Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
CAGL0B00264g1.2ON21021010741e-151
CAGL0B01265g1.121ON1861749041e-125
Kpol_2002.31.2ON2232113413e-39
KAFR0D007201.121ON2061983124e-35
TPHA0E040701.2ON2312182962e-32
TPHA0E036101.121ON2312182962e-32
Suva_3.1471.2ON2102122924e-32
YCR039C (MATALPHA2)1.121ON2102122924e-32
YCL067C (HMLALPHA2)1.2ON2102122924e-32
Skud_3.1181.121ON2102122925e-32
NCAS0B091401.2ON2052062761e-29
NDAI0A001101.2ON2112142725e-29
Smik_3.1421.121ON2281882656e-28
Skud_102.1singletonON1851882618e-28
Smik_95.1singletonON1851882618e-28
Suva_3.135singletonON119972542e-27
Suva_3.74singletonON119972542e-27
Suva_3.751.121ON119972542e-27
YCR096C (HMRA2)singletonOFF119972542e-27
KNAG0C001601.2ON2031962602e-27
ZYRO0F15818g1.121ON2252112403e-24
ZYRO0F18568g1.2ON2252112403e-24
TBLA0A076001.2ON2302242333e-23
TBLA0A070501.121ON2612302336e-23
Ecym_11151.121ON230882178e-21
Ecym_10021.2ON230882178e-21
TDEL0C070001.2ON2371301741e-14
KLLA0C00374g1.2ON223691704e-14
Smik_6.3746.170ON294831401e-09
Skud_16.1036.170ON295681321e-08
YPL177C (CUP9)6.170ON306831312e-08
Suva_16.1326.170ON2921331312e-08
CAGL0H02959g6.170ON259641258e-08
Ecym_22476.170ON3491221251e-07
TDEL0F018106.170ON256681213e-07
AFL049C6.170ON257571213e-07
ZYRO0G22044g6.170ON201831193e-07
Kpol_1036.566.170ON265691204e-07
CAGL0C01551g6.170ON221631178e-07
NCAS0H011306.170ON280561188e-07
TBLA0C037406.170ON293811189e-07
KAFR0G036506.170ON177911151e-06
TPHA0B025806.170ON264701161e-06
KAFR0A043706.170ON409591162e-06
KLTH0H05236g6.170ON234991142e-06
Kwal_YGOB_matalpha21.121ON110451092e-06
Kwal_33.12995singletonOFF110451092e-06
Kwal_YGOB_HMalpha21.2ON110451092e-06
Kwal_33.matalpha2singletonOFF110451092e-06
YGL096W (TOS8)6.170ON276871142e-06
KNAG0M005006.170ON298601117e-06
NDAI0F021706.170ON383561118e-06
Smik_7.1816.170ON274871101e-05
KNAG0F022106.170ON324501091e-05
Skud_7.1816.170ON274741082e-05
KLTH0F00396g1.2ON108601013e-05
NCAS0D035706.170ON257521054e-05
NDAI0I013206.170ON409471054e-05
SAKL0A05610g6.170ON320601047e-05
Kwal_27.110926.170ON229601028e-05
Suva_7.1726.170ON270471011e-04
KLLA0B10450g6.170ON38952870.009
Skud_71.2singletonON4537710.12
NDAI0A006701.122ON9552661.4
NDAI0H00100na 1ON9552661.4
KLTH0G04884g5.576ON325494665.5
CAGL0H05291g8.537ON568112647.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0B00264g
         (210 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0B00264g Chr2 (11470..12102) [633 bp, 210 aa] {ON} highly si...   418   e-151
CAGL0B01265g Chr2 (113719..114279) [561 bp, 186 aa] {ON} similar...   352   e-125
Kpol_2002.3 s2002 (4682..5353) [672 bp, 223 aa] {ON} (4682..5353...   135   3e-39
KAFR0D00720 Chr4 (128684..129304) [621 bp, 206 aa] {ON}  mating ...   124   4e-35
TPHA0E04070 Chr5 complement(848980..849613,849670..849731) [696 ...   118   2e-32
TPHA0E03610 Chr5 complement(765003..765636,765693..765754) [696 ...   118   2e-32
Suva_3.147 Chr3 complement(221912..222544) [633 bp, 210 aa] {ON}...   117   4e-32
YCR039C Chr3 complement(199546..200178) [633 bp, 210 aa] {ON}  M...   117   4e-32
YCL067C Chr3 complement(12386..13018) [633 bp, 210 aa] {ON}  HML...   117   4e-32
Skud_3.118 Chr3 complement(184042..184674) [633 bp, 210 aa] {ON}...   117   5e-32
NCAS0B09140 Chr2 complement(1754708..1755325) [618 bp, 205 aa] {...   110   1e-29
NDAI0A00110 Chr1 (1584..2219) [636 bp, 211 aa] {ON} Anc_1.2  sil...   109   5e-29
Smik_3.142 Chr3 complement(197575..198261) [687 bp, 228 aa] {ON}...   106   6e-28
Skud_102.1 Chr102 (1..558) [558 bp, 185 aa] {ON} YCR039C (REAL)       105   8e-28
Smik_95.1 Chr95 (1..558) [558 bp, 185 aa] {ON} YCR039C (REAL)         105   8e-28
Suva_3.135 Chr3 complement(211196..211555) [360 bp, 119 aa] {ON}...   102   2e-27
Suva_3.74 Chr3 complement(112965..113324) [360 bp, 119 aa] {ON} ...   102   2e-27
Suva_3.75 Chr3 complement(112965..113324) [360 bp, 119 aa] {ON} ...   102   2e-27
YCR096C Chr3 complement(293179..293538) [360 bp, 119 aa] {OFF}  ...   102   2e-27
KNAG0C00160 Chr3 (25548..26159) [612 bp, 203 aa] {ON} Anc_1.2 YC...   104   2e-27
ZYRO0F15818g Chr6 complement(1302816..1303493) [678 bp, 225 aa] ...    97   3e-24
ZYRO0F18568g Chr6 complement(1532755..1533432) [678 bp, 225 aa] ...    97   3e-24
TBLA0A07600 Chr1 (1882710..1882771,1882865..1882958,1883018..188...    94   3e-23
TBLA0A07050 Chr1 (1728941..1729002,1729096..1729189,1729249..172...    94   6e-23
Ecym_1115 Chr1 (237261..237485,237542..238009) [693 bp, 230 aa] ...    88   8e-21
Ecym_1002 Chr1 complement(5334..5801,5858..6082) [693 bp, 230 aa...    88   8e-21
TDEL0C07000 Chr3 complement(1273613..1274326) [714 bp, 237 aa] {...    72   1e-14
KLLA0C00374g Chr3 (25132..25803) [672 bp, 223 aa] {ON} uniprot|Q...    70   4e-14
Smik_6.374 Chr6 (610093..610977) [885 bp, 294 aa] {ON} YPL177C (...    59   1e-09
Skud_16.103 Chr16 complement(185398..186285) [888 bp, 295 aa] {O...    55   1e-08
YPL177C Chr16 complement(213042..213962) [921 bp, 306 aa] {ON}  ...    55   2e-08
Suva_16.132 Chr16 complement(222346..223224) [879 bp, 292 aa] {O...    55   2e-08
CAGL0H02959g Chr8 (277540..278319) [780 bp, 259 aa] {ON} some si...    53   8e-08
Ecym_2247 Chr2 complement(486469..487518) [1050 bp, 349 aa] {ON}...    53   1e-07
TDEL0F01810 Chr6 complement(338066..338836) [771 bp, 256 aa] {ON...    51   3e-07
AFL049C Chr6 complement(346546..347319) [774 bp, 257 aa] {ON} Sy...    51   3e-07
ZYRO0G22044g Chr7 (1814345..1814950) [606 bp, 201 aa] {ON} some ...    50   3e-07
Kpol_1036.56 s1036 (153997..154794) [798 bp, 265 aa] {ON} (15399...    51   4e-07
CAGL0C01551g Chr3 complement(169232..169897) [666 bp, 221 aa] {O...    50   8e-07
NCAS0H01130 Chr8 complement(216012..216854) [843 bp, 280 aa] {ON...    50   8e-07
TBLA0C03740 Chr3 complement(892360..893241) [882 bp, 293 aa] {ON...    50   9e-07
KAFR0G03650 Chr7 (752766..753299) [534 bp, 177 aa] {ON} Anc_6.17...    49   1e-06
TPHA0B02580 Chr2 (592073..592867) [795 bp, 264 aa] {ON} Anc_6.17...    49   1e-06
KAFR0A04370 Chr1 complement(870590..871819) [1230 bp, 409 aa] {O...    49   2e-06
KLTH0H05236g Chr8 complement(465998..466702) [705 bp, 234 aa] {O...    49   2e-06
Kwal_YGOB_matalpha2 s33 (284511..284843) [333 bp, 110 aa] {ON} (...    47   2e-06
Kwal_33.12995 s33 (32369..32701) [333 bp, 110 aa] {OFF} YCR096C ...    47   2e-06
Kwal_YGOB_HMalpha2 s33 (32369..32701) [333 bp, 110 aa] {ON} ANNO...    47   2e-06
Kwal_33.matalpha2 s33 (284511..284843) [333 bp, 110 aa] {OFF} (m...    47   2e-06
YGL096W Chr7 (325331..326161) [831 bp, 276 aa] {ON}  TOS8Homeodo...    49   2e-06
KNAG0M00500 Chr13 complement(79067..79963) [897 bp, 298 aa] {ON}...    47   7e-06
NDAI0F02170 Chr6 (527340..528491) [1152 bp, 383 aa] {ON} Anc_6.1...    47   8e-06
Smik_7.181 Chr7 (319819..320643) [825 bp, 274 aa] {ON} YGL096W (...    47   1e-05
KNAG0F02210 Chr6 complement(423243..424217) [975 bp, 324 aa] {ON...    47   1e-05
Skud_7.181 Chr7 (328628..329449) [822 bp, 274 aa] {ON} YGL096W (...    46   2e-05
KLTH0F00396g Chr6 (31990..32051,32348..32612) [327 bp, 108 aa] {...    44   3e-05
NCAS0D03570 Chr4 (664388..665161) [774 bp, 257 aa] {ON} Anc_6.17...    45   4e-05
NDAI0I01320 Chr9 complement(318160..319389) [1230 bp, 409 aa] {O...    45   4e-05
SAKL0A05610g Chr1 complement(506437..507399) [963 bp, 320 aa] {O...    45   7e-05
Kwal_27.11092 s27 (635052..635741) [690 bp, 229 aa] {ON} YPL177C...    44   8e-05
Suva_7.172 Chr7 (319317..320129) [813 bp, 270 aa] {ON} YGL096W (...    44   1e-04
KLLA0B10450g Chr2 (912877..914046) [1170 bp, 389 aa] {ON} some s...    38   0.009
Skud_71.2 Chr71 (734..868) [135 bp, 45 aa] {ON} YCL067C (REAL)         32   0.12 
NDAI0A00670 Chr1 complement(124998..125033,125093..125308,125369...    30   1.4  
NDAI0H00100 Chr8 complement(758..793,853..1068,1129..1164) [288 ...    30   1.4  
KLTH0G04884g Chr7 (389220..398984) [9765 bp, 3254 aa] {ON} simil...    30   5.5  
CAGL0H05291g Chr8 complement(509813..511519) [1707 bp, 568 aa] {...    29   7.7  

