIMQGLEKHGLAEKIPIVGVETRGCHVLNTSLNLNKQIEFEKITSIATSLGTA 240

Query: 241 DISTEAFKYAKRYGTKSVVLSDQDVVKTCLRYTHDFNMVIEPACGAAVHLAYHTEILEKE 300
            IS + F+ AK+Y T+SVV+ D  V++TCL+YT DFNMV EPACGAA+HLAY+ +ILEK 
Sbjct: 241 SISKQTFELAKKYNTRSVVVDDSKVIETCLKYTRDFNMVAEPACGAALHLAYNVDILEKA 300

Query: 301 LGTKLNADDIVLVVACGGSSNTVEDMESILQRLSTEENNINIPNVAE 347
           LG  L  +D++LV+ACGGSSNT++D+E  L  L    N+ +IP+  E
Sbjct: 301 LGHSLTPNDVILVIACGGSSNTLKDLEDTLVTL----NSKSIPSPPE 343

>ZYRO0F15774g Chr6 (1300486..1301718) [1233 bp, 410 aa] {ON} similar
           to uniprot|P25379 Saccharomyces cerevisiae YCL064C CHA1
           catabolism of hydroxy amino acids catabolic serine
           (threonine) dehydratase
          Length = 410

 Score =  387 bits (993), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 184/334 (55%), Positives = 243/334 (72%), Gaps = 5/334 (1%)

Query: 2   SVYNKTPLIRQIF--PSIPQMYLKHECFQPSGSFKSRGIGHLISKQSQRILGNGLGKKPM 59
           S+YNKTPL++QIF   +  Q+++K+EC QPSGSFKSRGIGHLISK+++ I G+G  K P 
Sbjct: 49  SIYNKTPLLKQIFNHATSAQVFVKYECLQPSGSFKSRGIGHLISKRAKDIQGDGR-KSPH 107

Query: 60  VFXXXXXXXXXXXXXXXKFLNLPCTVVIPTATKQRMADKIRATGANVIVSGNFWKEADNY 119
           VF               + LNLPCTVVIPT TKQRMADKIR  GANV+V G+ WKEAD++
Sbjct: 108 VFSSSGGNAGYAAAVAAQKLNLPCTVVIPTTTKQRMADKIRGCGANVVVQGSHWKEADSH 167

Query: 120 LKDNILSKLEELHKNVEPIYVHPFDNPDIWEGHASMVDEIVEDFKNKMIPLNKIKAIVCS 179
           LK NIL     +   +EPIYVHPFDNP IWEGHAS+VDEI+   KN+   LN++K IVCS
Sbjct: 168 LK-NILQNQVNM-AILEPIYVHPFDNPTIWEGHASIVDEIISSLKNENTALNRVKGIVCS 225

Query: 180 VXXXXXXXXXXXXXEKYNLADKIPIVGVETKGCHVFNTSLRMNKVVSFKKITSIATSLGT 239
           V             EKYNLA+KIP++ VETKGCHV NTSL++ + V F K+ S+ATSL T
Sbjct: 226 VGGGGLYNGIIQGLEKYNLANKIPLLAVETKGCHVLNTSLQVGQCVEFNKMNSVATSLCT 285

Query: 240 ADISTEAFKYAKRYGTKSVVLSDQDVVKTCLRYTHDFNMVIEPACGAAVHLAYHTEILEK 299
           + IS+    Y ++YG+KS+VL D++V++TCL+Y  +FNM+ EPACGA++HL YH +++E+
Sbjct: 286 SQISSRTLDYVQKYGSKSIVLEDKEVLQTCLKYAENFNMITEPACGASLHLGYHPQLIER 345

Query: 300 ELGTKLNADDIVLVVACGGSSNTVEDMESILQRL 333
            LG  L+ DD+++V+ACGGSSNT+ D+E  L +L
Sbjct: 346 ALGKNLDKDDVIIVIACGGSSNTILDLEESLAKL 379

>TBLA0A04920 Chr1 complement(1214344..1215426) [1083 bp, 360 aa]
           {ON} Anc_1.3 YCL064C
          Length = 360

 Score =  382 bits (981), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 182/332 (54%), Positives = 239/332 (71%), Gaps = 4/332 (1%)

Query: 3   VYNKTPLIRQIFPS--IPQMYLKHECFQPSGSFKSRGIGHLISKQSQRILGNGLGKKPMV 60
           VYNKTPL+RQ F    IPQ +LK+EC QPSGSFKSRGIG+LI K   +I  + L K+P V
Sbjct: 4   VYNKTPLLRQFFRGSPIPQFFLKYECMQPSGSFKSRGIGNLILKSIDKINSSNLNKRPQV 63

Query: 61  FXXXXXXXXXXXXXXXKFLNLPCTVVIPTATKQRMADKIRATGANVIVSGNFWKEADNYL 120
           F               + L++PCTVV+PTATK+RM +KI+ TGA VIV+G  W EAD+YL
Sbjct: 64  FSSSGGNAGLAAATASRRLSIPCTVVVPTATKERMVNKIKDTGAKVIVNGGHWSEADDYL 123

Query: 121 KDNILSKLEELHKNVEPIYVHPFDNPDIWEGHASMVDEIVEDFKNKMIPLNKIKAIVCSV 180
           ++++++K++     +EPIYVHPFDNP IWEGH++M+DEI+E    + I +  +KAI CS+
Sbjct: 124 QNHVINKID--LNEIEPIYVHPFDNPLIWEGHSTMIDEIIESLNEQNIDIRNVKAITCSI 181

Query: 181 XXXXXXXXXXXXXEKYNLADKIPIVGVETKGCHVFNTSLRMNKVVSFKKITSIATSLGTA 240
                        EKYNLA KIPI+GVET GC VFNTSL++ K+V F KI +IATSLGT+
Sbjct: 182 GGGGLYNGLIRGLEKYNLASKIPIIGVETNGCQVFNTSLKLKKLVKFPKINTIATSLGTS 241

Query: 241 DISTEAFKYAKRYGTKSVVLSDQDVVKTCLRYTHDFNMVIEPACGAAVHLAYHTEILEKE 300
            IS + F+ A +Y TKSVV+ + DV+KTCLRYT+DFN V EPACGAA+HLAY+T ++E  
Sbjct: 242 TISAKTFENALKYNTKSVVVDNIDVIKTCLRYTYDFNQVAEPACGAALHLAYNTGLIENA 301

Query: 301 LGTKLNADDIVLVVACGGSSNTVEDMESILQR 332
           L T L  DDI++V+ACGGSSNTV+++E  L +
Sbjct: 302 LDTTLTKDDIIIVIACGGSSNTVQELEEALLK 333

>NCAS0A15330 Chr1 (3015596..3016639) [1044 bp, 347 aa] {ON} 
          Length = 347

 Score =  379 bits (972), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 177/342 (51%), Positives = 246/342 (71%), Gaps = 10/342 (2%)

Query: 3   VYNKTPLIRQIFP------SIPQMYLKHECFQPSGSFKSRGIGHLISKQSQRILGNGLGK 56
           VYNKTPL+R++FP      S PQ+Y+K+E  QPSGSFKSRGIGHLI K + R+   G GK
Sbjct: 4   VYNKTPLLRRVFPTGLKVPSAPQLYVKYESLQPSGSFKSRGIGHLIMKNALRVQQLG-GK 62

Query: 57  KPMVFXXXXXXXXXXXXXXXKFLNLPCTVVIPTATKQRMADKIRATGANVIVSGNFWKEA 116
              VF               + L LPCTVV+PT+TK RM +KIR  G  VIV G+ WKEA
Sbjct: 63  SLHVFSSSGGNAGLAAATASQSLKLPCTVVVPTSTKSRMVEKIRNVGTEVIVKGSHWKEA 122

Query: 117 DNYLKDNILSKLEELHKNVEPIYVHPFDNPDIWEGHASMVDEIVEDFKNKMIPLNKIKAI 176
           D++LK++++  ++ +    EPIYVHPFD+PD+WEGH++MVDEIV+ F+++ + LNK+KAI
Sbjct: 123 DSFLKNSVIPSVDRIE---EPIYVHPFDHPDVWEGHSTMVDEIVDTFRSQNVSLNKVKAI 179

Query: 177 VCSVXXXXXXXXXXXXXEKYNLADKIPIVGVETKGCHVFNTSLRMNKVVSFKKITSIATS 236
           VCSV             EKY+LADKIP++ +ET GC+ FN  L+  K V   KITS+ATS
Sbjct: 180 VCSVGGGGLYNGIIHGLEKYHLADKIPVIAMETDGCNSFNACLKAKKQVELPKITSVATS 239

Query: 237 LGTADISTEAFKYAKRYGTKSVVLSDQDVVKTCLRYTHDFNMVIEPACGAAVHLAYHTEI 296
           LG   ++T+AF+  +RY + SVVL D DVV TCL+Y +DFN++ EPACGA++H+AY+T++
Sbjct: 240 LGATGVATKAFENGQRYQSPSVVLQDIDVVNTCLKYANDFNIITEPACGASLHMAYNTKL 299

Query: 297 LEKELGTKLNADDIVLVVACGGSSNTVEDMESILQRLSTEEN 338
           +EK LG KL++DDI++++ACGGS+NT+ED+++  ++LS E N
Sbjct: 300 IEKALGKKLDSDDIIVIIACGGSANTMEDLQNSYKQLSAEAN 341

>KAFR0I00130 Chr9 complement(26703..27737) [1035 bp, 344 aa] {ON}
           Anc_1.3 YCL064C
          Length = 344

 Score =  363 bits (933), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 173/342 (50%), Positives = 242/342 (70%), Gaps = 11/342 (3%)

Query: 3   VYNKTPLIRQIFP--------SIPQMYLKHECFQPSGSFKSRGIGHLISKQSQRILGNGL 54
           VYNKTPL+ Q FP        S+PQ+ +K+E  QPSGSFKSRGIG+L+ +++ +I  N  
Sbjct: 4   VYNKTPLVPQSFPGTEIRSSDSLPQVLIKYEYLQPSGSFKSRGIGNLVYQKALQIQKNST 63

Query: 55  GKKPMVFXXXXXXXXXXXXXXXKFLNLPCTVVIPTATKQRMADKIRATGANVIVSGNFWK 114
            K P VF               + L+LPCTVV+P ATKQRM +KIR+TGA V + G FWK
Sbjct: 64  -KNPEVFSSSGGNAGYAAAVVAQKLSLPCTVVVPAATKQRMIEKIRSTGAKVTIHGTFWK 122

Query: 115 EADNYLKDNILSKLEELHKNVEPIYVHPFDNPDIWEGHASMVDEIVEDFKNKMIPLNKIK 174
            AD Y+K+++L+++    + VEPIYVHP D+P IWEG++ +VDE++E  + + I  +K+K
Sbjct: 123 GADKYMKNSVLNEINT--EKVEPIYVHPSDDPLIWEGNSMIVDELMESLQEQKIDPSKVK 180

Query: 175 AIVCSVXXXXXXXXXXXXXEKYNLADKIPIVGVETKGCHVFNTSLRMNKVVSFKKITSIA 234
           AIVCSV             E+Y LADKIPIVGVET G HVFNT L+  K + F+KI+++A
Sbjct: 181 AIVCSVGGGGLYNGLMQGLERYKLADKIPIVGVETDGSHVFNTCLKSGKHIEFEKISTVA 240

Query: 235 TSLGTADISTEAFKYAKRYGTKSVVLSDQDVVKTCLRYTHDFNMVIEPACGAAVHLAYHT 294
           TSLG+A I+ + F+YA +Y  + V++ D +V++TCLRYT D+NM+ EPACGAA+HLAYH 
Sbjct: 241 TSLGSASITKKTFEYAMKYRPRGVIVKDIEVLETCLRYTQDYNMITEPACGAAIHLAYHV 300

Query: 295 EILEKELGTKLNADDIVLVVACGGSSNTVEDMESILQRLSTE 336
           +ILEK L T+L+ DD+V+++ACGGSSN++ DME  L+++ +E
Sbjct: 301 DILEKALDTRLDGDDVVIIIACGGSSNSLHDMEETLKKMKSE 342

>KAFR0F04430 Chr6 (868691..869722) [1032 bp, 343 aa] {ON} 
          Length = 343

 Score =  357 bits (915), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 169/340 (49%), Positives = 243/340 (71%), Gaps = 11/340 (3%)

Query: 2   SVYNKTPLIRQIF--------PSIPQMYLKHECFQPSGSFKSRGIGHLISKQSQRILGNG 53
           +VYNKTPL+R  F         S PQ++ K+E FQP  SFKSRGIG+LI K ++++   G
Sbjct: 3   TVYNKTPLLRPYFLEANRGTSDSSPQVFFKYESFQPGCSFKSRGIGNLILKNAKKVEEEG 62

Query: 54  LGKKPMVFXXXXXXXXXXXXXXXKFLNLPCTVVIPTATKQRMADKIRATGANVIVSGNFW 113
           + K   VF               + L++PCTVV+P++TK RM +KIR+TGA VIVSGNFW
Sbjct: 63  I-KTLEVFSSSGGNAGYAAAVACRELSIPCTVVVPSSTKVRMVEKIRSTGAQVIVSGNFW 121

Query: 114 KEADNYLKDNILSKLEELHKNVEPIYVHPFDNPDIWEGHASMVDEIVEDFKNKMIPLNKI 173
           KEAD YL++++++K++     VEP+YVHPFD+P IWEGH++++DEIVE   ++ +  +K+
Sbjct: 122 KEADEYLRNSVINKVDS--SKVEPLYVHPFDDPLIWEGHSTIIDEIVESLNDENVHTSKV 179

Query: 174 KAIVCSVXXXXXXXXXXXXXEKYNLADKIPIVGVETKGCHVFNTSLRMNKVVSFKKITSI 233
           K +VCS+             E++ LADKIP++ VET+GCHVFNT L + K V F+KI+SI
Sbjct: 180 KGVVCSIGGGGLYNGIIEGLERHALADKIPVIAVETEGCHVFNTCLELGKHVEFEKISSI 239

Query: 234 ATSLGTADISTEAFKYAKRYGTKSVVLSDQDVVKTCLRYTHDFNMVIEPACGAAVHLAYH 293
           ATSLG+  IST+ F+YA++Y +K VVL D DV++TCLRY+ D NM+IEPAC A+VHLAY+
Sbjct: 240 ATSLGSPSISTKTFEYAQKYHSKGVVLQDIDVLETCLRYSEDSNMIIEPACAASVHLAYN 299

Query: 294 TEILEKELGTKLNADDIVLVVACGGSSNTVEDMESILQRL 333
            +ILE+ L  KL+ DD+++++ACGGS+ T++D++  L +L
Sbjct: 300 VDILEEALNKKLSKDDVIIIIACGGSATTLQDIKDSLAKL 339