>CAGL0B00264g Chr2 (11470..12102) [633 bp, 210 aa] {ON} highly
           similar to uniprot|P01367 Saccharomyces cerevisiae
           YCR039c or uniprot|P01367 Saccharomyces cerevisiae
           YCL067c HMLALP 2 mating type regulatory protein
          Length = 210

 Score =  418 bits (1074), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 205/210 (97%), Positives = 205/210 (97%)

Query: 1   MSKKSRISITHLLNPIQEENLKEKLQEINNQLISLCSSLPKRQSLPGPSSDILRFLSRNN 60
           MSKKSRISITHLLNPIQEENLKEKLQEINNQLISLCSSLPKRQSLPGPSSDILRFLSRNN
Sbjct: 1   MSKKSRISITHLLNPIQEENLKEKLQEINNQLISLCSSLPKRQSLPGPSSDILRFLSRNN 60

Query: 61  LDPQEIGLIKTTYRLSTLLSKLREHEIVFNVVTKDHLLKKGVPNHYAASYRGHRFTRENV 120
           LDPQEIGLIKTTYRLSTLLSKLREHEIVFNVVTKDHLLKKGVPNHYAASYRGHRFTRENV
Sbjct: 61  LDPQEIGLIKTTYRLSTLLSKLREHEIVFNVVTKDHLLKKGVPNHYAASYRGHRFTRENV 120

Query: 121 QILETWYRNHIDNPYLDHNSQQYLAQKTNLSKIQIKNWVANRRRKQKSIYISLFDIHNIE 180
           QILETWYRNHIDNPYLDHNSQQYLAQKTNLSKIQIKNWVANRRRKQKSIYISLFDIHNIE
Sbjct: 121 QILETWYRNHIDNPYLDHNSQQYLAQKTNLSKIQIKNWVANRRRKQKSIYISLFDIHNIE 180

Query: 181 SGEYAYIEKVCYXXXXXCHLFLVFSLSCLT 210
           SGEYAYIEKVCY     CHLFLVFSLSCLT
Sbjct: 181 SGEYAYIEKVCYIIIIICHLFLVFSLSCLT 210

>CAGL0B01265g Chr2 (113719..114279) [561 bp, 186 aa] {ON} similar to
           uniprot|P01367 Saccharomyces cerevisiae YCR039c or
           uniprot|P01367 Saccharomyces cerevisiae YCL067c HMLALP2
           mating type regulatory protein
          Length = 186

 Score =  352 bits (904), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 173/174 (99%), Positives = 173/174 (99%)

Query: 1   MSKKSRISITHLLNPIQEENLKEKLQEINNQLISLCSSLPKRQSLPGPSSDILRFLSRNN 60
           MSKKSRISITHLLNPIQEENLKEKLQEINNQLISLCSSLPKRQSLPGPSSDILRFLSRNN
Sbjct: 1   MSKKSRISITHLLNPIQEENLKEKLQEINNQLISLCSSLPKRQSLPGPSSDILRFLSRNN 60

Query: 61  LDPQEIGLIKTTYRLSTLLSKLREHEIVFNVVTKDHLLKKGVPNHYAASYRGHRFTRENV 120
           LDPQEIGLIKTTYRLSTLLSKLREHEIVFNVVTKDHLLKKGVPNHYAASYRGHRFTRENV
Sbjct: 61  LDPQEIGLIKTTYRLSTLLSKLREHEIVFNVVTKDHLLKKGVPNHYAASYRGHRFTRENV 120

Query: 121 QILETWYRNHIDNPYLDHNSQQYLAQKTNLSKIQIKNWVANRRRKQKSIYISLF 174
           QILETWYRNHIDNPYLDHNSQQYLAQKTNLSKIQIKNWVANRRRKQKSIYIS F
Sbjct: 121 QILETWYRNHIDNPYLDHNSQQYLAQKTNLSKIQIKNWVANRRRKQKSIYISPF 174

>Kpol_2002.3 s2002 (4682..5353) [672 bp, 223 aa] {ON} (4682..5353)
           [672 nt, 224 aa]
          Length = 223

 Score =  135 bits (341), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 90/211 (42%), Positives = 119/211 (56%), Gaps = 49/211 (23%)

Query: 6   RISITHLLNPIQEENLKEKLQEINNQLISLCSSLPKRQSLPGPSSD-------ILRFLS- 57
           +I I  LLNP  +ENLK+KLQ+IN++L SLCS +P   S  G   +       IL FL+ 
Sbjct: 3   KIPINILLNPSHQENLKDKLQQINDKLTSLCSKIPGNTS--GLEQEDHLELQRILLFLTT 60

Query: 58  ---RNNLDPQEIGLIKTTYRLSTLLS----KLR--------------------------- 83
                 LD  EI L++TTY+LST LS     LR                           
Sbjct: 61  VVKNEKLDNDEIMLVRTTYQLSTTLSIMVKSLRMANENYESQTSKENSEEELTSPSSSDS 120

Query: 84  --EHEIVFNVVTKDHLLKKGVPNHYAASYRGHRFTRENVQILETWYRNHIDNPYLDHNSQ 141
              +E VFN+VT+D + KK +      SYRGHR  ++NV++LE WY  +++NPYLD  S 
Sbjct: 121 NDRNEFVFNIVTQDMMNKKKM---NIKSYRGHRLPKQNVKLLERWYIQNVENPYLDDKSI 177

Query: 142 QYLAQKTNLSKIQIKNWVANRRRKQKSIYIS 172
             L + T+LSK+QIKNWV+NRRRK+KSI IS
Sbjct: 178 SELMKITSLSKVQIKNWVSNRRRKEKSITIS 208

>KAFR0D00720 Chr4 (128684..129304) [621 bp, 206 aa] {ON}  mating
           type gene MATalpha2
          Length = 206

 Score =  124 bits (312), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 75/198 (37%), Positives = 116/198 (58%), Gaps = 34/198 (17%)

Query: 5   SRISITHLLNPIQEENLKEKLQEINNQLISLCSSLPKRQSLPGPS-----SDILRFLSR- 58
           ++I I  LLN  ++ + K++L++IN++L +LCS LP  ++L          DI+  LS+ 
Sbjct: 2   NKIQIQDLLNSPRDVDTKQELRDINDKLFALCSKLPSSEALLEAEFHLELRDIMLNLSKL 61

Query: 59  ---NNLDPQEIGLIKTTYRLS----TLLSKLRE-----------------HEIVFNVVTK 94
              + +  +E  L  T ++L+    TL+  ++                   + VFNVVT+
Sbjct: 62  QDTSRMGSEEKHLAYTAHQLTCTMITLIKGMKNFHGTGGHSYSSSKSESDDKTVFNVVTQ 121

Query: 95  DHLLKKGVPNHYAASYRGHRFTRENVQILETWYRNHIDNPYLDHNSQQYLAQKTNLSKIQ 154
           D +      N    SYRGHRF++ENV++LE WY  HID PYL+  S +YL  KT LS++Q
Sbjct: 122 DMM----NLNRTGISYRGHRFSKENVKVLERWYTAHIDRPYLNRQSTEYLISKTGLSRVQ 177

Query: 155 IKNWVANRRRKQKSIYIS 172
           IKNWV+NRRRK+KS+++S
Sbjct: 178 IKNWVSNRRRKEKSVHVS 195

>TPHA0E04070 Chr5 complement(848980..849613,849670..849731) [696 bp,
           231 aa] {ON}   silenced copy of alpha2 at HMLalpha locus
          Length = 231

 Score =  118 bits (296), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 82/218 (37%), Positives = 114/218 (52%), Gaps = 53/218 (24%)

Query: 5   SRISITHLLNPIQEENLKEKLQEINNQLISLCSSLPKRQSLPGPSS-----DILRFLS-- 57
           ++I I  LLNP Q  NL EKLQ+IN  L +LC+ LP   +    +      DIL +L+  
Sbjct: 2   NKIPINKLLNPSQHYNLTEKLQQINITLSNLCTKLPDTITDLTEADHRELQDILLYLTTV 61

Query: 58  --RNNLDPQEIGLIKTTYRLSTLLSKL------------REHEI---------------- 87
             +  L  +EI L+KTTY+L T L+ +            +E+EI                
Sbjct: 62  VKQQELKKEEIMLVKTTYQLCTTLTLMVKSCKQENDKENKENEIIKYESGTSDNSETNSS 121

Query: 88  -------------VFNVVTKDHLLKKGVPNHYAASYRGHRFTRENVQILETWYRNHIDNP 134
                        VFNV+T+D +           SYRGHR  ++NVQ LE WY +H  NP
Sbjct: 122 CNSSDNEDKNSILVFNVITQDMMNNNK---KNNKSYRGHRLPKKNVQYLEDWYMDHRKNP 178

Query: 135 YLDHNSQQYLAQKTNLSKIQIKNWVANRRRKQKSIYIS 172
           YL+  + + L  KT+LS+IQ+KNW++NRRRK+KSI IS
Sbjct: 179 YLNEINIKLLMSKTSLSRIQVKNWISNRRRKEKSITIS 216

>TPHA0E03610 Chr5 complement(765003..765636,765693..765754) [696 bp,
           231 aa] {ON} Anc_1.122 YCR039C MATalpha2 gene at MAT
           locus
          Length = 231

 Score =  118 bits (296), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 82/218 (37%), Positives = 114/218 (52%), Gaps = 53/218 (24%)

Query: 5   SRISITHLLNPIQEENLKEKLQEINNQLISLCSSLPKRQSLPGPSS-----DILRFLS-- 57
           ++I I  LLNP Q  NL EKLQ+IN  L +LC+ LP   +    +      DIL +L+  
Sbjct: 2   NKIPINKLLNPSQHYNLTEKLQQINITLSNLCTKLPDTITDLTEADHRELQDILLYLTTV 61

Query: 58  --RNNLDPQEIGLIKTTYRLSTLLSKL------------REHEI---------------- 87
             +  L  +EI L+KTTY+L T L+ +            +E+EI                
Sbjct: 62  VKQQELKKEEIMLVKTTYQLCTTLTLMVKSCKQENDKENKENEIIKYESGTSDNSETNSS 121

Query: 88  -------------VFNVVTKDHLLKKGVPNHYAASYRGHRFTRENVQILETWYRNHIDNP 134
                        VFNV+T+D +           SYRGHR  ++NVQ LE WY +H  NP
Sbjct: 122 CNSSDNEDKNSILVFNVITQDMMNNNK---KNNKSYRGHRLPKKNVQYLEDWYMDHRKNP 178

Query: 135 YLDHNSQQYLAQKTNLSKIQIKNWVANRRRKQKSIYIS 172
           YL+  + + L  KT+LS+IQ+KNW++NRRRK+KSI IS
Sbjct: 179 YLNEINIKLLMSKTSLSRIQVKNWISNRRRKEKSITIS 216

>Suva_3.147 Chr3 complement(221912..222544) [633 bp, 210 aa] {ON}
           (REAL)
          Length = 210

 Score =  117 bits (292), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 81/212 (38%), Positives = 118/212 (55%), Gaps = 43/212 (20%)

Query: 5   SRISITHLLNPIQEENLKEKLQEINNQLISLCSSLPKRQSLPGPSS--------DILRFL 56
           ++I I  LLNP   +  K  + +IN +L S+C +LPK   LP   +        DIL FL
Sbjct: 2   NKIPIKDLLNPQITDEFKSSILDINKKLFSICCNLPK---LPESVTTEEEVELRDILGFL 58

Query: 57  SRNNLDPQ--------EIGLIKTTYRLSTLLSKLREHE-----------------IVFNV 91
           SR N + +             + T  ++ LL ++R  E                 +VFNV
Sbjct: 59  SRANKNRKISDEEKKLLQTTSQLTTTITVLLKEMRSIENDRSNYQLTQKNKSADGLVFNV 118

Query: 92  VTKDHLLKKGVPNHYAASYRGHRFTRENVQILETWYRNHIDNPYLDHNSQQYLAQKTNLS 151
           VT+D + K   P      YRGHRFT+ENV+ILE+W+  +I+NPYLD    + L + T+LS
Sbjct: 119 VTQDMINKSTKP------YRGHRFTKENVRILESWFAKNIENPYLDTKGLENLMKNTSLS 172

Query: 152 KIQIKNWVANRRRKQKSIYISLFDIHNIESGE 183
           +IQIKNWV+NRRRK+K+I I+  ++ ++ SGE
Sbjct: 173 RIQIKNWVSNRRRKEKTITIAP-ELADLLSGE 203

>YCR039C Chr3 complement(199546..200178) [633 bp, 210 aa] {ON}
           MATALPHA2Homeobox-domain protein that, with Mcm1p,
           represses a-specific genes in haploids; acts with A1p to
           repress transcription of haploid-specific genes in
           diploids; one of two genes encoded by the MATalpha
           mating type cassette
          Length = 210

 Score =  117 bits (292), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 81/212 (38%), Positives = 118/212 (55%), Gaps = 43/212 (20%)

Query: 5   SRISITHLLNPIQEENLKEKLQEINNQLISLCSSLPKRQSLPGPSS--------DILRFL 56
           ++I I  LLNP   +  K  + +IN +L S+C +LPK   LP   +        DIL FL
Sbjct: 2   NKIPIKDLLNPQITDEFKSSILDINKKLFSICCNLPK---LPESVTTEEEVELRDILGFL 58

Query: 57  SRNNLDPQ--------EIGLIKTTYRLSTLLSKLREHE-----------------IVFNV 91
           SR N + +             + T  ++ LL ++R  E                 +VFNV
Sbjct: 59  SRANKNRKISDEEKKLLQTTSQLTTTITVLLKEMRSIENDRSNYQLTQKNKSADGLVFNV 118

Query: 92  VTKDHLLKKGVPNHYAASYRGHRFTRENVQILETWYRNHIDNPYLDHNSQQYLAQKTNLS 151
           VT+D + K   P      YRGHRFT+ENV+ILE+W+  +I+NPYLD    + L + T+LS
Sbjct: 119 VTQDMINKSTKP------YRGHRFTKENVRILESWFAKNIENPYLDTKGLENLMKNTSLS 172

Query: 152 KIQIKNWVANRRRKQKSIYISLFDIHNIESGE 183
           +IQIKNWV+NRRRK+K+I I+  ++ ++ SGE
Sbjct: 173 RIQIKNWVSNRRRKEKTITIAP-ELADLLSGE 203

>YCL067C Chr3 complement(12386..13018) [633 bp, 210 aa] {ON}
           HMLALPHA2Silenced copy of ALPHA2 at HML; homeobox-domain
           protein that associates with Mcm1p in haploid cells to
           repress a-specific gene expression and interacts with
           a1p in diploid cells to repress haploid-specific gene
           expression
          Length = 210

 Score =  117 bits (292), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 81/212 (38%), Positives = 118/212 (55%), Gaps = 43/212 (20%)

Query: 5   SRISITHLLNPIQEENLKEKLQEINNQLISLCSSLPKRQSLPGPSS--------DILRFL 56
           ++I I  LLNP   +  K  + +IN +L S+C +LPK   LP   +        DIL FL
Sbjct: 2   NKIPIKDLLNPQITDEFKSSILDINKKLFSICCNLPK---LPESVTTEEEVELRDILGFL 58

Query: 57  SRNNLDPQ--------EIGLIKTTYRLSTLLSKLREHE-----------------IVFNV 91
           SR N + +             + T  ++ LL ++R  E                 +VFNV
Sbjct: 59  SRANKNRKISDEEKKLLQTTSQLTTTITVLLKEMRSIENDRSNYQLTQKNKSADGLVFNV 118

Query: 92  VTKDHLLKKGVPNHYAASYRGHRFTRENVQILETWYRNHIDNPYLDHNSQQYLAQKTNLS 151
           VT+D + K   P      YRGHRFT+ENV+ILE+W+  +I+NPYLD    + L + T+LS
Sbjct: 119 VTQDMINKSTKP------YRGHRFTKENVRILESWFAKNIENPYLDTKGLENLMKNTSLS 172

Query: 152 KIQIKNWVANRRRKQKSIYISLFDIHNIESGE 183
           +IQIKNWV+NRRRK+K+I I+  ++ ++ SGE
Sbjct: 173 RIQIKNWVSNRRRKEKTITIAP-ELADLLSGE 203

>Skud_3.118 Chr3 complement(184042..184674) [633 bp, 210 aa] {ON}
           YCR039C (REAL)
          Length = 210

 Score =  117 bits (292), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 81/212 (38%), Positives = 118/212 (55%), Gaps = 43/212 (20%)

Query: 5   SRISITHLLNPIQEENLKEKLQEINNQLISLCSSLPKRQSLPGPSS--------DILRFL 56
           ++I I  LLNP   +  K  + +IN +L S+C +LPK   LP   +        DIL FL
Sbjct: 2   NKIPIKDLLNPQITDEFKSNILDINKKLFSICCNLPK---LPESVTTEEEVELRDILGFL 58

Query: 57  SRNNLDPQ--------EIGLIKTTYRLSTLLSKLREHE-----------------IVFNV 91
           SR N + +             + T  ++ LL ++R  E                 +VFNV
Sbjct: 59  SRANKNRKISDEEKKLLQTTSQLTTTITVLLKEMRSIENDRSNYQLTQKNKSADGLVFNV 118

Query: 92  VTKDHLLKKGVPNHYAASYRGHRFTRENVQILETWYRNHIDNPYLDHNSQQYLAQKTNLS 151
           VT+D + K   P      YRGHRFT+ENV+ILE+W+  +I+NPYLD    + L + T+LS
Sbjct: 119 VTQDMINKSTKP------YRGHRFTKENVRILESWFAKNIENPYLDTKGLENLMKNTSLS 172

Query: 152 KIQIKNWVANRRRKQKSIYISLFDIHNIESGE 183
           +IQIKNWV+NRRRK+K+I I+  ++ ++ SGE
Sbjct: 173 RIQIKNWVSNRRRKEKTITIAP-ELADLLSGE 203

>NCAS0B09140 Chr2 complement(1754708..1755325) [618 bp, 205 aa] {ON}
           Anc_1.2
          Length = 205

 Score =  110 bits (276), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 75/206 (36%), Positives = 114/206 (55%), Gaps = 37/206 (17%)

Query: 5   SRISITHLLNPIQEENLKEKLQEINNQLISLCSSLPKRQSLPGPS-SDILRFLS------ 57
           ++I+I  LLNP       E+L+ IN QL ++CS  P  ++L   +  + LR ++      
Sbjct: 2   NKIAIHDLLNPPNTTKTHEQLESINTQLNTICSVFPTTENLDFKTYQEQLRNIAVTLSSL 61

Query: 58  --RNNLDPQEIGLIKTTYRLSTLLSKL---------------------REHEIVFNVVTK 94
             +N L  +   +++ TY++S++L KL                     R  ++VFN++TK
Sbjct: 62  TNQNELSSENKNVLRVTYQISSVLLKLLGENAHNKDQPKTPTSGSESERNPKLVFNILTK 121

Query: 95  DHLLKKGVPNHYAASYRGHRFTRENVQILETWYRNHIDNPYLDHNSQQYLAQKTNLSKIQ 154
               K+  P       RGHR  +E V +LE WY  H+DNPYL+  S Q L Q+T+LSK+Q
Sbjct: 122 ----KRMSPTSNEP-RRGHRLAKEKVDLLEHWYIQHMDNPYLNKASLQMLMQETSLSKMQ 176