>SAKL0C00418g Chr3 complement(37529..38623) [1095 bp, 364 aa] {ON}
           similar to uniprot|P25379 Saccharomyces cerevisiae
           YCL064C CHA1 catabolism of hydroxy amino acids catabolic
           serine (threonine) dehydratase
          Length = 364

 Score =  342 bits (878), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 169/338 (50%), Positives = 222/338 (65%), Gaps = 8/338 (2%)

Query: 2   SVYNKTPLIRQIFPS-----IPQMYLKHECFQPSGSFKSRGIGHLISKQSQRILGNGLGK 56
           S Y+KTPL+R+IFPS      PQ  +K+E FQPSGSFKSRGIGHLI++ + RI   G  K
Sbjct: 3   SFYSKTPLLRRIFPSSVLSATPQFLVKYEVFQPSGSFKSRGIGHLITQSAARIESEG-NK 61

Query: 57  KPMVFXXXXXXXXXXXXXXXKFLNLPCTVVIPTATKQRMADKIRATGANVIVSGNFWKEA 116
              VF               +  +LPCTVV+PT T  RM  KIR TGA+VIV GN W +A
Sbjct: 62  TAHVFASSGGNAGLAAATACRAFSLPCTVVVPTTTNLRMVAKIRQTGADVIVHGNHWGDA 121

Query: 117 DNYLKDNILSKLEELHKNVEPIYVHPFDNPDIWEGHASMVDEIVEDFKNKMIPLNKIKAI 176
           D YL  +++  ++      EP+Y HPFDNP IWEGH+++VDEIVE  + + IP +++K I
Sbjct: 122 DQYLHRSVMPCIDT--TKFEPVYAHPFDNPVIWEGHSTIVDEIVESLERQRIPASQVKGI 179

Query: 177 VCSVXXXXXXXXXXXXXEKYNLADKIPIVGVETKGCHVFNTSLRMNKVVSFKKITSIATS 236
           VCS+             EK++LA  IPI+GVETKGC VF+ SL+  K + F KITS+ATS
Sbjct: 180 VCSIGGGGLYNGIIEGLEKHDLATTIPIIGVETKGCEVFHQSLKAGKPLVFDKITSVATS 239

Query: 237 LGTADISTEAFKYAKRYGTKSVVLSDQDVVKTCLRYTHDFNMVIEPACGAAVHLAYHTEI 296
           LGTA I  +  + A +Y TKSVVLSD DVV+TCL +  D N+V EPACGA++H  Y+  +
Sbjct: 240 LGTATICKKTLENALKYNTKSVVLSDADVVRTCLDFADDTNIVPEPACGASLHFGYNPHL 299

Query: 297 LEKELGTKLNADDIVLVVACGGSSNTVEDMESILQRLS 334
           LE  LG  L  +DI++V+ACGGSS TV+D++ +  RL 
Sbjct: 300 LEDTLGGSLGPEDIIIVIACGGSSTTVQDLQQMQVRLG 337

>NDAI0K02950 Chr11 (671102..672106) [1005 bp, 334 aa] {ON} 
          Length = 334

 Score =  325 bits (834), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 160/335 (47%), Positives = 227/335 (67%), Gaps = 9/335 (2%)

Query: 3   VYNKTPLIRQIFPSI---PQMYLKHECFQPSGSFKSRGIGHLISKQSQRILGNGLGKKPM 59
           +YNKTPL+RQ F S    P+++LK+E  QPSGSFKSRGIG LI +   ++  +G  K   
Sbjct: 4   IYNKTPLLRQTFDSAKIGPRIFLKYENLQPSGSFKSRGIGCLILQHINKLKQDG-NKTAH 62

Query: 60  VFXXXXXXXXXXXXXXXKFLNLPCTVVIPTATKQRMADKIRATGANVIVSGNFWKEADNY 119
           VF               + L +PCTVV+P +TK+RM +KIR TGA+V++ G+ WKEAD++
Sbjct: 63  VFSSSGGNAGLAAATASRSLQVPCTVVVPKSTKERMVNKIRKTGASVLIKGDHWKEADDF 122

Query: 120 LKDNILSKLEELHKNVE-PIYVHPFDNPDIWEGHASMVDEIVEDFKNKMIPLNKIKAIVC 178
           L+ +    ++E+    E PIYVHPFD+P IWEGH++++DEIV+  + + I + K+K I+C
Sbjct: 123 LRKS----MKEMDNTQEQPIYVHPFDDPVIWEGHSTIIDEIVQTLQTEKISIEKVKGIIC 178

Query: 179 SVXXXXXXXXXXXXXEKYNLADKIPIVGVETKGCHVFNTSLRMNKVVSFKKITSIATSLG 238
           SV             E++NLA  IP++ VETKGC V N SL+    V   KITS+ATSLG
Sbjct: 179 SVGGGGLFNGIIKGLERHNLAQSIPVIAVETKGCDVLNKSLKNGTPVQLPKITSVATSLG 238

Query: 239 TADISTEAFKYAKRYGTKSVVLSDQDVVKTCLRYTHDFNMVIEPACGAAVHLAYHTEILE 298
           +  IS+ AF+ A +Y ++S+ L+D+DV++TCL+Y  DF+M +EPACGA+VHLAY+  I+E
Sbjct: 239 STYISSTAFENAMKYNSRSITLNDKDVLETCLKYNDDFSMTLEPACGASVHLAYNPGIVE 298

Query: 299 KELGTKLNADDIVLVVACGGSSNTVEDMESILQRL 333
             LGT L+  DIV+VV CGGSS T+ D+ES+  +L
Sbjct: 299 SALGTALSNHDIVIVVLCGGSSCTLHDLESLNSKL 333

>Smik_9.2 Chr9 (6779..7795) [1017 bp, 338 aa] {ON} YCL064C (REAL)
          Length = 338

 Score =  320 bits (819), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 159/329 (48%), Positives = 213/329 (64%), Gaps = 6/329 (1%)

Query: 1   MSVYNKTPLIRQIF---PSIPQMYLKHECFQPSGSFKSRGIGHLISKQSQRILGNGLGKK 57
           +S Y KTPLIRQ+F    + P  Y+KH+  QP GSFKSRGIGHLI K+++  L  G GK 
Sbjct: 3   ISHYEKTPLIRQVFDNGKTNPLFYIKHDMLQPGGSFKSRGIGHLIRKKNKEALAEGSGKL 62

Query: 58  PMVFXXXXXXXXXXXXXXXKFLNLPCTVVIPTATKQRMADKIRATGANVIVSGNFWKEAD 117
            +VF               + + L CTVV+P  TK RM  KI++ GA VI+ G+ W EAD
Sbjct: 63  -VVFSSSGGNAGLAAATSCRLMALNCTVVVPKTTKSRMVKKIQSAGAKVIIHGDHWGEAD 121

Query: 118 NYLKDNILSKLEELHKNVEPIYVHPFDNPDIWEGHASMVDEIVEDFKNKMIPLNKIKAIV 177
            YLK  +++  +E     + +YVHPFD+  IWEGH+++VDEI++  + K I   ++K +V
Sbjct: 122 EYLKQEVMA--QEGQHGSKTLYVHPFDDEIIWEGHSTIVDEILQQLQEKDISPLQVKGLV 179

Query: 178 CSVXXXXXXXXXXXXXEKYNLADKIPIVGVETKGCHVFNTSLRMNKVVSFKKITSIATSL 237
           CSV             E+  LA KIPIV VET GC V N SL+    V+ +++TS+ATSL
Sbjct: 180 CSVGGGGLFSGIIKGLERNRLAGKIPIVAVETAGCDVLNKSLKNGSPVALERLTSVATSL 239

Query: 238 GTADISTEAFKYAKRYGTKSVVLSDQDVVKTCLRYTHDFNMVIEPACGAAVHLAYHTEIL 297
           G+  I+  AF+    YG KSVVLSDQDV+ TCLRY  D+N ++EPACGA++HL YH EIL
Sbjct: 240 GSPYIAPFAFESFITYGCKSVVLSDQDVLDTCLRYADDYNFIVEPACGASLHLCYHPEIL 299

Query: 298 EKELGTKLNADDIVLVVACGGSSNTVEDM 326
           EK LG KL+ DD+V+++ACGGS  T ED+
Sbjct: 300 EKALGQKLSEDDVVIIIACGGSCMTYEDL 328

>ZYRO0F18524g Chr6 (1528741..1529748) [1008 bp, 335 aa] {ON} similar
           to uniprot|P25379 Saccharomyces cerevisiae YCL064C CHA1
           catabolism of hydroxy amino acids catabolic serine
           (threonine) dehydratase
          Length = 335

 Score =  315 bits (806), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 154/328 (46%), Positives = 212/328 (64%), Gaps = 12/328 (3%)

Query: 4   YNKTPLIRQIF-----PSIPQMYLKHECFQPSGSFKSRGIGHLISKQSQRILGNGLGKKP 58
           Y KTPL+RQI        +PQ+++K+E  QP GSFKSRGIG+LIS +S+    NGL  K 
Sbjct: 5   YYKTPLLRQILNWKTTTELPQIFIKYENLQPGGSFKSRGIGNLISLKSE----NGL-VKS 59

Query: 59  MVFXXXXXXXXXXXXXXXKFLNLPCTVVIPTATKQRMADKIRATGANVIVSGNFWKEADN 118
            V                K + LPCTVV+PT+TKQRM  KI+ +GA VI+ G+ WKEADN
Sbjct: 60  HVLSSSGGNAGLAAAIASKQMELPCTVVVPTSTKQRMVQKIKNSGAEVIIRGSHWKEADN 119

Query: 119 YLKDNILSKLEELHKNVEPIYVHPFDNPDIWEGHASMVDEIVEDFKNKMIPLNKIKAIVC 178
           YL+ N +          +P+YVHPFD+P +WEGH++MV EI+++ + + I +  ++ IVC
Sbjct: 120 YLQQNYIQSFRN-DGTSKPLYVHPFDDPKVWEGHSTMVHEIIDNLREQNISVENVRGIVC 178

Query: 179 SVXXXXXXXXXXXXXEKYNLADKIPIVGVETKGCHVFNTSLRMNKVVSFKKITSIATSLG 238
           SV             E + LADKIP++ VET GC+V N SL   + V   KITS+ATSLG
Sbjct: 179 SVGGGGLFNGIIKGLEDHGLADKIPVIAVETYGCNVLNASLNAGRPVMLDKITSLATSLG 238

Query: 239 TADISTEAFKYAKRYGTKSVVLSDQDVVKTCLRYTHDFNMVIEPACGAAVHLAYHTEILE 298
           +  I    F+ A RYG KS+VL D+DV++TCLRY  DF  ++EPACGA++H+ YH E+LE
Sbjct: 239 STYIPQGVFENAVRYGAKSLVLEDKDVIETCLRYVSDFGQIVEPACGASLHIGYHPELLE 298

Query: 299 KELGTKLNADDIVLVVACGGSSNTVEDM 326
             LG   + DDI++++ACGGS+ T +D+
Sbjct: 299 NFLG-GFSKDDIIVIIACGGSTTTFKDL 325

>Skud_9.2 Chr9 (5919..6938) [1020 bp, 339 aa] {ON} YCL064C (REAL)
          Length = 339

 Score =  314 bits (805), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 156/338 (46%), Positives = 216/338 (63%), Gaps = 6/338 (1%)

Query: 1   MSVYNKTPLIRQIF---PSIPQMYLKHECFQPSGSFKSRGIGHLISKQSQRILGNGLGKK 57
           M+ Y +TPLI Q+F    + P++Y+KHE  QP GSFKSRGIGHLI++ ++  L +G GK 
Sbjct: 3   MTHYERTPLIHQVFNNGQTGPRLYVKHEMLQPGGSFKSRGIGHLINRSNEEALADGSGKL 62

Query: 58  PMVFXXXXXXXXXXXXXXXKFLNLPCTVVIPTATKQRMADKIRATGANVIVSGNFWKEAD 117
             VF                 + L CTVV+P  TK RM  KI+  GA VI+ G+ W EAD
Sbjct: 63  A-VFSSSGGNAGLAAATACSSMALDCTVVVPKTTKSRMIKKIQNAGAKVIIHGSHWGEAD 121

Query: 118 NYLKDNILSKLEELHKNVEPIYVHPFDNPDIWEGHASMVDEIVEDFKNKMIPLNKIKAIV 177
            YL+  ++  ++E     + +YVHPFD+  IWEGH+++VDE+++  + K I L +IKA+V
Sbjct: 122 EYLRQELM--IQESQLGSKTLYVHPFDDERIWEGHSTIVDEVLQQLQEKNISLARIKAMV 179

Query: 178 CSVXXXXXXXXXXXXXEKYNLADKIPIVGVETKGCHVFNTSLRMNKVVSFKKITSIATSL 237
           CSV             E+ NLA KI ++ VET GC V N SL     ++ ++++SIATSL
Sbjct: 180 CSVGGGGLFSGIIKGLERNNLAGKIRVIAVETIGCDVLNKSLVNGSPITLERLSSIATSL 239

Query: 238 GTADISTEAFKYAKRYGTKSVVLSDQDVVKTCLRYTHDFNMVIEPACGAAVHLAYHTEIL 297
           G+  I+  AF+    YG KSVVLSDQDV+ TCLRY  D+N ++EPACGA++HL YH EIL
Sbjct: 240 GSPYIAPFAFESFNAYGCKSVVLSDQDVLATCLRYADDYNSIVEPACGASLHLCYHQEIL 299

Query: 298 EKELGTKLNADDIVLVVACGGSSNTVEDMESILQRLST 335
           E  L  KL+ DDIV+++ACGGS  T ED+    +R+S+
Sbjct: 300 ENALEQKLSDDDIVIIIACGGSCMTYEDLVETSRRISS 337

>KLLA0C00440g Chr3 complement(32008..33141) [1134 bp, 377 aa] {ON}
           similar to uniprot|P25379 Saccharomyces cerevisiae
           YCL064C CHA1 catabolism of hydroxy amino acids catabolic
           serine (threonine) dehydratase
          Length = 377

 Score =  313 bits (803), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 155/329 (47%), Positives = 219/329 (66%), Gaps = 4/329 (1%)

Query: 3   VYNKTPLIRQIFPSI--PQMYLKHECFQPSGSFKSRGIGHLISKQSQRILGNGLGKKPMV 60
           +++KTPL++  F     PQ+ LK+E  QPSGSFKSRGIGHLIS + + I  +   K   V
Sbjct: 24  LFSKTPLLKHQFKRSKGPQVLLKYEFLQPSGSFKSRGIGHLISTKVEEIKKSSPEKIGHV 83

Query: 61  FXXXXXXXXXXXXXXXKFLNLPCTVVIPTATKQRMADKIRATGANVIVSGNFWKEADNYL 120
           F                 LN+PCTVV+  AT+ R+ +KIR+ GA+V+V GN WKEAD+++
Sbjct: 84  FASSGGNAGLAAAVASLELNVPCTVVVSNATRPRIIEKIRSYGADVVVHGNHWKEADSFM 143

Query: 121 KDNILSKLEELHKNVEPIYVHPFDNPDIWEGHASMVDEIVEDFKNKMIPLNKIKAIVCSV 180
           K++++ KL+      EPIY HPFDNP IWEGH+ MVDEI++   +  IP+ KIK IVCS 
Sbjct: 144 KEHLMKKLDSF--KYEPIYSHPFDNPLIWEGHSFMVDEIMDVLASSKIPITKIKGIVCSF 201

Query: 181 XXXXXXXXXXXXXEKYNLADKIPIVGVETKGCHVFNTSLRMNKVVSFKKITSIATSLGTA 240
                        ++YNLADKIPIV VETKG  V + SLR+   V F+KI+S ATSLGTA
Sbjct: 202 GGGGLYNGLILGLQRYNLADKIPIVCVETKGTDVLSASLRVGAPVEFEKISSCATSLGTA 261

Query: 241 DISTEAFKYAKRYGTKSVVLSDQDVVKTCLRYTHDFNMVIEPACGAAVHLAYHTEILEKE 300
            IST A++  KR+G+KS V+SD +V+ TCL++++D N+V EP CGA ++  Y+ + L+  
Sbjct: 262 TISTTAYQNVKRHGSKSAVISDTEVISTCLQFSNDTNIVAEPGCGATLYFGYNIDKLQNI 321

Query: 301 LGTKLNADDIVLVVACGGSSNTVEDMESI 329
           LG+ +  DD V+++ CGGSS ++ED++ +
Sbjct: 322 LGSDIKDDDYVILIGCGGSSTSLEDLKEL 350

>Scer_YGOB_SDL1 Chr9 (29032..29411,29415..30048) [1014 bp, 337 aa]
           {ON} ANNOTATED BY YGOB - Skipping over stop codon in
           S288c
          Length = 337

 Score =  310 bits (794), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 156/329 (47%), Positives = 206/329 (62%), Gaps = 7/329 (2%)

Query: 1   MSVYNKTPLIRQIF---PSIPQMYLKHECFQPSGSFKSRGIGHLISKQSQRILGNGLGKK 57
           M+ Y KTPLIRQ      +    Y+KHE  QP GSFKSRGIGHLI K ++  L  G GK 
Sbjct: 3   MTYYEKTPLIRQFLNNGKTNSWFYVKHEMLQPGGSFKSRGIGHLIRKSNEEALSEGSGKL 62

Query: 58  PMVFXXXXXXXXXXXXXXXKFLNLPCTVVIPTATKQRMADKIRATGANVIVSGNFWKEAD 117
             VF               + + L C+VV+P  TK RM  KI++ GA VI+ G+ W EAD
Sbjct: 63  A-VFSSSGGNAGLAAATACRSMALNCSVVVPKTTKPRMVKKIQSAGAKVIIHGDHWGEAD 121

Query: 118 NYLKDNILSKLEELHKNVEPIYVHPFDNPDIWEGHASMVDEIVEDFKNKMIPLNKIKAIV 177
            YL+  +    +E     + +YVHPFDN  IWEGH+++VDEI+E  K   I L ++KA+V
Sbjct: 122 EYLRHEMA---QESQHGSKTLYVHPFDNETIWEGHSTIVDEIIEQLKENDISLPRVKALV 178

Query: 178 CSVXXXXXXXXXXXXXEKYNLADKIPIVGVETKGCHVFNTSLRMNKVVSFKKITSIATSL 237
           CSV             ++  LA+KIP+V VET GC V N SL+    V+ +K+TS+ATSL
Sbjct: 179 CSVGGGGLFSGIIKGLDRNQLAEKIPVVAVETAGCDVLNKSLKKGSPVTLEKLTSVATSL 238

Query: 238 GTADISTEAFKYAKRYGTKSVVLSDQDVVKTCLRYTHDFNMVIEPACGAAVHLAYHTEIL 297
            +  I++ AF+   +YG KSVVLSDQDV+ TCLRY  D+N ++EPACGA++HL YH EIL
Sbjct: 239 ASPYIASFAFESFNKYGCKSVVLSDQDVLATCLRYADDYNFIVEPACGASLHLCYHPEIL 298

Query: 298 EKELGTKLNADDIVLVVACGGSSNTVEDM 326
           E  L  K+  DDIV+++ACGGS  T ED+
Sbjct: 299 EDILEQKIYEDDIVIIIACGGSCMTYEDL 327

>Ecym_1006 Chr1 complement(9635..10729) [1095 bp, 364 aa] {ON}
           similar to Ashbya gossypii AFR747W
          Length = 364

 Score =  308 bits (788), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 159/357 (44%), Positives = 235/357 (65%), Gaps = 16/357 (4%)

Query: 2   SVYNKTPLIRQIF--PSI-----PQMYLKHECFQPSGSFKSRGIGHLISKQSQRILGNGL 54
           S+Y KTPL+R+ F  P+I     PQ  +K+E FQPSGSFKSRGIG+LI  +   I  +  
Sbjct: 3   SLYVKTPLLRRAFGKPNIQISKVPQFLVKYEFFQPSGSFKSRGIGNLIYNKVSEIRRDP- 61

Query: 55  GKKPMVFXXXXXXXXXXXXXXXKFLNLPCTVVIPTATKQRMADKIRATGANVIVSGNFWK 114
            K+P VF               + + +PCTVV+PT+T+QR+ +KI ATGA +I  G+++ 
Sbjct: 62  AKQPHVFSSSGGNAGLAAATASQRMGIPCTVVVPTSTRQRIIEKIMATGATIICRGDYFA 121

Query: 115 EADNYLKD---NILSKLEELHKNVEPIYVHPFDNPDIWEGHASMVDEIVEDFKNKMIPLN 171
           EAD+YLKD      +K     KNV PIYVHPF++P IW GH+ +V+EI+E  +N+ IP +
Sbjct: 122 EADSYLKDLMQEAANKNTRDKKNV-PIYVHPFNHPLIWHGHSYIVEEILESLRNENIPYS 180

Query: 172 KIKAIVCSVXXXXXXXXXXXXXEKYNLADKIPIVGVETKGCHVFNTSLRMNKVVSFKKIT 231
           ++K IVCSV             E+++LA+ IPI+GVET+GC V + SL   K+++FKK  
Sbjct: 181 RVKGIVCSVGGGGLYNGIIEGLERHSLANTIPIIGVETEGCEVLHKSLIAGKLITFKKAL 240

Query: 232 SIATSLGTADISTEAFKYAKRYGTKSVVLSDQDVVKTCLRYTHDFNMVIEPACGAAVHLA 291
           S+ATSL    I+ E  +YA++Y TKS+VL + +V+ TCLR+T + N+V EPACGA +HL 
Sbjct: 241 SVATSLSVPTITKETLRYAQKYKTKSLVLGEGEVLDTCLRFTDESNIVTEPACGATLHLG 300

Query: 292 YHTEILEKELGTKLNADDIVLVVACGGSSNTVEDMESILQR---LSTEENNINIPNV 345
           YH  IL KELG  L+++DIV+++ACGGS+ T+ D+  +  +   ++ +++ + IP +
Sbjct: 301 YHPAILHKELG-PLSSEDIVILIACGGSATTLADLRELKLKYNPVTLDDSPVEIPGL 356

>KLTH0F00440g Chr6 complement(34215..35240) [1026 bp, 341 aa] {ON}
           similar to uniprot|P25379 Saccharomyces cerevisiae
           YCL064C CHA1 catabolism of hydroxy amino acids catabolic
           serine (threonine) dehydratase
          Length = 341

 Score =  302 bits (774), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 152/338 (44%), Positives = 212/338 (62%), Gaps = 10/338 (2%)

Query: 2   SVYNKTPLIRQIF-------PSIPQMYLKHECFQPSGSFKSRGIGHLISKQSQRILGNGL 54
           S + KTPL+   F       P+ PQ  LK E  QPSGSFKSRGIG++I+KQ+ +I   G 
Sbjct: 3   SAFVKTPLLAHYFAASSNRLPNQPQFMLKCEFLQPSGSFKSRGIGYMITKQAIKIRSEG- 61

Query: 55  GKKPMVFXXXXXXXXXXXXXXXKFLNLPCTVVIPTATKQRMADKIRATGANVIVSGNFWK 114
            K P VF               + L++PC+VV+P +T  RM  KI   GA V V G  WK
Sbjct: 62  NKLPHVFASSGGNAGLAAATTSRALSIPCSVVVPESTSNRMVQKIWNLGAEVHVYGRNWK 121

Query: 115 EADNYLKDNILSKLEELHKNVEPIYVHPFDNPDIWEGHASMVDEIVEDFKNKMIPLNKIK 174
           EAD +LK++I+S        V  IY HPFD+P IWEGH+S+VDEI++  K + I L  IK
Sbjct: 122 EADKFLKESIISGHNPSRTQV--IYAHPFDHPLIWEGHSSIVDEIIDSLKEQKIDLKNIK 179

Query: 175 AIVCSVXXXXXXXXXXXXXEKYNLADKIPIVGVETKGCHVFNTSLRMNKVVSFKKITSIA 234
           AIVCSV              ++ L  KIPI+GVE+KGC VFN+SL++ K+  F+ ITSIA
Sbjct: 180 AIVCSVGGGGLYNGIIEGLSRHKLVHKIPIIGVESKGCEVFNSSLKLGKLTEFEDITSIA 239

Query: 235 TSLGTADISTEAFKYAKRYGTKSVVLSDQDVVKTCLRYTHDFNMVIEPACGAAVHLAYHT 294
           TS+GT  IS +  + A RY TKSVVL+DQ+++ TCLR+  + N++ EPACGAA+HL Y+ 
Sbjct: 240 TSIGTNSISKKTLENALRYHTKSVVLTDQEIISTCLRFADETNIIPEPACGAALHLGYYP 299

Query: 295 EILEKELGTKLNADDIVLVVACGGSSNTVEDMESILQR 332
           +IL + L +    +D+++++ CGGS+ +  D+ S+  +
Sbjct: 300 DILYQALNSDFTPEDVIIMIGCGGSATSYNDLASLFSK 337

>KNAG0D05380 Chr4 complement(986308..987312) [1005 bp, 334 aa] {ON} 
          Length = 334

 Score =  301 bits (771), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 152/337 (45%), Positives = 209/337 (62%), Gaps = 7/337 (2%)

Query: 2   SVYNKTPLIRQIFPSI--PQMYLKHECFQPSGSFKSRGIGHLISKQSQRILGNGLGKKPM 59
           ++YNKTPL+ +       P    K+E  QP GSFK RG+ HLI K+ ++I   G  K P 
Sbjct: 3   ALYNKTPLLPKNLSGGDGPTFLFKYENMQPGGSFKIRGVSHLIEKRVEQIKSEG-KKPPH 61

Query: 60  VFXXXXXXXXXXXXXXXKFLNLPCTVVIPTATKQRMADKIRATGANVIVSGNFWKEADNY 119
           VF                 L++PCTVV+PT TK RM +KIR   A VIV G+ WKEAD+Y
Sbjct: 62  VFSSSGGNAGLAAATACHILSIPCTVVVPTLTKPRMVEKIRKANAEVIVKGSNWKEADDY 121

Query: 120 LKDNILSKLEELHKNVEPIYVHPFDNPDIWEGHASMVDEIVEDFKNKMIPLNKIKAIVCS 179
           L+  +++     +  V+PIYV+PFD+P +WEGH++M+DEI+     + I L+ +K IVCS
Sbjct: 122 LRGTVIAS----NNAVQPIYVNPFDDPLLWEGHSTMIDEILNALNQENIKLDAVKGIVCS 177

Query: 180 VXXXXXXXXXXXXXEKYNLADKIPIVGVETKGCHVFNTSLRMNKVVSFKKITSIATSLGT 239
           V             E + LA  IP+V VETKGC V   SL   K V   KI SIATSLG+
Sbjct: 178 VGGGGLFNGIVHGLENHQLACTIPVVAVETKGCDVLGLSLAAEKPVRLNKIDSIATSLGS 237

Query: 240 ADISTEAFKYAKRYGTKSVVLSDQDVVKTCLRYTHDFNMVIEPACGAAVHLAYHTEILEK 299
           + +S +AF  A ++ ++SVVL D DV+ TC RY  DFN ++EPACGA +H AYH +ILEK
Sbjct: 238 SYVSCQAFDNAVKFKSRSVVLHDSDVLNTCYRYLDDFNAIVEPACGATIHTAYHYKILEK 297

Query: 300 ELGTKLNADDIVLVVACGGSSNTVEDMESILQRLSTE 336
            LG KL   DI++++ CGGS  T++D+E+  ++L T+
Sbjct: 298 ALGQKLTPSDIIIIIVCGGSCVTIQDLENAKRKLDTD 334

>AFR747W Chr6 (1808016..1809296) [1281 bp, 426 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YCL064C (CHA1)
          Length = 426

 Score =  298 bits (764), Expect = 4e-98,   Method: Compositional matrix adjust.
 Identities = 159/349 (45%), Positives = 218/349 (62%), Gaps = 12/349 (3%)

Query: 2   SVYNKTPLIRQIFP-------SIPQMYLKHECFQPSGSFKSRGIGHLISKQSQRILGNGL 54
           S Y KTPL+R +F        + P++ LK+E FQPSGSFKSRGIG+LI K+ Q+I  N  
Sbjct: 71  SFYCKTPLMRHVFARQNVRYTANPEIMLKYEFFQPSGSFKSRGIGNLIWKEMQKIRQNS- 129

Query: 55  GKKPMVFXXXXXXXXXXXXXXXKFLNLPCTVVIPTATKQRMADKIRATGANVIVSGNFWK 114
             +P VF               + L LPCTVV+P  T++RM ++IR+TGA+VI  G+  K
Sbjct: 130 SLQPHVFASSGGNAGLAAATASRQLGLPCTVVVPETTRRRMVERIRSTGADVISMGSVLK 189

Query: 115 EADNYLKDNILSKLEELHKNVEPIYVHPFDNPDIWEGHASMVDEIVEDFKNKMIPLNKIK 174
           E+D+YL+  ++  +  L K V PIY HPFDNP IWEGHA+MVDE+VE    + + L  +K
Sbjct: 190 ESDDYLRSELMGNVN-LEK-VAPIYAHPFDNPLIWEGHATMVDEVVEALHLQGVQLESVK 247