Query: 155 IKNWVANRRRKQKSIYIS--LFDIHN 178
           IKNWV+NRRRK+KS+ I+  + DI N
Sbjct: 177 IKNWVSNRRRKEKSLSIAPEIVDILN 202

>NDAI0A00110 Chr1 (1584..2219) [636 bp, 211 aa] {ON} Anc_1.2  silent
           copy of MATalpha2 gene at HMLalpha
          Length = 211

 Score =  109 bits (272), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 74/214 (34%), Positives = 115/214 (53%), Gaps = 43/214 (20%)

Query: 5   SRISITHLLNPIQEENLKEKLQEINNQLISLCSSLP-KRQSLPGPSS----DILRFLS-- 57
           ++I+I+ LLNP     +   L  INNQL+++CS  P  ++++ G       +I+ FLS  
Sbjct: 2   NKIAISDLLNPPTAGPVTSNLDSINNQLVTICSKFPTAKENVDGSYQIQLHNIVSFLSTL 61

Query: 58  --RNNLDPQEIGLIKTTYRLSTLLSKLREHEI-------------------------VFN 90
               NL  ++   I+ TY LS++L K+ +  +                         VFN
Sbjct: 62  TQSTNLTSKDCSNIQLTYELSSMLGKVLKDMVLLNGTEEVEKKKVKEEEELETNSKYVFN 121

Query: 91  VVTKDHLL-KKGVPNHYAASYRGHRFTRENVQILETWYRNHIDNPYLDHNSQQYLAQKTN 149
           V+T+D ++ +K  P      +RGHR  +E V  LE WY  HI  PYLD  + + L ++T 
Sbjct: 122 VITQDMMIPEKNKP------HRGHRLPKEKVNRLEHWYLAHIQKPYLDSKNLKVLMEETK 175

Query: 150 LSKIQIKNWVANRRRKQKSIYIS--LFDIHNIES 181
           LSK+QIKNW++NRRRK+K + IS  + +I N +S
Sbjct: 176 LSKVQIKNWISNRRRKEKLLSISPDIVEIINTQS 209

>Smik_3.142 Chr3 complement(197575..198261) [687 bp, 228 aa] {ON}
           YCL067C (REAL)
          Length = 228

 Score =  106 bits (265), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 74/188 (39%), Positives = 106/188 (56%), Gaps = 43/188 (22%)

Query: 29  NNQLISLCSSLPKRQSLPGPSS--------DILRFLSRNN----LDPQE----IGLIKTT 72
           N +L S+C +LPK   LP   +        DIL FLSR N    +  +E        + T
Sbjct: 44  NKKLFSICCNLPK---LPESVTTEEEVELRDILGFLSRANKNRKISDEEKKLLQTTSQLT 100

Query: 73  YRLSTLLSKLREHE-----------------IVFNVVTKDHLLKKGVPNHYAASYRGHRF 115
             ++ LL ++R  E                 +VFNVVT+D + K   P      YRGHRF
Sbjct: 101 TTITVLLKEMRSIENDRSNYQLTQKNKSADGLVFNVVTQDMINKSTKP------YRGHRF 154

Query: 116 TRENVQILETWYRNHIDNPYLDHNSQQYLAQKTNLSKIQIKNWVANRRRKQKSIYISLFD 175
           T+ENV+ILE+W+  +I+NPYLD    + L + T+LS+IQIKNWV+NRRRK+K+I I+  +
Sbjct: 155 TKENVRILESWFAKNIENPYLDTKGLENLMKNTSLSRIQIKNWVSNRRRKEKTITIAP-E 213

Query: 176 IHNIESGE 183
           + ++ SGE
Sbjct: 214 LADLLSGE 221

>Skud_102.1 Chr102 (1..558) [558 bp, 185 aa] {ON} YCR039C (REAL)
          Length = 185

 Score =  105 bits (261), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 73/188 (38%), Positives = 105/188 (55%), Gaps = 43/188 (22%)

Query: 29  NNQLISLCSSLPKRQSLPGPSS--------DILRFLSRNNLDPQ--------EIGLIKTT 72
           N +L S+C +LPK   LP   +        DIL FLSR N + +             + T
Sbjct: 1   NKKLFSICCNLPK---LPESVTTEEEVELRDILGFLSRANKNRKISDEEKKLLQTTSQLT 57

Query: 73  YRLSTLLSKLREHE-----------------IVFNVVTKDHLLKKGVPNHYAASYRGHRF 115
             ++ LL ++R  E                 +VFNVVT+D + K   P      YRGHRF
Sbjct: 58  TTITVLLKEMRSIENDRSNYQLTQKNKSADGLVFNVVTQDMINKSTKP------YRGHRF 111

Query: 116 TRENVQILETWYRNHIDNPYLDHNSQQYLAQKTNLSKIQIKNWVANRRRKQKSIYISLFD 175
           T+ENV+ILE+W+  +I+NPYLD    + L + T+LS+IQIKNWV+NRRRK+K+I I+  +
Sbjct: 112 TKENVRILESWFAKNIENPYLDTKGLENLMKNTSLSRIQIKNWVSNRRRKEKTITIAP-E 170

Query: 176 IHNIESGE 183
           + ++ SGE
Sbjct: 171 LADLLSGE 178

>Smik_95.1 Chr95 (1..558) [558 bp, 185 aa] {ON} YCR039C (REAL)
          Length = 185

 Score =  105 bits (261), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 73/188 (38%), Positives = 105/188 (55%), Gaps = 43/188 (22%)

Query: 29  NNQLISLCSSLPKRQSLPGPSS--------DILRFLSRNNLDPQ--------EIGLIKTT 72
           N +L S+C +LPK   LP   +        DIL FLSR N + +             + T
Sbjct: 1   NKKLFSICCNLPK---LPESVTTEEEVELRDILGFLSRANKNRKISDEEKKLLQTTSQLT 57

Query: 73  YRLSTLLSKLREHE-----------------IVFNVVTKDHLLKKGVPNHYAASYRGHRF 115
             ++ LL ++R  E                 +VFNVVT+D + K   P      YRGHRF
Sbjct: 58  TTITVLLKEMRSIENDRSNYQLTQKNKSADGLVFNVVTQDMINKSTKP------YRGHRF 111

Query: 116 TRENVQILETWYRNHIDNPYLDHNSQQYLAQKTNLSKIQIKNWVANRRRKQKSIYISLFD 175
           T+ENV+ILE+W+  +I+NPYLD    + L + T+LS+IQIKNWV+NRRRK+K+I I+  +
Sbjct: 112 TKENVRILESWFAKNIENPYLDTKGLENLMKNTSLSRIQIKNWVSNRRRKEKTITIAP-E 170

Query: 176 IHNIESGE 183
           + ++ SGE
Sbjct: 171 LADLLSGE 178

>Suva_3.135 Chr3 complement(211196..211555) [360 bp, 119 aa] {ON}
           YCR096C (REAL)
          Length = 119

 Score =  102 bits (254), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 51/97 (52%), Positives = 72/97 (74%), Gaps = 7/97 (7%)

Query: 87  IVFNVVTKDHLLKKGVPNHYAASYRGHRFTRENVQILETWYRNHIDNPYLDHNSQQYLAQ 146
           +VFNVVT+D + K   P      YRGHRFT+ENV+ILE+W+  +I+NPYLD    + L +
Sbjct: 23  LVFNVVTQDMINKSTKP------YRGHRFTKENVRILESWFAKNIENPYLDTKGLENLMK 76

Query: 147 KTNLSKIQIKNWVANRRRKQKSIYISLFDIHNIESGE 183
            T+LS+IQIKNWV+NRRRK+K+I I+  ++ ++ SGE
Sbjct: 77  NTSLSRIQIKNWVSNRRRKEKTITIAP-ELADLLSGE 112

>Suva_3.74 Chr3 complement(112965..113324) [360 bp, 119 aa] {ON}
           YCR039C (REAL)
          Length = 119

 Score =  102 bits (254), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 51/97 (52%), Positives = 72/97 (74%), Gaps = 7/97 (7%)

Query: 87  IVFNVVTKDHLLKKGVPNHYAASYRGHRFTRENVQILETWYRNHIDNPYLDHNSQQYLAQ 146
           +VFNVVT+D + K   P      YRGHRFT+ENV+ILE+W+  +I+NPYLD    + L +
Sbjct: 23  LVFNVVTQDMINKSTKP------YRGHRFTKENVRILESWFAKNIENPYLDTKGLENLMK 76

Query: 147 KTNLSKIQIKNWVANRRRKQKSIYISLFDIHNIESGE 183
            T+LS+IQIKNWV+NRRRK+K+I I+  ++ ++ SGE
Sbjct: 77  NTSLSRIQIKNWVSNRRRKEKTITIAP-ELADLLSGE 112

>Suva_3.75 Chr3 complement(112965..113324) [360 bp, 119 aa] {ON}
           YCL067C (REAL)
          Length = 119

 Score =  102 bits (254), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 51/97 (52%), Positives = 72/97 (74%), Gaps = 7/97 (7%)

Query: 87  IVFNVVTKDHLLKKGVPNHYAASYRGHRFTRENVQILETWYRNHIDNPYLDHNSQQYLAQ 146
           +VFNVVT+D + K   P      YRGHRFT+ENV+ILE+W+  +I+NPYLD    + L +
Sbjct: 23  LVFNVVTQDMINKSTKP------YRGHRFTKENVRILESWFAKNIENPYLDTKGLENLMK 76

Query: 147 KTNLSKIQIKNWVANRRRKQKSIYISLFDIHNIESGE 183
            T+LS+IQIKNWV+NRRRK+K+I I+  ++ ++ SGE
Sbjct: 77  NTSLSRIQIKNWVSNRRRKEKTITIAP-ELADLLSGE 112

>YCR096C Chr3 complement(293179..293538) [360 bp, 119 aa] {OFF}
           HMRA2Silenced copy of a2 at HMR; similarity to Alpha2p;
           required along with a1p for inhibiting expression of the
           HO endonuclease in a/alpha HO/HO diploid cells with an
           active mating-type interconversion system
          Length = 119