Query: 175 AIVCSVXXXXXXXXXXXXXEKYNLADKIPIVGVETKGCHVFNTSLRMNKVVSFKKITSIA 234
            IVCSV             EK+ LAD IP+V VET+GC V + SL + + VS     S+A
Sbjct: 248 GIVCSVGGGGLYNGIVYGLEKHGLADSIPVVAVETEGCEVLHRSLLLGRNVSMNP-KSVA 306

Query: 235 TSLGTADISTEAFKYAKRYGTKSVVLSDQDVVKTCLRYTHDFNMVIEPACGAAVHLAYHT 294
           TSL T+ ++     YA++Y TKSVVL    VV+TCL +  + N+V EPACGAA+HL YH 
Sbjct: 307 TSLCTSFVTDLTLSYAQKYRTKSVVLDQLAVVQTCLNFAEESNIVTEPACGAALHLGYHP 366

Query: 295 EILEKELGTKLNADDIVLVVACGGSSNTVEDMESILQRLSTEENNINIP 343
           EILE+ELG  L   D+V+V+ACGGS+  + D++    +L  +  + + P
Sbjct: 367 EILERELG-PLTPQDVVIVIACGGSTMNLADLKESEDQLQPKIKDFHTP 414

>SAKL0C13904g Chr3 (1223973..1224992) [1020 bp, 339 aa] {ON} similar
           to uniprot|P25379 Saccharomyces cerevisiae YCL064C CHA1
           catabolism of hydroxy amino acids catabolic serine
           (threonine) dehydratase
          Length = 339

 Score =  290 bits (743), Expect = 4e-96,   Method: Compositional matrix adjust.
 Identities = 141/337 (41%), Positives = 214/337 (63%), Gaps = 6/337 (1%)

Query: 1   MSVYNKTPLIRQIFPSI---PQMYLKHECFQPSGSFKSRGIGHLISKQSQRILGNGLGKK 57
           +S YNKTPL+ ++  +    P+ +LK+E  QP GSFKSRGIG+L+ K  ++   +G GK 
Sbjct: 5   LSFYNKTPLLPRVLTTTDGAPRFFLKYEFLQPGGSFKSRGIGYLVKKSYEKARRDG-GKS 63

Query: 58  PMVFXXXXXXXXXXXXXXXKFLNLPCTVVIPTATKQRMADKIRATGANVIVSGNFWKEAD 117
             VF               +  ++ CTVV+P  TK RM +KIR TGA V+V G  W  AD
Sbjct: 64  LAVFSSSGGNAGLAAAIAAQTFSINCTVVVPRTTKSRMVEKIRKTGAEVLVYGKHWGMAD 123

Query: 118 NYLKDNILSKLEELHKNVEPIYVHPFDNPDIWEGHASMVDEIVEDFKNKMIPLNKIKAIV 177
            YL++ ++ +++     V P+YVHPFDNP IW+GH+++VDE+V   K + + ++K+KAIV
Sbjct: 124 EYLREVVMKEVDV--SKVVPLYVHPFDNPIIWQGHSTIVDEVVAQLKEENVSIDKVKAIV 181

Query: 178 CSVXXXXXXXXXXXXXEKYNLADKIPIVGVETKGCHVFNTSLRMNKVVSFKKITSIATSL 237
           CSV             E + LAD+IPI+ +ETKGC V N SL     V  + +TS+A+SL
Sbjct: 182 CSVGGGGLYNGIVKGLETHQLADRIPILAIETKGCDVLNKSLNSGNPVVLESLTSVASSL 241

Query: 238 GTADISTEAFKYAKRYGTKSVVLSDQDVVKTCLRYTHDFNMVIEPACGAAVHLAYHTEIL 297
            +  IS +AF+ A++Y +KS++L D  V++TCL +  D  +V+EPACGA+++  YH E+L
Sbjct: 242 ASPYISEKAFENARKYESKSILLKDSQVIETCLNFADDAGIVVEPACGASLYSCYHPELL 301

Query: 298 EKELGTKLNADDIVLVVACGGSSNTVEDMESILQRLS 334
              +G +L  DD+++V+ACGGS+ T +D+E + + L 
Sbjct: 302 PLYIGKELTEDDVIVVIACGGSAVTYKDLEYMKKELG 338

>TDEL0D06540 Chr4 (1175562..1176575) [1014 bp, 337 aa] {ON} 
          Length = 337

 Score =  276 bits (707), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 143/336 (42%), Positives = 204/336 (60%), Gaps = 9/336 (2%)

Query: 1   MSVYNKTPLIRQIFPSI----PQMYLKHECFQPSGSFKSRGIGHLISKQSQRILGNGLGK 56
           MS  +K+PL+ + F       PQ +LK+E  QPSGSFKSRGIG+LI+ +++       G 
Sbjct: 1   MSYSHKSPLLNRRFKESEKDGPQFFLKYETLQPSGSFKSRGIGYLINSKAKEARSRD-GS 59

Query: 57  KPMVFXXXXXXXXXXXXXXXKFLNLPCTVVIPTATKQRMADKIRATGANVIVSGNFWKEA 116
              VF               K LNL CTVV+P  TK+ M D+I+  G+ VIV G  W  A
Sbjct: 60  DVHVFSSSGGNAGLAAANASKLLNLNCTVVVPVTTKRHMIDRIQNAGSQVIVHGTHWGMA 119

Query: 117 DNYLKDNILSKLEELHKNVEPIYVHPFDNPDIWEGHASMVDEIVEDFKNKMIPLNKIKAI 176
           D YLK+ ++ K+     NVEP+YVHPFD+P +WEGH+ M+DEIVE  + +   +  +K I
Sbjct: 120 DTYLKEVVMKKVPS---NVEPLYVHPFDDPLVWEGHSFMIDEIVEQLQEQGRSMRDVKGI 176

Query: 177 VCSVXXXXXXXXXXXXXEKYNLADKIPIVGVETKGCHVFNTSLRMNKVVSFKKITSIATS 236
           +CSV             E++  A KIPI+ VET G      SL   K V   ++TSIA+S
Sbjct: 177 ICSVGGGGLYNGIVGGLERHGYAGKIPIIAVETVGADALAKSLAAGKPVRLTEVTSIASS 236

Query: 237 LGTADISTEAFKYAKRYGTKSVVLSDQDVVKTCLRYTHDFNMVIEPACGAAVHLAYHTEI 296
           LG+  I+ ++F+ A RY T+S V +D++ V+T LR+  + N+++EPAC A+V L YH + 
Sbjct: 237 LGSPYIAQDSFEKAIRYKTRSFVQTDEEAVRTSLRFFQETNILVEPACAASVSLCYHVDE 296

Query: 297 LEKELGTKLNADDIVLVVACGGSSNTVEDMESILQR 332
           L K L  KL++ DIV+V+ CGGS+ T+ D+E +LQR
Sbjct: 297 LNKLLSCKLSSKDIVIVIVCGGSATTISDLE-MLQR 331

>KLLA0E01805g Chr5 complement(173125..174093) [969 bp, 322 aa] {ON}
           similar to uniprot|P25379 Saccharomyces cerevisiae
           YCL064C CHA1 catabolism of hydroxy amino acids catabolic
           serine (threonine) dehydratase
          Length = 322

 Score =  251 bits (642), Expect = 5e-81,   Method: Compositional matrix adjust.
 Identities = 131/326 (40%), Positives = 192/326 (58%), Gaps = 13/326 (3%)

Query: 6   KTPLI--RQIFPSIPQMYLKHECFQPSGSFKSRGIGHLISKQSQRILGNGLGKKPMVFXX 63
           KTPL+  R+     P   LK+E  QP GSFKSRGI HLI      I  +    +  V+  
Sbjct: 7   KTPLLPFREPLNGGPTFLLKYENLQPGGSFKSRGISHLIKTTMDSI--SDPENELAVYSS 64

Query: 64  XXXXXXXXXXXXXKFLNLPCTVVIPTATKQRMADKIRATGANVIVSGNFWKEADNYLKDN 123
                          L +PCTV++P +TK RM  KI + GA V++ G+ WKEAD YL++ 
Sbjct: 65  SGGNAGLAAARACATLKVPCTVIVPKSTKPRMIKKIESAGAKVVIFGDHWKEADTYLREY 124

Query: 124 ILSKLEELHKNVEPIYVHPFDNPDIWEGHASMVDEIVEDFKNKMIPLNKIKAIVCSVXXX 183
           ++   +  + N   +YVHPFDNP IW+GH++M+DEI+E        +N +K IVCSV   
Sbjct: 125 VMR--QSSYSNT--LYVHPFDNPIIWDGHSTMIDEIIEQLAESHTDINDVKGIVCSVGGG 180

Query: 184 XXXXXXXXXXEKYNLADKIPIVGVETKGCHVFNTSLRMNKVVSFKKITSIATSLGTADIS 243
                     E++ LA  IP+  +ET GC V + SL   + V   +I+SIATSLG+ +I 
Sbjct: 181 GLYNGVVNGLERHGLAGSIPVFAMETDGCDVLSKSLIAGEPVVLDRISSIATSLGSTEIC 240

Query: 244 TEAFKYAKRYGTKSVVLSDQDVVKTCLRYTHDFNMVIEPACGAAVHLAYHTEILEKELGT 303
            ++F+ A ++ +KS+VL D++VV TCLR+  + ++++EPACGA++H  Y  E+L      
Sbjct: 241 ADSFQKAIKFSSKSIVLDDKNVVDTCLRFFDETSILVEPACGASLHTCYRPELL-----G 295

Query: 304 KLNADDIVLVVACGGSSNTVEDMESI 329
            L  DDIV+V+ CGGS NT +D++S 
Sbjct: 296 PLGPDDIVVVILCGGSCNTYDDLKSF 321

>YIL167W Chr9 (29416..30048) [633 bp, 210 aa] {OFF}  SDL1Open
           reading frame, unlikely to produce a functional protein
           in S288C; in closely related species and other S.
           cerevisiae strain backgrounds YIL167W and adjacent
           ORF, YIL168W, constitute a single ORF encoding L-serine
           dehydratase
          Length = 210

 Score =  211 bits (538), Expect = 6e-67,   Method: Compositional matrix adjust.
 Identities = 100/198 (50%), Positives = 135/198 (68%)

Query: 129 EELHKNVEPIYVHPFDNPDIWEGHASMVDEIVEDFKNKMIPLNKIKAIVCSVXXXXXXXX 188
           +E     + +YVHPFDN  IWEGH+++VDEI+E  K   I L ++KA+VCSV        
Sbjct: 3   QESQHGSKTLYVHPFDNETIWEGHSTIVDEIIEQLKENDISLPRVKALVCSVGGGGLFSG 62

Query: 189 XXXXXEKYNLADKIPIVGVETKGCHVFNTSLRMNKVVSFKKITSIATSLGTADISTEAFK 248
                ++  LA+KIP+V VET GC V N SL+    V+ +K+TS+ATSL +  I++ AF+
Sbjct: 63  IIKGLDRNQLAEKIPVVAVETAGCDVLNKSLKKGSPVTLEKLTSVATSLASPYIASFAFE 122

Query: 249 YAKRYGTKSVVLSDQDVVKTCLRYTHDFNMVIEPACGAAVHLAYHTEILEKELGTKLNAD 308
              +YG KSVVLSDQDV+ TCLRY  D+N ++EPACGA++HL YH EILE  L  K+  D
Sbjct: 123 SFNKYGCKSVVLSDQDVLATCLRYADDYNFIVEPACGASLHLCYHPEILEDILEQKIYED 182

Query: 309 DIVLVVACGGSSNTVEDM 326
           DIV+++ACGGS  T ED+
Sbjct: 183 DIVIIIACGGSCMTYEDL 200

>KNAG0A01150 Chr1 (6346..7041) [696 bp, 231 aa] {ON}
          Length = 231

 Score =  211 bits (537), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 100/214 (46%), Positives = 142/214 (66%), Gaps = 4/214 (1%)

Query: 114 KEADNYLKDNILSKLEELHKNVEPIYVHPFDNPDIWEGHASMVDEIVEDFKNKMIPLNKI 173
           KEAD YL++ ++    +L+K+V+PIYV+PFD+P IWEGH++++DEI+     + I +  +
Sbjct: 13  KEADYYLQNVVI----DLYKDVQPIYVNPFDDPLIWEGHSTIIDEILNTLTQENIEVGSV 68

Query: 174 KAIVCSVXXXXXXXXXXXXXEKYNLADKIPIVGVETKGCHVFNTSLRMNKVVSFKKITSI 233
           K I+CS              EKY+LA  IP+V VETKGC V N SL  NK V    ITSI
Sbjct: 69  KGIICSFSGGGLYNGIMQGLEKYDLAYNIPVVAVETKGCDVLNLSLAANKPVQLDSITSI 128

Query: 234 ATSLGTADISTEAFKYAKRYGTKSVVLSDQDVVKTCLRYTHDFNMVIEPACGAAVHLAYH 293
           A SLG++ +S + F    +Y +KS+VL+D D + TC +Y  DF  V+EPACGA+VH AYH
Sbjct: 129 AKSLGSSVVSQKVFDNVIKYHSKSLVLNDSDALDTCFKYLDDFGTVLEPACGASVHTAYH 188

Query: 294 TEILEKELGTKLNADDIVLVVACGGSSNTVEDME 327
             +LE+ L  KL  DD+++++ACGGS  T +D+E
Sbjct: 189 YNVLEEALDQKLRPDDVIIIIACGGSCATFQDLE 222

>YIL168W Chr9 (29032..29415) [384 bp, 127 aa] {OFF} Open reading
           frame, unlikely to produce a functional protein in
           S288C; in closely related species and other S.
           cerevisiae strain backgrounds YIL168W and adjacent
           ORF, YIL167W, constitute a single ORF encoding L-serine
           dehydratase
          Length = 127

 Score =  108 bits (269), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 56/124 (45%), Positives = 70/124 (56%), Gaps = 4/124 (3%)

Query: 1   MSVYNKTPLIRQIF---PSIPQMYLKHECFQPSGSFKSRGIGHLISKQSQRILGNGLGKK 57
           M+ Y KTPLIRQ      +    Y+KHE  QP GSFKSRGIGHLI K ++  L  G GK 
Sbjct: 3   MTYYEKTPLIRQFLNNGKTNSWFYVKHEMLQPGGSFKSRGIGHLIRKSNEEALSEGSGKL 62

Query: 58  PMVFXXXXXXXXXXXXXXXKFLNLPCTVVIPTATKQRMADKIRATGANVIVSGNFWKEAD 117
             VF               + + L C+VV+P  TK RM  KI++ GA VI+ G+ W EAD
Sbjct: 63  A-VFSSSGGNAGLAAATACRSMALNCSVVVPKTTKPRMVKKIQSAGAKVIIHGDHWGEAD 121

Query: 118 NYLK 121
            YL+
Sbjct: 122 EYLR 125

>SAKL0F11858g Chr6 (920767..922455) [1689 bp, 562 aa] {ON} highly
           similar to uniprot|P00927 Saccharomyces cerevisiae
           YER086W ILV1 Threonine deaminase catalyzes the first
           step in isoleucine biosynthesis expression is under
           general amino acid control ILV1 locus exhibits highly
           positioned nucleosomes whose organization is independent
           of known ILV1 regulation
          Length = 562

 Score = 76.3 bits (186), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 66/269 (24%), Positives = 113/269 (42%), Gaps = 24/269 (8%)

Query: 22  LKHECFQPSGSFKSRGIGHLISK--QSQRILGNGLGKKPMVFXXXXXXXXXXXXXXXKFL 79
           LK E   P  SFK RG  ++I+K  +SQ+  G        V                K L
Sbjct: 83  LKREDLLPVFSFKLRGAYNMIAKLDESQKTQG--------VIACSAGNHAQGVAYASKHL 134

Query: 80  NLPCTVVIPTATKQRMADKIRATGANVIVSGNFWKEADNYLKDNILSKLEELHKNVEPIY 139
           N+P T+V+P +T       +   G+ V++ GN + EA         ++  +L +      
Sbjct: 135 NIPATIVMPVSTPSIKYQNVSRLGSQVVLYGNDFDEAK--------AECTKLTEERGLTN 186

Query: 140 VHPFDNPDIWEGHASMVDEIVEDFKNKMIPLNKIKAIVCSVXXXXXXXXXXXXXEKYNLA 199
           + PFD+P +  G  ++  EI+    N     +KIKA+ C+V             ++  +A
Sbjct: 187 IPPFDHPYVIAGQGTIAMEILRQVHNA----SKIKAVFCAVGGGGLITGVGAYLKR--IA 240

Query: 200 DKIPIVGVETKGCHVFNTSLRMNKVVSFKKITSIATSLGTADISTEAFKYAKRYGTKSVV 259
             I ++GVET      +TSL+  K V    + + A       I  E F+ AK    + V+
Sbjct: 241 PHIKVIGVETYDAATLHTSLKAGKRVPLPNVGTFADGTSVRMIGEETFRVAKDVVDEVVL 300

Query: 260 LSDQDVVKTCLRYTHDFNMVIEPACGAAV 288
           ++  ++         D   ++EP+   +V
Sbjct: 301 VNTDEICAAVKDIFEDTRSIVEPSGALSV 329

>Ecym_4708 Chr4 (1386138..1387850) [1713 bp, 570 aa] {ON} similar to
           Ashbya gossypii ACR232C
          Length = 570

 Score = 67.8 bits (164), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 67/289 (23%), Positives = 124/289 (42%), Gaps = 23/289 (7%)

Query: 3   VYNKTPLIRQIFPSI---PQMYLKHECFQPSGSFKSRGIGHLISKQSQRILGNGLGKKPM 59
           + N++P+ R  F S      + LK E   P  SFK RG  ++IS        + + KK  
Sbjct: 69  IINESPISRSEFLSSRLNTDVQLKREDLLPVFSFKLRGAYNMISHL------DDVQKKCG 122

Query: 60  VFXXXXXXXXXXXXXXXKFLNLPCTVVIPTATKQRMADKIRATGANVIVSGNFWKEADNY 119
           V                K L +P T+V+P +T       +   GA V++ G+ +  A   
Sbjct: 123 VIACSAGNHAQGVAYSAKHLGIPATIVMPVSTPSIKYQNVSRLGAEVVLYGDNFDAAK-- 180

Query: 120 LKDNILSKLEELHKNVEPIYVHPFDNPDIWEGHASMVDEIVEDFKNKMIPLNKIKAIVCS 179
           ++ + LS+ + L+       + PFD+P +  G  ++  EI++  +N     +KI A+ C+
Sbjct: 181 VECSRLSEEKGLYD------IPPFDHPYVIAGQGTIAMEILKQIQNS----SKIGAVFCA 230

Query: 180 VXXXXXXXXXXXXXEKYNLADKIPIVGVETKGCHVFNTSLRMNKVVSFKKITSIATSLGT 239
           V             ++   A  I ++GVET      +TS++ N   +  ++   A     
Sbjct: 231 VGGGGLIAGVGAYIKR--AAPHIKVIGVETYDAATLHTSMQNNARTTLSQVGGFADGTSV 288

Query: 240 ADISTEAFKYAKRYGTKSVVLSDQDVVKTCLRYTHDFNMVIEPACGAAV 288
             I  E+F+ A+    + ++++  ++         D   V+EP+   AV
Sbjct: 289 RLIGEESFRVAREVVDEVILVNTDEICAAIKDIFEDTRAVVEPSGALAV 337

>NCAS0A14230 Chr1 (2801647..2803356) [1710 bp, 569 aa] {ON}
           Anc_7.367
          Length = 569

 Score = 67.0 bits (162), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 65/269 (24%), Positives = 109/269 (40%), Gaps = 24/269 (8%)

Query: 22  LKHECFQPSGSFKSRGIGHLISK--QSQRILGNGLGKKPMVFXXXXXXXXXXXXXXXKFL 79
           LK E   P  SFK RG  ++I+K   SQR  G        V                K L
Sbjct: 90  LKREDLLPVFSFKLRGAYNMIAKLDDSQRNQG--------VIACSAGNHAQGVAYAAKHL 141

Query: 80  NLPCTVVIPTATKQRMADKIRATGANVIVSGNFWKEADNYLKDNILSKLEELHKNVEPIY 139
            +P T+V+P +T       +   G+ V++ GN + EA         ++  +L +      
Sbjct: 142 GIPATIVMPVSTPSIKYQNVSRLGSQVVLYGNDFDEAK--------AECTKLAEERGLTN 193

Query: 140 VHPFDNPDIWEGHASMVDEIVEDFKNKMIPLNKIKAIVCSVXXXXXXXXXXXXXEKYNLA 199
           + PFD+P +  G  ++  EI+    N     NKI A+   V             ++  +A
Sbjct: 194 IPPFDHPYVIAGQGTVAMEILRQVHNA----NKIGAVFVPVGGGGFIAGVGAYLKR--IA 247

Query: 200 DKIPIVGVETKGCHVFNTSLRMNKVVSFKKITSIATSLGTADISTEAFKYAKRYGTKSVV 259
             I ++GVET      +TSL+ NK      + + A       I  E F+ A++   + V+
Sbjct: 248 PHIKVIGVETFDAATLHTSLKHNKRTPLPTVGTFADGTSVRVIGEETFRVAQQVVDEVVL 307

Query: 260 LSDQDVVKTCLRYTHDFNMVIEPACGAAV 288
           ++  ++         D   ++EP+   AV
Sbjct: 308 VNTDEICAAVKDIFEDTRSIVEPSGALAV 336

>CAGL0I05126g Chr9 complement(481145..482860) [1716 bp, 571 aa] {ON}
           highly similar to uniprot|P00927 Saccharomyces
           cerevisiae YER086w ILV1 anabolic serine and threonine
           dehydratase precursor
          Length = 571

 Score = 65.9 bits (159), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 63/269 (23%), Positives = 109/269 (40%), Gaps = 24/269 (8%)

Query: 22  LKHECFQPSGSFKSRGIGHLISK--QSQRILGNGLGKKPMVFXXXXXXXXXXXXXXXKFL 79
           LK E   P  SFK RG  ++I+K   +QR  G        V                + L
Sbjct: 92  LKREDLLPVFSFKLRGAYNMIAKLDDTQRNQG--------VIACSAGNHAQGVAYAARHL 143

Query: 80  NLPCTVVIPTATKQRMADKIRATGANVIVSGNFWKEADNYLKDNILSKLEELHKNVEPIY 139
           ++P T+V+P +T       +   G+ V++ GN + EA         ++  +L +      
Sbjct: 144 DIPATIVMPVSTPSIKYQNVSRLGSQVVLYGNDFDEAK--------AECTKLAEERGLTN 195

Query: 140 VHPFDNPDIWEGHASMVDEIVEDFKNKMIPLNKIKAIVCSVXXXXXXXXXXXXXEKYNLA 199
           + PFD+P +  G  ++  EI+    N     NKI A+   V             ++  + 
Sbjct: 196 IPPFDHPYVIAGQGTVAMEILRQVYNS----NKIGAVFVPVGGGGLIAGVGAYLKR--VT 249

Query: 200 DKIPIVGVETKGCHVFNTSLRMNKVVSFKKITSIATSLGTADISTEAFKYAKRYGTKSVV 259
             I I+GVET      +TSL+ NK  +   + + A       I  E F+ A+    + V+
Sbjct: 250 PHIKIIGVETHDAATLHTSLQRNKRTNLASVGTFADGTSVRIIGEETFRVAREVVDEIVL 309

Query: 260 LSDQDVVKTCLRYTHDFNMVIEPACGAAV 288
           ++  ++         D   ++EP+   AV
Sbjct: 310 VNTDEICAAVKDVFEDTRSIVEPSGALAV 338

>YKL218C Chr11 complement(17359..18339) [981 bp, 326 aa] {ON}
           SRY13-hydroxyaspartate dehydratase, deaminates
           L-threo-3-hydroxyaspartate to form oxaloacetate and
           ammonia; required in the presence of hydroxyaspartate;
           highly similar to mouse serine racemase (Srr) but has no
           serine racemase activity
          Length = 326

 Score = 64.7 bits (156), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 73/312 (23%), Positives = 128/312 (41%), Gaps = 30/312 (9%)

Query: 5   NKTPLI--RQIFPSI-PQMYLKHECFQPSGSFKSRGIGHLISKQSQRILGNGLGKKPMVF 61
           NKTP++  R +   +  Q+Y K E FQ  G+FK RG  + +SK S      G      V 
Sbjct: 21  NKTPVLTSRMLNDRLGAQIYFKGENFQRVGAFKFRGAMNAVSKLSDEKRSKG------VI 74

Query: 62  XXXXXXXXXXXXXXXKFLNLPCTVVIPTATKQRMADKIRATGANVIVSGNFWKEADNYLK 121
                          K LN+P T+V+P              GA++I    + ++     +
Sbjct: 75  AFSSGNHAQAIALSAKLLNVPATIVMPEDAPALKVAATAGYGAHIIRYNRYTED-----R 129

Query: 122 DNILSKLEELHKNVEPIYVHPFDNPDIWEGHASMVDEIVEDFKNKMIPLNKIKAIVCSVX 181
           + I  +L   H       + P+D+PD+  G  +   E++E+       + ++ A+   V 
Sbjct: 130 EQIGRQLAAEHGFA---LIPPYDHPDVIAGQGTSAKELLEE-------VGQLDALF--VP 177

Query: 182 XXXXXXXXXXXXEKYNLADKIPIVGVETKGCHVFNTSLRMNKVVSFKKITSIATSLGTAD 241
                          +L+    I GVE +  +    S R   +V      +IA    T  
Sbjct: 178 LGGGGLLSGSALAARSLSPGCKIFGVEPEAGNDGQQSFRSGSIVHINTPKTIADGAQTQH 237

Query: 242 ISTEAFKYAKRYGTKSVVLSDQDVVKTCLRYTHD-FNMVIEP-AC-GAAVHLAYHTEILE 298
           +    F   +      + +SDQ++VK C+ +  +   +V+EP AC G A  L    E++ 
Sbjct: 238 LGEYTFAIIRENVDDILTVSDQELVK-CMHFLAERMKVVVEPTACLGFAGALLKKEELVG 296

Query: 299 KELGTKLNADDI 310
           K++G  L+  ++
Sbjct: 297 KKVGIILSGGNV 308

>KAFR0K01700 Chr11 (352943..354682) [1740 bp, 579 aa] {ON} Anc_7.367
           YER086W
          Length = 579

 Score = 63.5 bits (153), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 61/267 (22%), Positives = 106/267 (39%), Gaps = 20/267 (7%)

Query: 22  LKHECFQPSGSFKSRGIGHLISKQSQRILGNGLGKKPMVFXXXXXXXXXXXXXXXKFLNL 81
           LK E   P  SFK RG  ++I+K    +   G      V                K L +
Sbjct: 100 LKREDLLPVFSFKLRGAYNMIAKLDDNVRNQG------VIACSAGNHAQGVAYAAKKLGI 153

Query: 82  PCTVVIPTATKQRMADKIRATGANVIVSGNFWKEADNYLKDNILSKLEELHKNVEPIYVH 141
           P T+V+P +T       +   G+ V++ GN + EA         ++  +L +      + 
Sbjct: 154 PATIVMPVSTPSIKYQNVSRLGSQVVLYGNDFDEAK--------AECAKLSEERGLTNIP 205

Query: 142 PFDNPDIWEGHASMVDEIVEDFKNKMIPLNKIKAIVCSVXXXXXXXXXXXXXEKYNLADK 201
           PFD+P +  G  ++  EI+    N     NKI A+   V             ++  +A  
Sbjct: 206 PFDHPYVIAGQGTVAMEILRQVHNA----NKINAVFVPVGGGGLIAGVGAYLKR--IAPH 259

Query: 202 IPIVGVETKGCHVFNTSLRMNKVVSFKKITSIATSLGTADISTEAFKYAKRYGTKSVVLS 261
           I ++GVET      +TSL+  K     K+ + A       I  E F+ A+    + V+++
Sbjct: 260 IKVIGVETYDATTLHTSLQNGKRTELTKVGTFADGTSVRLIGEETFRVAQEVVDEIVLVN 319

Query: 262 DQDVVKTCLRYTHDFNMVIEPACGAAV 288
             ++         D   ++EP+   +V
Sbjct: 320 TDELCAAIKDVFEDTRSILEPSGALSV 346

>ZYRO0B02772g Chr2 (224426..226135) [1710 bp, 569 aa] {ON} highly
           similar to uniprot|P00927 Saccharomyces cerevisiae
           YER086W ILV1 Threonine deaminase catalyzes the first
           step in isoleucine biosynthesis expression is under
           general amino acid control ILV1 locus exhibits highly
           positioned nucleosomes whose organization is independent
           of known ILV1 regulation
          Length = 569

 Score = 63.5 bits (153), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 60/267 (22%), Positives = 106/267 (39%), Gaps = 20/267 (7%)

Query: 22  LKHECFQPSGSFKSRGIGHLISKQSQRILGNGLGKKPMVFXXXXXXXXXXXXXXXKFLNL 81
           LK E   P  SFK RG  ++I+K  +     G      V                + +N+
Sbjct: 90  LKREDLLPVFSFKLRGAYNMIAKLDENQKNQG------VIACSAGNHAQGVAYAARHMNI 143

Query: 82  PCTVVIPTATKQRMADKIRATGANVIVSGNFWKEADNYLKDNILSKLEELHKNVEPIYVH 141
           P T+V+P +T       +   G+ V++ GN + EA         ++  +L +      + 
Sbjct: 144 PATIVMPVSTPSIKYQNVSRLGSQVVLYGNDFDEAK--------AECAKLAEERGLTNIP 195