 Score =  102 bits (254), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 51/97 (52%), Positives = 72/97 (74%), Gaps = 7/97 (7%)

Query: 87  IVFNVVTKDHLLKKGVPNHYAASYRGHRFTRENVQILETWYRNHIDNPYLDHNSQQYLAQ 146
           +VFNVVT+D + K   P      YRGHRFT+ENV+ILE+W+  +I+NPYLD    + L +
Sbjct: 23  LVFNVVTQDMINKSTKP------YRGHRFTKENVRILESWFAKNIENPYLDTKGLENLMK 76

Query: 147 KTNLSKIQIKNWVANRRRKQKSIYISLFDIHNIESGE 183
            T+LS+IQIKNWV+NRRRK+K+I I+  ++ ++ SGE
Sbjct: 77  NTSLSRIQIKNWVSNRRRKEKTITIAP-ELADLLSGE 112

>KNAG0C00160 Chr3 (25548..26159) [612 bp, 203 aa] {ON} Anc_1.2
           YCL067C silent copy of mating type alpha2 gene at HML
           locus
          Length = 203

 Score =  104 bits (260), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 67/196 (34%), Positives = 102/196 (52%), Gaps = 31/196 (15%)

Query: 5   SRISITHLLNPIQEENLKEKLQEINNQLISLCSSLPK---------RQSLPGPSSDILRF 55
           +RI I  LLN     +L +  + IN+QL+ +CS+ PK         +  L G    + + 
Sbjct: 2   NRIEIQDLLNNQDCSSLDKDFKNINSQLLEICSNFPKELLSNHGELQMQLQGILLFLTKL 61

Query: 56  LSRNNLDPQEIGLIKTTYRLSTLLSKL-------------------REHEIVFNVVTKDH 96
           + +N+L        + TY+ S +++ L                    E+E VF+VVT+D 
Sbjct: 62  VGKNDLSVTLKNEARMTYQFSKIIASLLKSFEDFFFERKEYNDPATSENEFVFSVVTQDM 121

Query: 97  LLKKGVPNHYAASYRGHRFTRENVQILETWYRNHIDNPYLDHNSQQYLAQKTNLSKIQIK 156
           + K+          RGHRF+  + + LE WY+ H + PYLD  S   L  KT LSK+QI+
Sbjct: 122 MNKRK---ESMRPCRGHRFSSNSTETLEDWYKKHHEKPYLDKRSLHELEFKTKLSKMQIR 178

Query: 157 NWVANRRRKQKSIYIS 172
           NWV+NRRRK+KSI++S
Sbjct: 179 NWVSNRRRKEKSIHVS 194

>ZYRO0F15818g Chr6 complement(1302816..1303493) [678 bp, 225 aa]
           {ON} similar to uniprot|Q6B2C0 Saccharomyces cerevisiae
           YCR039C MATALPHA2 Homeobox-domain containing protein
           which in haploid cells acts with Mcm1p to repress
           a-specific genes in diploid cells Alpha2p acts together
           with A1p to repress transcription of haploid-specific
           genes
          Length = 225

 Score = 97.1 bits (240), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 68/211 (32%), Positives = 110/211 (52%), Gaps = 44/211 (20%)

Query: 6   RISITHLLNPIQEENLKEKLQEINNQLISLCSSLP-KRQSLPGPSSDILRFLSRNNLDPQ 64
           +I I  LLNP+ +E   EKL+ INN+L++LCS LP + +      +++ + L   N+  +
Sbjct: 3   KIPIERLLNPVHQEFPHEKLKNINNKLLALCSKLPSENEQFEKDKAELEKILPSLNILIR 62

Query: 65  EIG-------LIKTTYRLSTLLSKL--------------------------------REH 85
           E G       ++   ++LS++ S L                                 + 
Sbjct: 63  ECGSSKEDQKMVHRIHQLSSVFSLLLNEVSELKSKRSQFLRSKPKYHLPYAAALGNTGKE 122

Query: 86  EIVFNVVTKDHLLKKGVPNHYAASYRGHRFTRENVQILETWYRNHIDNPYLDHNSQQYLA 145
            +VFN+VT+D L      N    +YRGHR  +   ++LE+W+  +I++PYL  +S + L 
Sbjct: 123 GMVFNIVTQDTLNSARRSN---KTYRGHRLPKHITRLLESWFNRNIEHPYLQTSSMKELM 179

Query: 146 QKTNLSKIQIKNWVANRRRKQKSIYISLFDI 176
            +T LS  QIKNWV+NRRRK+KS+ IS F++
Sbjct: 180 VETKLSGPQIKNWVSNRRRKEKSLTIS-FEV 209

>ZYRO0F18568g Chr6 complement(1532755..1533432) [678 bp, 225 aa]
           {ON} similar to uniprot|Q6B2C0 Saccharomyces cerevisiae
           YCR039C MATALPHA2 Homeobox-domain containing protein
           which in haploid cells acts with Mcm1p to repress
           a-specific genes in diploid cells Alpha2p acts together
           with A1p to repress transcription of haploid-specific
           genes
          Length = 225

 Score = 97.1 bits (240), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 68/211 (32%), Positives = 110/211 (52%), Gaps = 44/211 (20%)

Query: 6   RISITHLLNPIQEENLKEKLQEINNQLISLCSSLP-KRQSLPGPSSDILRFLSRNNLDPQ 64
           +I I  LLNP+ +E   EKL+ INN+L++LCS LP + +      +++ + L   N+  +
Sbjct: 3   KIPIERLLNPVHQEFPHEKLKNINNKLLALCSKLPSENEQFEKDKAELEKILPSLNILIR 62

Query: 65  EIG-------LIKTTYRLSTLLSKL--------------------------------REH 85
           E G       ++   ++LS++ S L                                 + 
Sbjct: 63  ECGSSKEDQKMVHRIHQLSSVFSLLLNEVSELKSKRSQFLRSKPKYHLPYAAALGNTGKE 122

Query: 86  EIVFNVVTKDHLLKKGVPNHYAASYRGHRFTRENVQILETWYRNHIDNPYLDHNSQQYLA 145
            +VFN+VT+D L      N    +YRGHR  +   ++LE+W+  +I++PYL  +S + L 
Sbjct: 123 GMVFNIVTQDTLNSARRSN---KTYRGHRLPKHITRLLESWFNRNIEHPYLQTSSMKELM 179

Query: 146 QKTNLSKIQIKNWVANRRRKQKSIYISLFDI 176
            +T LS  QIKNWV+NRRRK+KS+ IS F++
Sbjct: 180 VETKLSGPQIKNWVSNRRRKEKSLTIS-FEV 209

>TBLA0A07600 Chr1
           (1882710..1882771,1882865..1882958,1883018..1883554)
           [693 bp, 230 aa] {ON} Anc_1.2 YCL067C silenced copy of
           alpha2 gene at HML locus
          Length = 230

 Score = 94.4 bits (233), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 70/224 (31%), Positives = 109/224 (48%), Gaps = 62/224 (27%)

Query: 6   RISITHLLNPIQEENLKEKLQEINNQLISLCSSLPKRQSLPGPS-SDILRFLSRN----N 60
           +I I  LLNP   EN+KE+LQ +N +L+S+CS LP  +S+     S+IL+FL++      
Sbjct: 3   KIPIDTLLNPTNSENIKEQLQNLNKELLSMCSRLPSAKSMEETQLSEILKFLTKTIKHEP 62

Query: 61  LDPQEIGLIKTTYRLSTLLSKL--------REHEI-------VFNVVTKDHLL------- 98
           L  +E  L+ TT +LST+LS L        R H         VFNV+T+  +        
Sbjct: 63  LGKEETELVTTTVQLSTVLSSLVKEARQLHRLHHSQSTHNPRVFNVLTQHMMSNSNSTST 122

Query: 99  ---KKGVPN--------------------------------HYAASYRGHRFTRENVQIL 123
                 +PN                                 +  S+RGHR  +  +  L
Sbjct: 123 SPHSNSLPNSPSTKKSTTPLTNPSPPYYYSSSSPKSLSPPLQHTPSHRGHRLPKHTLIPL 182

Query: 124 ETWYRNHIDNPYLDHNSQQYLAQKTNLSKIQIKNWVANRRRKQK 167
           E W+ ++  +PYL ++  Q L  +++LSK Q+KNW++NRRRK++
Sbjct: 183 EKWFLHNKSHPYLHNSDLQALTTQSSLSKTQVKNWISNRRRKER 226

>TBLA0A07050 Chr1
           (1728941..1729002,1729096..1729189,1729249..1729878)
           [786 bp, 261 aa] {ON}  MATalpha2 gene at MAT locus
          Length = 261

 Score = 94.4 bits (233), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 73/230 (31%), Positives = 113/230 (49%), Gaps = 63/230 (27%)

Query: 6   RISITHLLNPIQEENLKEKLQEINNQLISLCSSLPKRQSLPGPS-SDILRFLSRN----N 60
           +I I  LLNP   EN+KE+LQ +N +L+S+CS LP  +S+     S+IL+FL++      
Sbjct: 3   KIPIDTLLNPTNSENIKEQLQNLNKELLSMCSRLPSAKSMEETQLSEILKFLTKTIKHEP 62

Query: 61  LDPQEIGLIKTTYRLSTLLSKL--------REHEI-------VFNVVTKDHLL------- 98
           L  +E  L+ TT +LST+LS L        R H         VFNV+T+  +        
Sbjct: 63  LGKEETELVTTTVQLSTVLSSLVKEARQLHRLHHSQSTHNPRVFNVLTQHMMSNSNSTST 122

Query: 99  ---KKGVPN--------------------------------HYAASYRGHRFTRENVQIL 123
                 +PN                                 +  S+RGHR  +  +  L
Sbjct: 123 SPHSNSLPNSPSTKKSTTPLTNPSPPYYYSSSSPKSLSPPLQHTPSHRGHRLPKHTLIPL 182

Query: 124 ETWYRNHIDNPYLDHNSQQYLAQKTNLSKIQIKNWVANRRRKQK-SIYIS 172
           E W+ ++  +PYL ++  Q L  +++LSK Q+KNW++NRRRK++ S+ IS
Sbjct: 183 EKWFLHNKSHPYLHNSDLQALTTQSSLSKTQVKNWISNRRRKERHSLKIS 232

>Ecym_1115 Chr1 (237261..237485,237542..238009) [693 bp, 230 aa]
           {ON} similar to YCL067C HMLALPHA2, 1-intron
          Length = 230

 Score = 88.2 bits (217), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 42/88 (47%), Positives = 64/88 (72%), Gaps = 6/88 (6%)

Query: 87  IVFNVVTKDHL--LKKGVPNHYAASYRGHRFTRENVQILETWYRNHIDNPYLDHNSQQYL 144
           I+FNVVT+D +   +KG     ++SY+GHR  +++VQ+LE+WY+N+I+NPYL+    + L
Sbjct: 138 IIFNVVTQDMMENGRKG----GSSSYKGHRLPKKHVQLLESWYKNNIENPYLNDTDIRIL 193

Query: 145 AQKTNLSKIQIKNWVANRRRKQKSIYIS 172
            ++T  S+ Q+KNWVAN+RRK K   IS
Sbjct: 194 MRETGFSRSQVKNWVANKRRKDKHSTIS 221

>Ecym_1002 Chr1 complement(5334..5801,5858..6082) [693 bp, 230 aa]
           {ON} similar to Saccharomyces cerevisiae YCL067C
           HMLALPHA2; 1-intron
          Length = 230

 Score = 88.2 bits (217), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 42/88 (47%), Positives = 64/88 (72%), Gaps = 6/88 (6%)

Query: 87  IVFNVVTKDHL--LKKGVPNHYAASYRGHRFTRENVQILETWYRNHIDNPYLDHNSQQYL 144
           I+FNVVT+D +   +KG     ++SY+GHR  +++VQ+LE+WY+N+I+NPYL+    + L
Sbjct: 138 IIFNVVTQDMMENGRKG----GSSSYKGHRLPKKHVQLLESWYKNNIENPYLNDTDIRIL 193

Query: 145 AQKTNLSKIQIKNWVANRRRKQKSIYIS 172
            ++T  S+ Q+KNWVAN+RRK K   IS
Sbjct: 194 MRETGFSRSQVKNWVANKRRKDKHSTIS 221

>TDEL0C07000 Chr3 complement(1273613..1274326) [714 bp, 237 aa] {ON}
           Anc_1.122 YCR039C silenced copy of alpha2 gene at T.
           delbrueckii HML locus
          Length = 237

 Score = 71.6 bits (174), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 47/130 (36%), Positives = 68/130 (52%), Gaps = 25/130 (19%)

Query: 68  LIKTTYRLSTLLS-------KLREHEIVF------NVVTKDHLLKKGVPN---------- 104
           L++TT++LS  LS       K+ E  I F      +   K+  L+  VPN          
Sbjct: 89  LLRTTFQLSKTLSVVLSEFKKVEESNIQFHKSRDWDSERKETNLRCKVPNFEIVPLNTKQ 148

Query: 105 --HYAASYRGHRFTRENVQILETWYRNHIDNPYLDHNSQQYLAQKTNLSKIQIKNWVANR 162
                  +RGHR   E V+ LE W+  +I  PYL+  + + L  +T+LS IQIKNW++NR
Sbjct: 149 DYSTGKRHRGHRLPSEKVEKLELWFNQNISKPYLNQRALRTLVHETSLSPIQIKNWLSNR 208

Query: 163 RRKQKSIYIS 172
           RRK+KS  I+
Sbjct: 209 RRKKKSAGIA 218

>KLLA0C00374g Chr3 (25132..25803) [672 bp, 223 aa] {ON}
           uniprot|Q9HDS5 Kluyveromyces lactis HMLALPHA2 Mating-
           type protein ALPHA2
          Length = 223

 Score = 70.1 bits (170), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 34/69 (49%), Positives = 46/69 (66%), Gaps = 1/69 (1%)

Query: 111 RGHRFTRENVQILETWYRNHIDNPYLDHNSQQYLAQKTNLSKIQIKNWVANRRRKQKSIY 170
           +G RF + ++Q+LE WY  +  NPYL  N   Y+++ T L+K QIKNW+ANRRRK K   
Sbjct: 154 KGKRFPKSHIQLLENWYSMNRRNPYLAENDLAYISKNTTLTKTQIKNWLANRRRKDKITE 213

Query: 171 ISLFDIHNI 179
           +S  DI NI
Sbjct: 214 VS-SDIRNI 221

>Smik_6.374 Chr6 (610093..610977) [885 bp, 294 aa] {ON} YPL177C
           (REAL)
          Length = 294

 Score = 58.5 bits (140), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 35/83 (42%), Positives = 47/83 (56%), Gaps = 1/83 (1%)

Query: 109 SYRGHRFTRENVQILETWYRNHIDNPYLDHNSQQYLAQKTNLSKIQIKNWVAN-RRRKQK 167
           S R     +E VQIL TW  NH++NPY     ++ L  KT L+KIQ+ NW  N RRRK  
Sbjct: 151 SGRRSNLPKETVQILNTWLLNHLNNPYPTQQEKRELLIKTGLTKIQLSNWFINVRRRKIF 210

Query: 168 SIYISLFDIHNIESGEYAYIEKV 190
           S Y +L +    E+G    +E+V
Sbjct: 211 SDYYTLVNSIPNENGNNTPMERV 233

>Skud_16.103 Chr16 complement(185398..186285) [888 bp, 295 aa] {ON}
           YPL177C (REAL)
          Length = 295

 Score = 55.5 bits (132), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 31/68 (45%), Positives = 40/68 (58%), Gaps = 1/68 (1%)

Query: 109 SYRGHRFTRENVQILETWYRNHIDNPYLDHNSQQYLAQKTNLSKIQIKNWVAN-RRRKQK 167
           S R     +E VQIL TW  NH++NPY     ++ L  KT L+KIQ+ NW  N RRRK  
Sbjct: 152 SGRRSNLPKETVQILNTWLLNHLNNPYPTQQEKRELLIKTGLTKIQLSNWFINVRRRKIF 211

Query: 168 SIYISLFD 175
           S Y +L +
Sbjct: 212 SDYYTLVN 219

>YPL177C Chr16 complement(213042..213962) [921 bp, 306 aa] {ON}
           CUP9Homeodomain-containing transcriptional repressor of
           PTR2, which encodes a major peptide transporter;
           imported peptides activate ubiquitin-dependent
           proteolysis, resulting in degradation of Cup9p and
           de-repression of PTR2 transcription
          Length = 306

 Score = 55.1 bits (131), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 33/83 (39%), Positives = 46/83 (55%), Gaps = 1/83 (1%)

Query: 109 SYRGHRFTRENVQILETWYRNHIDNPYLDHNSQQYLAQKTNLSKIQIKNWVAN-RRRKQK 167
           S R     +E VQIL TW  NH++NPY     ++ L  KT L+KIQ+ NW  N RRRK  
Sbjct: 163 SGRRSNLPKETVQILNTWLLNHLNNPYPTQQEKRELLIKTGLTKIQLSNWFINVRRRKIF 222

Query: 168 SIYISLFDIHNIESGEYAYIEKV 190
           S Y +L +    ++     +E+V
Sbjct: 223 SDYYTLVNSIPNDNANNTPVERV 245

>Suva_16.132 Chr16 complement(222346..223224) [879 bp, 292 aa] {ON}
           YPL177C (REAL)
          Length = 292

 Score = 55.1 bits (131), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 41/133 (30%), Positives = 64/133 (48%), Gaps = 17/133 (12%)

Query: 54  RFLSRNNLDPQEIGL---IKTTYRLSTLLSKLREHEIVFNVVTKDHLLKKGVPNHYAA-- 108
           +FL  +  +P+   +   IK  Y+ + +      +EI+ N        K+ +P    +  
Sbjct: 90  QFLPDSTTNPETQPVLENIKPCYKSAPI------YEIINNETDMHAQTKRSIPEFEDSKS 143

Query: 109 -----SYRGHRFTRENVQILETWYRNHIDNPYLDHNSQQYLAQKTNLSKIQIKNWVAN-R 162
                S R     +E VQ+L TW  NH++NPY     ++ L  KT L+KIQ+ NW  N R
Sbjct: 144 KKKQNSGRRSNLPKETVQVLNTWLLNHLNNPYPTQQEKRELLIKTGLTKIQLSNWFINVR 203

Query: 163 RRKQKSIYISLFD 175
           RRK  S Y +L +
Sbjct: 204 RRKIFSDYYTLVN 216

>CAGL0H02959g Chr8 (277540..278319) [780 bp, 259 aa] {ON} some
           similarities with uniprot|P53147 Saccharomyces
           cerevisiae YGL096w TOS8
          Length = 259

 Score = 52.8 bits (125), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 25/64 (39%), Positives = 38/64 (59%), Gaps = 2/64 (3%)

Query: 115 FTRENVQILETWYRNHIDNPYLDHNSQQYLAQKTNLSKIQIKNWVANRRRKQKSIYISLF 174
             +E V+IL  W  +HI+NPY     +  L+ KT L+KIQ+ NW  N RR++  ++   +
Sbjct: 168 LPKETVKILNEWLYDHINNPYPTPQEKMELSLKTGLTKIQLSNWFINVRRRK--VFADYY 225

Query: 175 DIHN 178
           DI N
Sbjct: 226 DITN 229

>Ecym_2247 Chr2 complement(486469..487518) [1050 bp, 349 aa] {ON}
           similar to Ashbya gossypii AFL049C
          Length = 349

 Score = 52.8 bits (125), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 33/122 (27%), Positives = 55/122 (45%), Gaps = 3/122 (2%)

Query: 47  GPSSDILRFLSRNNLD--PQEIGLIKTTYRLSTLLSKLREHEIVFNVVTKDHLLKKGVPN 104
           GP S  + +    + D  P++I    TT   +  +  +   +    +    H   K V  
Sbjct: 161 GPQSCEIHYTLEPHRDYVPKQIMAPSTTTATTVQMEPISASQAGTAIPKVPHKALKSV-E 219

Query: 105 HYAASYRGHRFTRENVQILETWYRNHIDNPYLDHNSQQYLAQKTNLSKIQIKNWVANRRR 164
           H    +R     +E V IL  W R+H DNPY     ++ L ++T L+ +Q+ NW  N RR
Sbjct: 220 HTKKQHRRSNLPKETVDILNEWLRDHYDNPYPSPQEKKELLKQTGLNPVQLSNWFINVRR 279