Query: 142 PFDNPDIWEGHASMVDEIVEDFKNKMIPLNKIKAIVCSVXXXXXXXXXXXXXEKYNLADK 201
           PFD+P +  G  ++  EI+    N +    KI A+   V             ++  +A  
Sbjct: 196 PFDHPYVIAGQGTVAMEILRQVHNSL----KIGAVFVPVGGGGLIAGIGAYLKR--IAPH 249

Query: 202 IPIVGVETKGCHVFNTSLRMNKVVSFKKITSIATSLGTADISTEAFKYAKRYGTKSVVLS 261
           I IVGVET      + S++  K    K + S A       I  E F+ ++    + V+++
Sbjct: 250 IKIVGVETHDAPTLSASMKTGKRELLKTVGSFADGTSVRIIGEETFRVSQEVVDEIVLVN 309

Query: 262 DQDVVKTCLRYTHDFNMVIEPACGAAV 288
             ++         D   +IEP+   +V
Sbjct: 310 TDEICAAVKDIFEDTRSIIEPSGALSV 336

>Suva_5.199 Chr5 (303073..304803) [1731 bp, 576 aa] {ON} YER086W
           (REAL)
          Length = 576

 Score = 63.2 bits (152), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 61/269 (22%), Positives = 108/269 (40%), Gaps = 24/269 (8%)

Query: 22  LKHECFQPSGSFKSRGIGHLISK--QSQRILGNGLGKKPMVFXXXXXXXXXXXXXXXKFL 79
           LK E   P  SFK RG  ++I+K   SQR  G        V                K L
Sbjct: 97  LKREDLLPVFSFKLRGAYNMIAKLDDSQRNQG--------VIACSAGNHAQGVAFAAKHL 148

Query: 80  NLPCTVVIPTATKQRMADKIRATGANVIVSGNFWKEADNYLKDNILSKLEELHKNVEPIY 139
            +P T+V+P  T       +   G+ V++ GN + EA         ++  +L +      
Sbjct: 149 KIPATIVMPVCTPSIKYQNVSRLGSQVVLFGNDFDEAK--------AECTKLAEERGLTN 200

Query: 140 VHPFDNPDIWEGHASMVDEIVEDFKNKMIPLNKIKAIVCSVXXXXXXXXXXXXXEKYNLA 199
           + PFD+P +  G  ++  EI+   +     +NKI A+   V             ++  +A
Sbjct: 201 IPPFDHPYVIAGQGTVAMEILRQVRT----VNKIGAVFVPVGGGGLIAGIGAYLKR--IA 254

Query: 200 DKIPIVGVETKGCHVFNTSLRMNKVVSFKKITSIATSLGTADISTEAFKYAKRYGTKSVV 259
             I ++GVET      + SL+ N+      + + A       I  E F+ A++   + V+
Sbjct: 255 PHIKVIGVETYDAATLHNSLQRNQRTPLPAVGTFADGTSVRMIGEETFRVAQQVVDEVVL 314

Query: 260 LSDQDVVKTCLRYTHDFNMVIEPACGAAV 288
           ++  ++         D   ++EP+   +V
Sbjct: 315 VNTDEICAAVKDVFEDTRSIVEPSGALSV 343

>YER086W Chr5 (328477..330207) [1731 bp, 576 aa] {ON}  ILV1Threonine
           deaminase, catalyzes the first step in isoleucine
           biosynthesis; expression is under general amino acid
           control; ILV1 locus exhibits highly positioned
           nucleosomes whose organization is independent of known
           ILV1 regulation
          Length = 576

 Score = 62.8 bits (151), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 62/269 (23%), Positives = 107/269 (39%), Gaps = 24/269 (8%)

Query: 22  LKHECFQPSGSFKSRGIGHLISK--QSQRILGNGLGKKPMVFXXXXXXXXXXXXXXXKFL 79
           LK E   P  SFK RG  ++I+K   SQR  G        V                K L
Sbjct: 97  LKREDLLPVFSFKLRGAYNMIAKLDDSQRNQG--------VIACSAGNHAQGVAFAAKHL 148

Query: 80  NLPCTVVIPTATKQRMADKIRATGANVIVSGNFWKEADNYLKDNILSKLEELHKNVEPIY 139
            +P T+V+P  T       +   G+ V++ GN + EA         ++  +L +      
Sbjct: 149 KIPATIVMPVCTPSIKYQNVSRLGSQVVLYGNDFDEAK--------AECAKLAEERGLTN 200

Query: 140 VHPFDNPDIWEGHASMVDEIVEDFKNKMIPLNKIKAIVCSVXXXXXXXXXXXXXEKYNLA 199
           + PFD+P +  G  ++  EI+   +      NKI A+   V             ++  +A
Sbjct: 201 IPPFDHPYVIAGQGTVAMEILRQVRTA----NKIGAVFVPVGGGGLIAGIGAYLKR--VA 254

Query: 200 DKIPIVGVETKGCHVFNTSLRMNKVVSFKKITSIATSLGTADISTEAFKYAKRYGTKSVV 259
             I I+GVET      + SL+ N+      + + A       I  E F+ A++   + V+
Sbjct: 255 PHIKIIGVETYDAATLHNSLQRNQRTPLPVVGTFADGTSVRMIGEETFRVAQQVVDEVVL 314

Query: 260 LSDQDVVKTCLRYTHDFNMVIEPACGAAV 288
           ++  ++         D   ++EP+   +V
Sbjct: 315 VNTDEICAAVKDIFEDTRSIVEPSGALSV 343

>Skud_5.205 Chr5 (322688..324418) [1731 bp, 576 aa] {ON} YER086W
           (REAL)
          Length = 576

 Score = 62.4 bits (150), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 62/269 (23%), Positives = 107/269 (39%), Gaps = 24/269 (8%)

Query: 22  LKHECFQPSGSFKSRGIGHLISK--QSQRILGNGLGKKPMVFXXXXXXXXXXXXXXXKFL 79
           LK E   P  SFK RG  ++I+K   SQR  G        V                K L
Sbjct: 97  LKREDLLPVFSFKLRGAYNMIAKLDDSQRNQG--------VIACSAGNHAQGVAFAAKHL 148

Query: 80  NLPCTVVIPTATKQRMADKIRATGANVIVSGNFWKEADNYLKDNILSKLEELHKNVEPIY 139
            +P T+V+P  T       +   G+ V++ GN + EA         ++  +L +      
Sbjct: 149 KIPATIVMPVCTPSIKYQNVSRLGSQVVLYGNDFDEAK--------AECAKLAEERGLTN 200

Query: 140 VHPFDNPDIWEGHASMVDEIVEDFKNKMIPLNKIKAIVCSVXXXXXXXXXXXXXEKYNLA 199
           + PFD+P +  G  ++  EI+   +      NKI A+   V             ++  +A
Sbjct: 201 IPPFDHPYVIAGQGTVAMEILRQVRTA----NKIGAVFVPVGGGGLIAGIGAYLKR--VA 254

Query: 200 DKIPIVGVETKGCHVFNTSLRMNKVVSFKKITSIATSLGTADISTEAFKYAKRYGTKSVV 259
             I ++GVET      + SL+ N+      + S A       I  E F+ A++   + V+
Sbjct: 255 PHIKVIGVETFDAPTLHNSLQRNQRTPLPVVGSFADGTSVRMIGEETFRVAQQVVDEVVL 314

Query: 260 LSDQDVVKTCLRYTHDFNMVIEPACGAAV 288
           ++  ++         D   ++EP+   +V
Sbjct: 315 VNTDEICAAVKDVFEDTRSIVEPSGALSV 343

>TBLA0C05070 Chr3 (1230732..1232459) [1728 bp, 575 aa] {ON}
           Anc_7.367 YER086W
          Length = 575

 Score = 62.0 bits (149), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 69/291 (23%), Positives = 118/291 (40%), Gaps = 27/291 (9%)

Query: 3   VYNKTPLIRQIFPSI---PQMYLKHECFQPSGSFKSRGIGHLISK--QSQRILGNGLGKK 57
           V N++P+ + I  S     Q+ LK E   P  SFK RG  ++++K  ++QR  G      
Sbjct: 69  VINESPMTKGIGLSSKLNSQIQLKREDLLPVFSFKMRGAYNMVAKLDETQRKQG------ 122

Query: 58  PMVFXXXXXXXXXXXXXXXKFLNLPCTVVIPTATKQRMADKIRATGANVIVSGNFWKEAD 117
             V                K L +P T+V+P +T     + +   G+ V++ GN +    
Sbjct: 123 --VIACSAGNHAQGVAYAAKHLGIPATIVMPVSTPSIKYENVSRLGSQVVLYGNDF---- 176

Query: 118 NYLKDNILSKLEELHKNVEPIYVHPFDNPDIWEGHASMVDEIVEDFKNKMIPLNKIKAIV 177
               D+   + E L +    + + PFD+P +  G  ++  EI+   KN      KI A+ 
Sbjct: 177 ----DSSKGECERLCEERGLVNIPPFDHPYVIAGQGTVAMEILRQVKNSA----KIGAVF 228

Query: 178 CSVXXXXXXXXXXXXXEKYNLADKIPIVGVETKGCHVFNTSLRMNKVVSFKKITSIATSL 237
             V             ++  +A  I IVGVET       TSL   K      + + A   
Sbjct: 229 VPVGGGGLVAGIGAYLKR--IAPHIKIVGVETYDAATLKTSLDNGKRTELNTVGTFADGT 286

Query: 238 GTADISTEAFKYAKRYGTKSVVLSDQDVVKTCLRYTHDFNMVIEPACGAAV 288
               I  E F+ +K    + V+++  ++         D   ++EP+   +V
Sbjct: 287 AVKMIGEETFRVSKDVVDEIVLVNTDELCAAVKDIFEDTRSIVEPSGALSV 337

>Smik_5.225 Chr5 (337064..338794) [1731 bp, 576 aa] {ON} YER086W
           (REAL)
          Length = 576

 Score = 62.0 bits (149), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 61/269 (22%), Positives = 107/269 (39%), Gaps = 24/269 (8%)

Query: 22  LKHECFQPSGSFKSRGIGHLISK--QSQRILGNGLGKKPMVFXXXXXXXXXXXXXXXKFL 79
           LK E   P  SFK RG  ++I+K   SQR  G        V                K L
Sbjct: 97  LKREDLLPVFSFKLRGAYNMIAKLDDSQRNQG--------VIACSAGNHAQGVAFAAKHL 148

Query: 80  NLPCTVVIPTATKQRMADKIRATGANVIVSGNFWKEADNYLKDNILSKLEELHKNVEPIY 139
            +P T+V+P  T       +   G+ V++ GN + EA         ++  +L +      
Sbjct: 149 KIPATIVMPVCTPSIKYQNVSRLGSQVVLYGNDFDEAK--------AECAKLAEERGLTN 200

Query: 140 VHPFDNPDIWEGHASMVDEIVEDFKNKMIPLNKIKAIVCSVXXXXXXXXXXXXXEKYNLA 199
           + PFD+P +  G  ++  EI+   +      NKI A+   V             ++  +A
Sbjct: 201 IPPFDHPYVIAGQGTVAMEILRQVRTA----NKIGAVFVPVGGGGLIAGIGAYLKR--VA 254

Query: 200 DKIPIVGVETKGCHVFNTSLRMNKVVSFKKITSIATSLGTADISTEAFKYAKRYGTKSVV 259
             I ++GVET      + SL+ N+      + + A       I  E F+ A++   + V+
Sbjct: 255 PHIKVIGVETYDAATLHNSLQRNQRTPLPVVGTFADGTSVRMIGEETFRVAQQVVDEVVL 314

Query: 260 LSDQDVVKTCLRYTHDFNMVIEPACGAAV 288
           ++  ++         D   ++EP+   +V
Sbjct: 315 VNTDEICAAVKDIFEDTRSIVEPSGALSV 343

>ACR232C Chr3 complement(767330..769012) [1683 bp, 560 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YER086W
           (ILV1)
          Length = 560

 Score = 61.2 bits (147), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 59/267 (22%), Positives = 106/267 (39%), Gaps = 20/267 (7%)

Query: 22  LKHECFQPSGSFKSRGIGHLISKQSQRILGNGLGKKPMVFXXXXXXXXXXXXXXXKFLNL 81
           LK E   P  SFK RG  ++IS   +        K   V                + L +
Sbjct: 82  LKREDLLPVFSFKLRGAYNMISNLDE------YQKSAGVIACSAGNHAQGVAFSARELGI 135

Query: 82  PCTVVIPTATKQRMADKIRATGANVIVSGNFWKEADNYLKDNILSKLEELHKNVEPIYVH 141
              +V+PT+T     + + A GA V++ G  + EA         ++L +LHK  +   + 
Sbjct: 136 RAMIVMPTSTPSIKYNSVAAMGAEVVLYGKDFDEAKAEC-----ARLAQLHKLTD---IP 187

Query: 142 PFDNPDIWEGHASMVDEIVEDFKNKMIPLNKIKAIVCSVXXXXXXXXXXXXXEKYNLADK 201
           PFD+P +  G  ++  EI+    N     ++I A+ C V             ++  +A  
Sbjct: 188 PFDHPYVIAGQGTIATEILRQVHNA----SQIGAVFCGVGGGGLIAGIGSYLKR--IAPH 241

Query: 202 IPIVGVETKGCHVFNTSLRMNKVVSFKKITSIATSLGTADISTEAFKYAKRYGTKSVVLS 261
           I I+GVET      +T+L+  +      +   A       +  E F+ A+    + V+++
Sbjct: 242 IKIIGVETHDAPTLHTALKQGRRTMLPAVGCFADGTSVRMMGEETFRVARDVVDEVVLVN 301

Query: 262 DQDVVKTCLRYTHDFNMVIEPACGAAV 288
             ++         D   ++EP+    V
Sbjct: 302 TDELCAAIKDIFEDTRAIVEPSGALGV 328

>NDAI0A01810 Chr1 complement(400890..402602) [1713 bp, 570 aa] {ON}
           Anc_7.367
          Length = 570

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 64/269 (23%), Positives = 106/269 (39%), Gaps = 24/269 (8%)

Query: 22  LKHECFQPSGSFKSRGIGHLISK--QSQRILGNGLGKKPMVFXXXXXXXXXXXXXXXKFL 79
           LK E   P  SFK RG  ++I+K   SQR  G        V                K L
Sbjct: 91  LKREDLLPVFSFKLRGAYNMIAKLDDSQRNQG--------VIACSAGNHAQGVAFAAKHL 142

Query: 80  NLPCTVVIPTATKQRMADKIRATGANVIVSGNFWKEADNYLKDNILSKLEELHKNVEPIY 139
           N+P T+V+P +T       +   G+ V++ GN + EA         ++  +L +      
Sbjct: 143 NIPATIVMPVSTPSIKYQNVSRLGSQVVLYGNDFDEAK--------AECTKLAEERGLTN 194

Query: 140 VHPFDNPDIWEGHASMVDEIVEDFKNKMIPLNKIKAIVCSVXXXXXXXXXXXXXEKYNLA 199
           + PFD+P +  G  ++  EI+    N     NKI A+   V             ++  +A
Sbjct: 195 IPPFDHPYVIAGQGTVAMEILRQVHNA----NKIGAVFVPVGGGGLVAGVGAYLKR--IA 248

Query: 200 DKIPIVGVETKGCHVFNTSLRMNKVVSFKKITSIATSLGTADISTEAFKYAKRYGTKSVV 259
             I I+GVET       TSL+  +      +   A       I  E F+ A+    + V+
Sbjct: 249 PHIKIIGVETHDAATLQTSLKHGRRTPLSVVGPFADGTSVRLIGEETFRVAQEVVDEVVL 308

Query: 260 LSDQDVVKTCLRYTHDFNMVIEPACGAAV 288
           ++  ++         D   ++EP+   +V
Sbjct: 309 VNTDEICAAVKDVFEDTRSIVEPSGALSV 337

>KLLA0E19779g Chr5 complement(1760800..1762503) [1704 bp, 567 aa]
           {ON} highly similar to uniprot|P00927 Saccharomyces
           cerevisiae YER086W ILV1 Threonine deaminase catalyzes
           the first step in isoleucine biosynthesis expression is
           under general amino acid control ILV1 locus exhibits
           highly positioned nucleosomes whose organization is
           independent of known ILV1 regulation
          Length = 567

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 60/271 (22%), Positives = 108/271 (39%), Gaps = 28/271 (10%)

Query: 22  LKHECFQPSGSFKSRGIGHLISK--QSQRILGNGLGKKPMVFXXXXXXXXXXXXXXXKFL 79
           LK E   P  SFK RG  ++I+K  ++Q+  G        V                  +
Sbjct: 88  LKREDLLPVFSFKLRGAYNMIAKLDETQKNAG--------VIACSAGNHAQGVAFSSNHM 139

Query: 80  NLPCTVVIPTATKQRMADKIRATGANVIVSGNFWKEADNYLKDNILSKLE--ELHKNVEP 137
           N+P T+V+P +T       +   GA V++ G+ + EA          KLE   L +    
Sbjct: 140 NIPATIVMPVSTPSIKYQNVSRLGAQVVLYGDDFDEA----------KLECARLAEERGM 189

Query: 138 IYVHPFDNPDIWEGHASMVDEIVEDFKNKMIPLNKIKAIVCSVXXXXXXXXXXXXXEKYN 197
             + PFD+P +  G  ++  EI+   +N     + I A+ C+V             ++  
Sbjct: 190 TDIPPFDHPYVIAGQGTIAMEILRQVQNG----SNIGAVFCAVGGGGLISGIGSYLKR-- 243

Query: 198 LADKIPIVGVETKGCHVFNTSLRMNKVVSFKKITSIATSLGTADISTEAFKYAKRYGTKS 257
           +A  I ++GVET      + SL+  K      + + A       I  E F+  +    + 
Sbjct: 244 IAPHIKVIGVETYDAATLDVSLKNGKRTPLPSVGTFADGTSVRLIGEETFRVCQDVVDEV 303

Query: 258 VVLSDQDVVKTCLRYTHDFNMVIEPACGAAV 288
           ++++  ++         D   ++EP+   AV
Sbjct: 304 ILVNTDEICAAVKDVFEDTRSIVEPSGALAV 334

>TDEL0C01800 Chr3 complement(313699..315408) [1710 bp, 569 aa] {ON}
           Anc_7.367 YER086W
          Length = 569

 Score = 60.5 bits (145), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 61/269 (22%), Positives = 105/269 (39%), Gaps = 24/269 (8%)

Query: 22  LKHECFQPSGSFKSRGIGHLISK--QSQRILGNGLGKKPMVFXXXXXXXXXXXXXXXKFL 79
           LK E   P  SFK RG  ++I+K   SQ+  G        V                K +
Sbjct: 90  LKREDLLPVFSFKLRGAYNMIAKLDDSQKNQG--------VIACSAGNHAQGVAFAAKHM 141

Query: 80  NLPCTVVIPTATKQRMADKIRATGANVIVSGNFWKEADNYLKDNILSKLEELHKNVEPIY 139
           ++P T+V+P +T       +   G+ V++ GN + EA         ++   L +      
Sbjct: 142 SIPATIVMPVSTPSIKYQNVSRLGSQVVLYGNDFDEAK--------AECTRLSEERGLTN 193

Query: 140 VHPFDNPDIWEGHASMVDEIVEDFKNKMIPLNKIKAIVCSVXXXXXXXXXXXXXEKYNLA 199
           + PFD+P +  G  ++  EI+   +N      KI A+                 ++  +A
Sbjct: 194 IPPFDHPYVIAGQGTVAMEILRQVRNSA----KIGAVFVPCGGGGLVAGIGAYLKR--IA 247

Query: 200 DKIPIVGVETKGCHVFNTSLRMNKVVSFKKITSIATSLGTADISTEAFKYAKRYGTKSVV 259
             I I+GVET      +TSL+  K      + + A       I  E F+ A+    + V+
Sbjct: 248 PHIKIIGVETFDSATLHTSLKNGKRTPLASVGTFADGTSVRMIGEETFRIAQDVVDEVVL 307

Query: 260 LSDQDVVKTCLRYTHDFNMVIEPACGAAV 288
           +   ++         D   ++EP+   AV
Sbjct: 308 VGTDEICAAIKDIFEDTRGIVEPSGALAV 336

>SAKL0A10626g Chr1 complement(932879..933841) [963 bp, 320 aa] {ON}
           similar to uniprot|P36007 Saccharomyces cerevisiae
           YKL218C SRY1 3-hydroxyaspartate dehydratase deaminates
           L- threo-3-hydroxyaspartate to form oxaloacetate and
           ammonia required for survival in the presence of
           hydroxyaspartate
          Length = 320

 Score = 59.3 bits (142), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 73/316 (23%), Positives = 130/316 (41%), Gaps = 38/316 (12%)

Query: 5   NKTPLI--RQIFPSI-PQMYLKHECFQPSGSFKSRGIGHLISK--QSQRILGNGLGKKPM 59
           NKTP++  R +   +  ++Y K E FQ  G+FK RG  + + K  Q QR  G        
Sbjct: 21  NKTPVLTSRTVNAELGAEVYFKCENFQRIGAFKFRGAMNTLLKLTQEQRAAG-------- 72

Query: 60  VFXXXXXXXXXXXXXXXKFLNLPCTVVIPTATKQRMADKIRAT---GANVIVSGNFWKEA 116
           V                K L +P T+V+P       A K+RAT   GAN++    + ++ 
Sbjct: 73  VVAFSSGNHAQAIALSAKLLGVPATIVMPNDAP---AAKVRATAGYGANIVRYDRYTED- 128

Query: 117 DNYLKDNILSKLEELHKNVEPIYVHPFDNPDIWEGHASMVDEIVEDFKNKMIPLNKIKAI 176
               ++ I   L E  K +    V P+D+PD+  G  +   E++E+       + ++  +
Sbjct: 129 ----REQIGRALAE-EKGL--TLVPPYDHPDVIAGQGTAAKELIEE-------VGELDLL 174

Query: 177 VCSVXXXXXXXXXXXXXEKYNLADKIPIVGVETKGCHVFNTSLRMNKVVSFKKITSIATS 236
              +             ++  L+ +  I+GVE +  +    SLR   +V      +IA  
Sbjct: 175 FVPLGGGGLLSGSALAAKR--LSPRCEIIGVEPEAGNDGQQSLRSGSIVHIDTPETIADG 232

Query: 237 LGTADISTEAFKYAKRYGTKSVVLSDQDVVKTCLRYTHDFNMVIEP-AC-GAAVHLAYHT 294
             T  +    F+         +  SD ++V +   +     +V+EP  C G A   A   
Sbjct: 233 AQTQHLGQYTFEVIHANVADILTASDAELVDSMRFFAERMKIVVEPTGCLGFAAARAQKA 292

Query: 295 EILEKELGTKLNADDI 310
           ++  K +G  ++  +I
Sbjct: 293 KLAGKRVGIIVSGGNI 308

>Kpol_530.16 s530 complement(41170..42870) [1701 bp, 566 aa] {ON}
           complement(41170..42870) [1701 nt, 567 aa]
          Length = 566

 Score = 59.7 bits (143), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 62/269 (23%), Positives = 106/269 (39%), Gaps = 24/269 (8%)

Query: 22  LKHECFQPSGSFKSRGIGHLISK--QSQRILGNGLGKKPMVFXXXXXXXXXXXXXXXKFL 79
           LK E   P  SFK RG  ++++K   SQ+  G        V                K L
Sbjct: 87  LKREDLLPVFSFKLRGAYNMMAKLDDSQKNQG--------VIACSAGNHAQGIAYAAKHL 138

Query: 80  NLPCTVVIPTATKQRMADKIRATGANVIVSGNFWKEADNYLKDNILSKLEELHKNVEPIY 139
           N+P T+V+P +T       +   G+ V++ GN + EA         ++   L +      
Sbjct: 139 NIPATIVMPVSTPSIKYQNVSRLGSQVVLYGNDFDEAK--------AECARLAEERGLTN 190

Query: 140 VHPFDNPDIWEGHASMVDEIVEDFKNKMIPLNKIKAIVCSVXXXXXXXXXXXXXEKYNLA 199
           + PFD+P +  G  ++  EI+          NKI A+   V             ++  +A
Sbjct: 191 IPPFDHPYVIAGQGTVAMEILRQVHKA----NKIGAVFVPVGGGGLIAGVGAYLKR--IA 244

Query: 200 DKIPIVGVETKGCHVFNTSLRMNKVVSFKKITSIATSLGTADISTEAFKYAKRYGTKSVV 259
             I I+GVET   +   TSL+  K V    + + A       I  E F+  +    + V+
Sbjct: 245 PHIKIIGVETFDANCLYTSLQSGKRVPLSSVGTFADGTAVRLIGEETFRVCQEVVDEVVL 304

Query: 260 LSDQDVVKTCLRYTHDFNMVIEPACGAAV 288
           ++  ++         D   ++EP+   +V
Sbjct: 305 VNTDEICAAVKDVFEDTRSIVEPSGALSV 333

>Skud_11.2 Chr11 complement(1812..2792) [981 bp, 326 aa] {ON}
           YKL218C (REAL)
          Length = 326

 Score = 56.6 bits (135), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 65/312 (20%), Positives = 131/312 (41%), Gaps = 30/312 (9%)

Query: 5   NKTPLI--RQIFPSI-PQMYLKHECFQPSGSFKSRGIGHLISKQSQRILGNGLGKKPMVF 61
           NKTP++  R +   +  ++Y K E +Q  G+FK RG  + +SK S +       +K  V 
Sbjct: 21  NKTPVLTSRTLNDRLEAEVYFKGENYQRVGAFKFRGAMNAVSKLSDK------ERKKGVI 74

Query: 62  XXXXXXXXXXXXXXXKFLNLPCTVVIPTATKQRMADKIRATGANVIVSGNFWKEADNYLK 121
                          K  N+P T+++P              GA++I    + ++     +
Sbjct: 75  AFSSGNHAQAIALSAKLFNVPATIIMPEDAPALKVAATAGYGAHIIKYNRYTED-----R 129

Query: 122 DNILSKLEELHKNVEPIYVHPFDNPDIWEGHASMVDEIVEDFKNKMIPLNKIKAIVCSVX 181
           ++I  +L   H  V    + P+D+PD+  G  +   E+ E+       + ++ A+   V 
Sbjct: 130 EHIGRQLAAKHGYV---LIPPYDHPDVIAGQGTSAKELFEE-------VGELDALF--VP 177

Query: 182 XXXXXXXXXXXXEKYNLADKIPIVGVETKGCHVFNTSLRMNKVVSFKKITSIATSLGTAD 241
                          +L+    + GVE +  +    S +   +V     ++IA    T  
Sbjct: 178 LGGGGLLSGSALAARSLSPGCKVFGVEPEAGNDGQQSFKSGSIVHIDTPSTIADGAQTQH 237

Query: 242 ISTEAFKYAKRYGTKSVVLSDQDVVKTCLRYTHD-FNMVIEP-AC-GAAVHLAYHTEILE 298
           +    +   +      + +SD+++V+ C+ +  +   +V+EP AC G A  L    E++ 
Sbjct: 238 LGEYTYAVIRENVDDILTVSDEELVE-CMHFLAERMKLVVEPTACLGFAGALLKKRELVG 296

Query: 299 KELGTKLNADDI 310
           K++G  L+  ++
Sbjct: 297 KKVGIILSGGNV 308

>TPHA0F03130 Chr6 complement(685292..686998) [1707 bp, 568 aa] {ON}
           Anc_7.367 YER086W
          Length = 568

 Score = 56.6 bits (135), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 58/267 (21%), Positives = 103/267 (38%), Gaps = 20/267 (7%)

Query: 22  LKHECFQPSGSFKSRGIGHLISKQSQRILGNGLGKKPMVFXXXXXXXXXXXXXXXKFLNL 81
           LK +   P  SFK RG  ++++K        G      V                K L +
Sbjct: 89  LKRDDLLPVFSFKLRGAYNMMAKLDDTQKNQG------VIACSAGNHAQGVAYAAKHLKI 142

Query: 82  PCTVVIPTATKQRMADKIRATGANVIVSGNFWKEADNYLKDNILSKLEELHKNVEPIYVH 141
           P T+V+P +T       +   G+ V++ GN + EA         ++   L +      + 
Sbjct: 143 PATIVMPVSTPSIKYQNVSRLGSQVVLYGNDFDEAK--------AECARLAEERGLTNIP 194

Query: 142 PFDNPDIWEGHASMVDEIVEDFKNKMIPLNKIKAIVCSVXXXXXXXXXXXXXEKYNLADK 201
           PFD+P +  G  ++  EI+          +KI A+   V             ++  +A  
Sbjct: 195 PFDHPYVIAGQGTVAMEILRQVHMS----SKIGAVFVPVGGGGLIAGVGTYLKR--IAPH 248

Query: 202 IPIVGVETKGCHVFNTSLRMNKVVSFKKITSIATSLGTADISTEAFKYAKRYGTKSVVLS 261
           I I+GVET       TSL+  K  + + + S A       +  E F+ A+    + V+++
Sbjct: 249 IKIIGVETYDACALYTSLQSGKRAALESVGSFADGTAVRLLGEETFRVAQEVVDEVVLVN 308