Query: 165 KQ 166
           ++
Sbjct: 280 RK 281

>TDEL0F01810 Chr6 complement(338066..338836) [771 bp, 256 aa] {ON}
           Anc_6.170 YPL177C
          Length = 256

 Score = 51.2 bits (121), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 26/68 (38%), Positives = 39/68 (57%), Gaps = 2/68 (2%)

Query: 111 RGHRFTRENVQILETWYRNHIDNPYLDHNSQQYLAQKTNLSKIQIKNWVANRRRKQKSIY 170
           R     +E VQIL TW  +H+ NPY     ++ L  KT L+KIQ+ NW  N RR++  I+
Sbjct: 132 RRSNLPKETVQILNTWLLDHLRNPYPTPQEKRELLIKTGLTKIQLSNWFINVRRRK--IF 189

Query: 171 ISLFDIHN 178
              +++ N
Sbjct: 190 CDYYELAN 197

>AFL049C Chr6 complement(346546..347319) [774 bp, 257 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL177C
           (CUP9) and YGL096W (TOS8)
          Length = 257

 Score = 51.2 bits (121), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 22/57 (38%), Positives = 33/57 (57%)

Query: 110 YRGHRFTRENVQILETWYRNHIDNPYLDHNSQQYLAQKTNLSKIQIKNWVANRRRKQ 166
           +R     +E V IL  W RNH DNPY     ++ L ++T L+ +Q+ NW  N RR++
Sbjct: 133 HRRSNLPKETVDILNEWLRNHYDNPYPSPQEKKELLKQTGLNPVQLSNWFINVRRRK 189

>ZYRO0G22044g Chr7 (1814345..1814950) [606 bp, 201 aa] {ON} some
           similarities with uniprot|P41817 Saccharomyces
           cerevisiae YPL177C CUP9 Homeodomain-containing
           transcriptional repressor of PTR2 which encodes a major
           peptide transporter imported peptides activate
           ubiquitin- dependent proteolysis resulting in
           degradation of Cup9p and de-repression of PTR2
           transcription
          Length = 201

 Score = 50.4 bits (119), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 29/83 (34%), Positives = 44/83 (53%), Gaps = 2/83 (2%)

Query: 84  EHEIVFNVVTKDHLLKKGVPNHYAASYRGHRFTRENVQILETWYRNHIDNPYLDHNSQQY 143
           EHE+V      + ++  G  +  + S R     +E VQIL  W  +H+ NPY     ++ 
Sbjct: 55  EHEMVEPF--SEGVVSSGKNHKGSRSGRRSNLPKETVQILNRWLLDHLGNPYPTPQEKRD 112

Query: 144 LAQKTNLSKIQIKNWVANRRRKQ 166
           L  KT L+KIQ+ NW  N RR++
Sbjct: 113 LLIKTGLTKIQLSNWFINVRRRK 135

>Kpol_1036.56 s1036 (153997..154794) [798 bp, 265 aa] {ON}
           (153997..154794) [798 nt, 266 aa]
          Length = 265

 Score = 50.8 bits (120), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 42/69 (60%), Gaps = 3/69 (4%)

Query: 115 FTRENVQILETWYRNHIDNPYLDHNSQQYLAQKTNLSKIQIKNWVANRRRKQKSIYISLF 174
             + +VQIL  W  NH+ NPY     ++ L ++T L+KIQ+ NW  N RR++  I+   +
Sbjct: 163 LPKNSVQILNQWLLNHLQNPYPTPQEKKELLKQTGLTKIQLSNWFINVRRRK--IFSDYY 220

Query: 175 DIHNIESGE 183
           DI N ++GE
Sbjct: 221 DIVN-KTGE 228

>CAGL0C01551g Chr3 complement(169232..169897) [666 bp, 221 aa] {ON}
           similar to uniprot|P41817 Saccharomyces cerevisiae
           YPL177c CUP9
          Length = 221

 Score = 49.7 bits (117), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 34/63 (53%)

Query: 104 NHYAASYRGHRFTRENVQILETWYRNHIDNPYLDHNSQQYLAQKTNLSKIQIKNWVANRR 163
           N    S R     ++ +QIL  W  +HI NPY     ++ L  KT L+KIQ+ NW  N R
Sbjct: 71  NMMKKSKRRSNLPKDTIQILNQWLLDHIHNPYPTQQEKRDLLIKTGLTKIQLSNWFINVR 130

Query: 164 RKQ 166
           R++
Sbjct: 131 RRK 133

>NCAS0H01130 Chr8 complement(216012..216854) [843 bp, 280 aa] {ON}
           Anc_6.170 YGL096W
          Length = 280

 Score = 50.1 bits (118), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 24/56 (42%), Positives = 33/56 (58%)

Query: 111 RGHRFTRENVQILETWYRNHIDNPYLDHNSQQYLAQKTNLSKIQIKNWVANRRRKQ 166
           R     +E VQIL TW  NH+ NPY     ++ L  KT L+K+Q+ NW  N RR++
Sbjct: 129 RRSNLPKEMVQILNTWLLNHLQNPYPTSQEKRELLIKTGLTKVQLSNWFINVRRRK 184

>TBLA0C03740 Chr3 complement(892360..893241) [882 bp, 293 aa] {ON}
           Anc_6.170 YPL177C
          Length = 293

 Score = 50.1 bits (118), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 36/81 (44%), Positives = 43/81 (53%), Gaps = 3/81 (3%)

Query: 94  KDHLLKKGVPNHYAASYRGHRFTRENVQILETWYRNHIDNPYLDHNSQQYLAQKTNLSKI 153
           K+H LKK   N Y  S R +   +E VQIL  W  NH+ NPY     +  L   T L+KI
Sbjct: 163 KNHSLKKSKLN-YMVSKRSN-LPKETVQILNDWLLNHLRNPYPTPKEKSELLVLTGLTKI 220

Query: 154 QIKNWVAN-RRRKQKSIYISL 173
           Q+ NW  N RRRK  S Y  L
Sbjct: 221 QLSNWFINVRRRKVFSDYYVL 241

>KAFR0G03650 Chr7 (752766..753299) [534 bp, 177 aa] {ON} Anc_6.170
           YPL177C
          Length = 177

 Score = 48.9 bits (115), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 32/91 (35%), Positives = 47/91 (51%), Gaps = 6/91 (6%)

Query: 90  NVVTKDHLLKKGVP--NHYAASYRGHR--FTRENVQILETWYRNHIDNPYLDHNSQQYLA 145
           N  T + LL +  P  N   +  R  R    +E +QIL  W  NH+ NPY     ++ L 
Sbjct: 47  NRNTIEALLNESSPISNSMDSKSRQSRSNLPKETIQILNAWLLNHLHNPYPTSQEKRDLL 106

Query: 146 QKTNLSKIQIKNWVANRRRKQKSIYISLFDI 176
            KT L+KIQ+ NW  N RR++  I+   +D+
Sbjct: 107 IKTGLTKIQLSNWFINVRRRK--IFNGYYDL 135

>TPHA0B02580 Chr2 (592073..592867) [795 bp, 264 aa] {ON} Anc_6.170
           YPL177C
          Length = 264

 Score = 49.3 bits (116), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 40/70 (57%), Gaps = 3/70 (4%)

Query: 112 GHR--FTRENVQILETWYRNHIDNPYLDHNSQQYLAQKTNLSKIQIKNWVAN-RRRKQKS 168
           G R    +++V +L  W  NH+ NPY     ++ L + T LSKIQ+ NW  N RRRK  +
Sbjct: 155 GKRSNLPKQSVDVLNKWLLNHLGNPYPTPKEKEELLELTGLSKIQLSNWFINVRRRKIFN 214

Query: 169 IYISLFDIHN 178
            Y +L + HN
Sbjct: 215 DYYNLINKHN 224

>KAFR0A04370 Chr1 complement(870590..871819) [1230 bp, 409 aa] {ON}
           Anc_6.170 YPL177C
          Length = 409

 Score = 49.3 bits (116), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 24/59 (40%), Positives = 35/59 (59%), Gaps = 2/59 (3%)

Query: 117 RENVQILETWYRNHIDNPYLDHNSQQYLAQKTNLSKIQIKNWVANRRRKQKSIYISLFD 175
           +E VQIL  W  NH+ NPY     +  L ++T L+KIQ+ NW  N RR++  ++   FD
Sbjct: 277 KETVQILNNWLVNHLGNPYPTAIEKNELLKQTGLTKIQLSNWFINVRRRK--VFTDYFD 333

>KLTH0H05236g Chr8 complement(465998..466702) [705 bp, 234 aa] {ON}
           some similarities with uniprot|P41817 Saccharomyces
           cerevisiae YPL177C CUP9 Homeodomain-containing
           transcriptional repressor of PTR2 which encodes a major
           peptide transporter imported peptides activate
           ubiquitin- dependent proteolysis resulting in
           degradation of Cup9p and de-repression of PTR2
           transcription
          Length = 234

 Score = 48.5 bits (114), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 30/99 (30%), Positives = 45/99 (45%), Gaps = 3/99 (3%)

Query: 115 FTRENVQILETWYRNHIDNPYLDHNSQQYLAQKTNLSKIQIKNWVAN-RRRKQKSIYISL 173
             +E V+IL  W  +H++NPY     ++ L  +T LSK+Q+ NW  N RRRK  S Y  +
Sbjct: 109 LPKETVEILNAWLASHLNNPYPSPQEKRELLVQTGLSKVQLSNWFINVRRRKVFSDYYQM 168

Query: 174 FDIHNIESGEYA--YIEKVCYXXXXXCHLFLVFSLSCLT 210
                  + + A   +            L L F  + LT
Sbjct: 169 SRARRAGAPDEATDAVGAAGAPTATDADLELRFQAAPLT 207

>Kwal_YGOB_matalpha2 s33 (284511..284843) [333 bp, 110 aa] {ON}
           (matalpha2) - mating type alpha2 protein [contig MAT]
           FULL
          Length = 110

 Score = 46.6 bits (109), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 21/45 (46%), Positives = 30/45 (66%)