Query: 262 DQDVVKTCLRYTHDFNMVIEPACGAAV 288
             ++         D   ++EP+   AV
Sbjct: 309 TDEICAGIKDIFEDTRSIVEPSGALAV 335

>KNAG0C03690 Chr3 complement(722238..723971) [1734 bp, 577 aa] {ON}
           Anc_7.367 YER086W
          Length = 577

 Score = 55.5 bits (132), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 60/267 (22%), Positives = 106/267 (39%), Gaps = 20/267 (7%)

Query: 22  LKHECFQPSGSFKSRGIGHLISKQSQRILGNGLGKKPMVFXXXXXXXXXXXXXXXKFLNL 81
           LK E   P  SFK RG  ++++K        G      V                K L++
Sbjct: 98  LKREDLLPVFSFKLRGAYNMMAKLDDTQKNQG------VIACSAGNHAQGVAFAAKHLDI 151

Query: 82  PCTVVIPTATKQRMADKIRATGANVIVSGNFWKEADNYLKDNILSKLEELHKNVEPIYVH 141
           P T+V+P +T       +   G+ V++ GN + EA         ++  +L K      + 
Sbjct: 152 PATIVMPVSTPSIKYQNVSRLGSQVVLYGNDFDEAK--------AECTKLSKERGLTNIP 203

Query: 142 PFDNPDIWEGHASMVDEIVEDFKNKMIPLNKIKAIVCSVXXXXXXXXXXXXXEKYNLADK 201
           PFD+P +  G  ++  EI+     ++   NKI A+   V             ++  +A  
Sbjct: 204 PFDHPYVIAGQGTVAMEILR----QVHIANKIGAVFVPVGGGGLVAGVGAYLKR--IAPH 257

Query: 202 IPIVGVETKGCHVFNTSLRMNKVVSFKKITSIATSLGTADISTEAFKYAKRYGTKSVVLS 261
           I I+GVET       TSL+  +  S   + + A       I  E F+ ++    + V+++
Sbjct: 258 IKIIGVETFDASTLYTSLQRGRRTSLPSVGTFADGTSVKLIGEETFRISQDVVDEVVLVN 317

Query: 262 DQDVVKTCLRYTHDFNMVIEPACGAAV 288
             ++         D   ++EP+   AV
Sbjct: 318 TDEICAAVKDIFEDTRSIVEPSGALAV 344

>Kwal_33.14822 s33 complement(830029..831717) [1689 bp, 562 aa] {ON}
           YER086W (ILV1) - threonine deaminase [contig 101] FULL
          Length = 562

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 62/269 (23%), Positives = 102/269 (37%), Gaps = 24/269 (8%)

Query: 22  LKHECFQPSGSFKSRGIGHLISKQSQRILGNGLGKKPMVFXXXXXXXXXXXXXXXKFLNL 81
           LK E   P  SFK RG  ++++K     L  G G K  V                + LN+
Sbjct: 83  LKREDLLPVFSFKLRGAYNMMAK-----LAEGQGNKG-VIACSAGNHAQGVAFASRHLNI 136

Query: 82  PCTVVIPTATKQRMADKIRATGANVIVSGNFWKEADNYLKDNILSKLE--ELHKNVEPIY 139
           P  +V+P  T       +   G  V++ GN + EA          K+E   + +      
Sbjct: 137 PAIIVMPVNTPSIKYQNVSRLGGQVVLYGNDFDEA----------KIECARISEERGLTN 186

Query: 140 VHPFDNPDIWEGHASMVDEIVEDFKNKMIPLNKIKAIVCSVXXXXXXXXXXXXXEKYNLA 199
           + PFD+P +  G  ++  EI+    N     +KI A+   V             ++  +A
Sbjct: 187 IPPFDHPYVIAGQGTVAMEILRQVHNA----SKIGAVFVPVGGGGLVAGVAAYLKR--IA 240

Query: 200 DKIPIVGVETKGCHVFNTSLRMNKVVSFKKITSIATSLGTADISTEAFKYAKRYGTKSVV 259
             I IVGVET       TSL          + + A       I  E F+  + +  + V+
Sbjct: 241 PHIKIVGVETYDSATLKTSLDAGCRTPLTSVGTFADGTSVRMIGEETFRICEDFVDEVVL 300

Query: 260 LSDQDVVKTCLRYTHDFNMVIEPACGAAV 288
           ++  ++         D   ++EP+   AV
Sbjct: 301 VNTDEICAAVKDIFEDTRSIVEPSGALAV 329

>KLTH0B04884g Chr2 (400193..401914) [1722 bp, 573 aa] {ON} highly
           similar to uniprot|P00927 Saccharomyces cerevisiae
           YER086W ILV1 Threonine deaminase catalyzes the first
           step in isoleucine biosynthesis expression is under
           general amino acid control ILV1 locus exhibits highly
           positioned nucleosomes whose organization is independent
           of known ILV1 regulation
          Length = 573

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 56/267 (20%), Positives = 97/267 (36%), Gaps = 20/267 (7%)

Query: 22  LKHECFQPSGSFKSRGIGHLISKQSQRILGNGLGKKPMVFXXXXXXXXXXXXXXXKFLNL 81
           LK E   P  SFK RG  ++++K S+     G      V                + LN+
Sbjct: 94  LKREDLLPVFSFKLRGAYNMMAKLSEAQKNQG------VIACSAGNHAQGVAFASRHLNI 147

Query: 82  PCTVVIPTATKQRMADKIRATGANVIVSGNFWKEADNYLKDNILSKLEELHKNVEPIYVH 141
           P  +V+P  T       +   G  V++ GN + EA         ++   + +      + 
Sbjct: 148 PAIIVMPVNTPSIKYQNVSRLGGQVVLYGNDFDEAK--------TECTRISEERGLTNIP 199

Query: 142 PFDNPDIWEGHASMVDEIVEDFKNKMIPLNKIKAIVCSVXXXXXXXXXXXXXEKYNLADK 201
           PFD+P +  G  ++  EI+    N      KI A+   V             ++  +A  
Sbjct: 200 PFDHPYVIAGQGTVAMEILRQVHNAA----KIGAVFVPVGGGGLVAGVAAYLKR--IAPH 253

Query: 202 IPIVGVETKGCHVFNTSLRMNKVVSFKKITSIATSLGTADISTEAFKYAKRYGTKSVVLS 261
           I I+GVET       TSL          + + A       I  E F+  +      ++++
Sbjct: 254 IKIIGVETYDSATLKTSLEAGTRTPLSTVGTFADGTSVRMIGEETFRICQDLVDDVILVN 313

Query: 262 DQDVVKTCLRYTHDFNMVIEPACGAAV 288
             ++         D   ++EP+   AV
Sbjct: 314 TDEICAAVKDIFEDTRSIVEPSGALAV 340

>Smik_11.3 Chr11 complement(1725..2534) [810 bp, 269 aa] {ON}
           YKL218C (REAL)
          Length = 269

 Score = 36.6 bits (83), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 45/237 (18%), Positives = 97/237 (40%), Gaps = 21/237 (8%)

Query: 77  KFLNLPCTVVIPTATKQRMADKIRATGANVIVSGNFWKEADNYLKDNILSKLEELHKNVE 136
           K LN+P T+V+P              GA++     + ++     +D I  +L   H    
Sbjct: 33  KLLNVPATIVMPEDASTLKVAATTGYGAHITKYNRYTED-----RDKIGRQLAAKHGFA- 86

Query: 137 PIYVHPFDNPDIWEGHASMVDEIVEDFKNKMIPLNKIKAIVCSVXXXXXXXXXXXXXEKY 196
              + P+D+PD+  G ++   +++E+       + ++ A+   V                
Sbjct: 87  --LIPPYDHPDVIAGQSASAKKLLEE-------VGQLDALF--VLLGGGGLLSGSTLASR 135

Query: 197 NLADKIPIVGVETKGCHVFNTSLRMNKVVSFKKITSIATSLGTADISTEAFKYAKRYGTK 256
           +L+    I GVE +  +    S R   VV      +IA    T  +    F   +     
Sbjct: 136 SLSPDCKIFGVEPEAGNDGQQSFRSGSVVHIDTPNTIAGEAQTQHLGEYTFAIIRENVDD 195

Query: 257 SVVLSDQDVVKTCLRYTHD-FNMVIEP-AC-GAAVHLAYHTEILEKELGTKLNADDI 310
            + ++D  +++ C+ +  +   +V+ P AC G A  +    E++ +++G +L+  ++
Sbjct: 196 ILTVTDGKLIE-CMHFLAERMKLVVGPTACLGHAGAVLKKKELVGEKIGIRLSRGNV 251

>Kwal_23.3442 s23 (291852..296042) [4191 bp, 1396 aa] {ON} YDL112W
            (TRM3) - tRNA (Gm18) ribose methylase [contig 252] FULL
          Length = 1396

 Score = 34.7 bits (78), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 28/90 (31%), Positives = 41/90 (45%), Gaps = 14/90 (15%)

Query: 77   KFLNLPCTVVIPTATKQRMADKIRATGANVIVSGNFWKEADNYL-KDNILSKLEELHKNV 135
            +FL    + +IP  T  +    IR    ++++S  FW   + YL KD + S LE L K  
Sbjct: 1074 RFLQRFISKIIPNCTSNKPL--IRHFSNSLMLS--FWPSLEQYLAKDTLRSVLENLFKEA 1129

Query: 136  EPIYVHPFDNPDIWEGHASMVDEIVEDFKN 165
            + I VH         G   M D I+ D +N
Sbjct: 1130 QKIQVH---------GQYRMGDAIIWDLEN 1150

>CAGL0I05852g Chr9 complement(554011..555597) [1587 bp, 528 aa] {ON}
           similar to uniprot|P20438 Saccharomyces cerevisiae
           YPL256c CLN2 cyclin or uniprot|P20437 Saccharomyces
           cerevisiae YMR199w CLN1
          Length = 528

 Score = 32.3 bits (72), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 38/119 (31%), Positives = 51/119 (42%), Gaps = 21/119 (17%)

Query: 224 VVSFKKITSIATSLGTADISTEAFKYAKRYGTKSVVLSDQD--VVKTCLRYT-------- 273
           +V+F    S+ T + T  I  +A +   RY +K VVL DQ   VV TCL           
Sbjct: 74  IVTFLFELSVMTRV-TNGIFVQAVRLYDRYCSKRVVLKDQAKLVVATCLWLAAKTWGGCN 132

Query: 274 HDFNMVIEPACGAAVHLAYHTEILEKELGTKLNADDIVLVVACGGSSNTVEDMESILQR 332
           H  N VI P  G          I       +L+     LV+ CGGS+N  E M   ++R
Sbjct: 133 HIINNVIVPTGGRFYGPNPRARI------PRLSE----LVLYCGGSNNFDESMFLQMER 181

>NCAS0G01010 Chr7 complement(173895..175460) [1566 bp, 521 aa] {ON}
           Anc_6.293
          Length = 521

 Score = 31.6 bits (70), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 25/73 (34%), Positives = 36/73 (49%), Gaps = 11/73 (15%)

Query: 223 KVVSFKKITSIATSLGTADISTEAFKYAKRYGTKSVVLSDQD--VVKTCLRYT------- 273
           ++V+F    S+ T + T  I ++A +   RY +K VVL DQ   V+ TCL  T       
Sbjct: 74  QIVTFLYELSVMTRV-THGIFSQAVRLYDRYCSKRVVLKDQSKLVIATCLWLTAKTWGGC 132

Query: 274 -HDFNMVIEPACG 285
            H  N V+ P  G
Sbjct: 133 NHIINNVVIPTGG 145

>KNAG0C01250 Chr3 complement(241906..243654) [1749 bp, 582 aa] {ON}
           Anc_1.214 YKR056W
          Length = 582

 Score = 31.2 bits (69), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 18/82 (21%), Positives = 42/82 (51%), Gaps = 1/82 (1%)

Query: 273 THDFNMVIEPACGAAVHLAYHTEILEKELGTKLNADDIVLVVACGGSSNTVEDMESILQR 332
           +HD N +++  CG+ +     ++ + K +G +++AD +         +N VE+   I+ +
Sbjct: 429 SHDPNYLVDAYCGSGLFSVCSSKGVTKVIGVEISADSVSFAEK-NAKANNVENCRFIVGK 487

Query: 333 LSTEENNINIPNVAENIIVRMP 354
                 +I+IP+   ++I+  P
Sbjct: 488 AEKLFESIDIPSDRTSVILDPP 509

>KNAG0C01570 Chr3 (310309..312681) [2373 bp, 790 aa] {ON} Anc_1.285
           YJL082W
          Length = 790

 Score = 31.2 bits (69), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 19/69 (27%), Positives = 33/69 (47%), Gaps = 4/69 (5%)

Query: 253 YGTKSVVLSDQDVVKTCLRYTHDFNMVIEPA----CGAAVHLAYHTEILEKELGTKLNAD 308
           +G+K   LS +++ K  L+  HDF + ++         A    Y  E   K+L    NAD
Sbjct: 6   FGSKEPTLSREEMTKVVLKQAHDFEIALKAMDYVLDDRAEQGLYLLEQQRKQLTQDPNAD 65

Query: 309 DIVLVVACG 317
           + + ++A G
Sbjct: 66  ETINILARG 74

>TBLA0A00310 Chr1 complement(52232..54913) [2682 bp, 893 aa] {ON}
           Anc_8.81 YPL008W
          Length = 893

 Score = 30.8 bits (68), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 24/41 (58%), Gaps = 3/41 (7%)

Query: 117 DNYLKDNILSKLEELHKNVEPIYVHPFDNPDIWEGHASMVD 157
           DN+ K NI  K++   KN+ PI+    D PDI + + + V+
Sbjct: 706 DNWQKINIFDKID---KNIRPIFFETKDGPDILQDYITSVE 743

>NDAI0H01950 Chr8 complement(474375..476945) [2571 bp, 856 aa] {ON}
           Anc_7.21 YAL047C
          Length = 856

 Score = 30.4 bits (67), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 35/61 (57%), Gaps = 14/61 (22%)

Query: 121 KDNILSKLEELHKNVEPIYVHPFDNPDIWEGHASMVDEIVE-------DFKNKMIPLNKI 173
           KD++ S ++EL KN+E +    F+N DI    +S+V ++ E       DF N ++ LN +
Sbjct: 595 KDDLTSLIDELSKNIEHL---RFENDDI----SSLVKQLTEEKRNKDNDFSNLLVELNDM 647

Query: 174 K 174
           K
Sbjct: 648 K 648

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.134    0.389 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 35,272,836
Number of extensions: 1445540
Number of successful extensions: 4687
Number of sequences better than 10.0: 66
Number of HSP's gapped: 4674
Number of HSP's successfully gapped: 66
Length of query: 360
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 249
Effective length of database: 40,753,473
Effective search space: 10147614777
Effective search space used: 10147614777
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 66 (30.0 bits)