Query: 123 LETWYRNHIDNPYLDHNSQQYLAQKTNLSKIQIKNWVANRRRKQK 167
           LE W+  +  +PYL       L+++TNLS  QI+NW++NRRRK K
Sbjct: 47  LENWFHLNSSHPYLTRKQISLLSERTNLSSKQIRNWMSNRRRKSK 91

>Kwal_33.12995 s33 (32369..32701) [333 bp, 110 aa] {OFF} YCR096C
           (HMRA2) - Regulatory protein MATa2p (no known function);
           sequence is the same as the last 119 residues of
           MATalpha2p [contig 123] FULL
          Length = 110

 Score = 46.6 bits (109), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 21/45 (46%), Positives = 30/45 (66%)

Query: 123 LETWYRNHIDNPYLDHNSQQYLAQKTNLSKIQIKNWVANRRRKQK 167
           LE W+  +  +PYL       L+++TNLS  QI+NW++NRRRK K
Sbjct: 47  LENWFHLNSSHPYLTRKQISLLSERTNLSSKQIRNWMSNRRRKSK 91

>Kwal_YGOB_HMalpha2 s33 (32369..32701) [333 bp, 110 aa] {ON}
           ANNOTATED BY YGOB - This is Kwal_33.12995
          Length = 110

 Score = 46.6 bits (109), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 21/45 (46%), Positives = 30/45 (66%)

Query: 123 LETWYRNHIDNPYLDHNSQQYLAQKTNLSKIQIKNWVANRRRKQK 167
           LE W+  +  +PYL       L+++TNLS  QI+NW++NRRRK K
Sbjct: 47  LENWFHLNSSHPYLTRKQISLLSERTNLSSKQIRNWMSNRRRKSK 91

>Kwal_33.matalpha2 s33 (284511..284843) [333 bp, 110 aa] {OFF}
           (matalpha2) - mating type alpha2 protein [contig MAT]
           FULL
          Length = 110

 Score = 46.6 bits (109), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 21/45 (46%), Positives = 30/45 (66%)

Query: 123 LETWYRNHIDNPYLDHNSQQYLAQKTNLSKIQIKNWVANRRRKQK 167
           LE W+  +  +PYL       L+++TNLS  QI+NW++NRRRK K
Sbjct: 47  LENWFHLNSSHPYLTRKQISLLSERTNLSSKQIRNWMSNRRRKSK 91

>YGL096W Chr7 (325331..326161) [831 bp, 276 aa] {ON}
           TOS8Homeodomain-containing protein and putative
           transcription factor found associated with chromatin;
           target of SBF transcription factor; induced during
           meiosis and under cell-damaging conditions; similar to
           Cup9p transcription factor
          Length = 276

 Score = 48.5 bits (114), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 28/87 (32%), Positives = 43/87 (49%), Gaps = 9/87 (10%)

Query: 100 KGVPNHYAASYRGHR-------FTRENVQILETWYRNHIDNPYLDHNSQQYLAQKTNLSK 152
           +G  N Y+A  + H+         +  V IL  W   H++NPY     ++ L  KT L+K
Sbjct: 179 RGSNNGYSAKEKKHKAHGKRSNLPKATVSILNKWLHEHVNNPYPTVQEKRELLAKTGLTK 238

Query: 153 IQIKNWVANRRRKQKSIYISLFDIHNI 179
           +QI NW  N RR++  I+    D +N 
Sbjct: 239 LQISNWFINARRRK--IFSGQNDANNF 263

>KNAG0M00500 Chr13 complement(79067..79963) [897 bp, 298 aa] {ON}
           Anc_6.170 YPL177C
          Length = 298

 Score = 47.4 bits (111), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 34/60 (56%), Gaps = 1/60 (1%)

Query: 115 FTRENVQILETWYRNHIDNPYLDHNSQQYLAQKTNLSKIQIKNWVAN-RRRKQKSIYISL 173
             ++ V IL  W  +H+ NPY     ++ L  KT LSKIQ+ NW  N RRRK  S Y SL
Sbjct: 183 LPKDTVLILNRWLLDHLHNPYPTSQEKRELLIKTGLSKIQLSNWFINVRRRKVFSDYYSL 242

>NDAI0F02170 Chr6 (527340..528491) [1152 bp, 383 aa] {ON} Anc_6.170
           YGL096W
          Length = 383

 Score = 47.4 bits (111), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 33/56 (58%)

Query: 111 RGHRFTRENVQILETWYRNHIDNPYLDHNSQQYLAQKTNLSKIQIKNWVANRRRKQ 166
           R     +E ++IL +W  NH+ NPY     ++ L  KT L+K+Q+ NW  N RR++
Sbjct: 266 RRSNLPKETIRILNSWLLNHLQNPYPTSQEKRDLLIKTGLTKVQLSNWFINVRRRK 321

>Smik_7.181 Chr7 (319819..320643) [825 bp, 274 aa] {ON} YGL096W
           (REAL)
          Length = 274

 Score = 47.0 bits (110), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 42/87 (48%), Gaps = 9/87 (10%)

Query: 101 GVPNHYAASYRGHR-------FTRENVQILETWYRNHIDNPYLDHNSQQYLAQKTNLSKI 153
           G  N ++   + H+         +  V IL  W   HI+NPY     ++ L  KT L+K+
Sbjct: 178 GSSNEFSVKEKKHKAHGKRTNLPKATVSILNKWLLEHINNPYPTVQEKRELLAKTGLTKL 237

Query: 154 QIKNWVANRRRKQKSIYISLFDIHNIE 180
           QI NW  N RR++  I+    D +N +
Sbjct: 238 QISNWFINARRRK--IFSGQNDANNFK 262

>KNAG0F02210 Chr6 complement(423243..424217) [975 bp, 324 aa] {ON}
           Anc_6.170 YPL177C
          Length = 324

 Score = 46.6 bits (109), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 32/50 (64%)

Query: 117 RENVQILETWYRNHIDNPYLDHNSQQYLAQKTNLSKIQIKNWVANRRRKQ 166
           RE VQ+L  W  NH+ +PY   + +  L ++T L+KIQ+ NW  N RR++
Sbjct: 248 RETVQMLNNWLLNHLHDPYPTPHEKLELLRQTGLTKIQLSNWFINVRRRK 297

>Skud_7.181 Chr7 (328628..329449) [822 bp, 274 aa] {ON} YGL096W
           (REAL)
          Length = 274

 Score = 46.2 bits (108), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 39/74 (52%), Gaps = 6/74 (8%)

Query: 111 RGH----RFTRENVQILETWYRNHIDNPYLDHNSQQYLAQKTNLSKIQIKNWVANRRRKQ 166
           +GH       +  V IL  W   HI NPY     ++ L  KT L+K+QI NW  N RR++
Sbjct: 191 KGHGKRSNLPKATVCILNQWLLEHIHNPYPTVQEKRDLLAKTGLTKLQISNWFINARRRK 250

Query: 167 KSIYISLFDIHNIE 180
             I+    D++N++
Sbjct: 251 --IFAGHNDVNNLK 262

>KLTH0F00396g Chr6 (31990..32051,32348..32612) [327 bp, 108 aa] {ON}
           conserved hypothetical protein
          Length = 108

 Score = 43.5 bits (101), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 36/60 (60%)

Query: 108 ASYRGHRFTRENVQILETWYRNHIDNPYLDHNSQQYLAQKTNLSKIQIKNWVANRRRKQK 167
           AS +  +F     + LE W+ ++I  PY +      L++ TNLS  QI+NW++NRRRK +
Sbjct: 35  ASGKQRKFNATAKKRLERWFCSNIQYPYPNKIQILSLSKNTNLSIKQIQNWMSNRRRKSR 94

>NCAS0D03570 Chr4 (664388..665161) [774 bp, 257 aa] {ON} Anc_6.170
           YGL096W
          Length = 257

 Score = 45.1 bits (105), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 31/52 (59%)

Query: 115 FTRENVQILETWYRNHIDNPYLDHNSQQYLAQKTNLSKIQIKNWVANRRRKQ 166
             R  V++L  W   H++NPY +   ++ L + T L+K+Q+ NW  N RR++
Sbjct: 187 LPRGTVEVLNGWLLEHLNNPYPNVQEKKLLLELTGLTKVQLSNWFINVRRRK 238

>NDAI0I01320 Chr9 complement(318160..319389) [1230 bp, 409 aa] {ON}
           Anc_6.170 YGL096W
          Length = 409

 Score = 45.1 bits (105), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 20/47 (42%), Positives = 30/47 (63%)

Query: 120 VQILETWYRNHIDNPYLDHNSQQYLAQKTNLSKIQIKNWVANRRRKQ 166
           VQIL  W  +H+ NPY     ++ L ++T L+KIQ+ NW  N RR++
Sbjct: 317 VQILNEWLLDHLTNPYPTTQEKKELLKQTGLTKIQLSNWFINVRRRK 363

>SAKL0A05610g Chr1 complement(506437..507399) [963 bp, 320 aa] {ON}
           some similarities with uniprot|P41817 Saccharomyces
           cerevisiae YPL177C CUP9 Homeodomain-containing
           transcriptional repressor of PTR2 which encodes a major
           peptide transporter imported peptides activate
           ubiquitin- dependent proteolysis resulting in
           degradation of Cup9p and de-repression of PTR2
           transcription
          Length = 320

 Score = 44.7 bits (104), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 32/60 (53%)

Query: 107 AASYRGHRFTRENVQILETWYRNHIDNPYLDHNSQQYLAQKTNLSKIQIKNWVANRRRKQ 166
           + S +     +E VQIL  W   H+ NPY     ++ L  KT L+ +Q+ NW  N RR++
Sbjct: 205 SPSNKRTNLPKETVQILNNWLLAHLHNPYPSPQEKRELLLKTGLNPVQLSNWFINVRRRK 264

>Kwal_27.11092 s27 (635052..635741) [690 bp, 229 aa] {ON} YPL177C
           (CUP9) - putative DNA binding protein which shows
           similarity in homeobox domain to human proto-oncogene
           PBX1 [contig 31] FULL
          Length = 229

 Score = 43.9 bits (102), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 32/60 (53%), Gaps = 1/60 (1%)

Query: 115 FTRENVQILETWYRNHIDNPYLDHNSQQYLAQKTNLSKIQIKNWVAN-RRRKQKSIYISL 173
             +E V IL  W   H++ PY     ++ L  KT LSK+Q+ NW  N RRRK  S Y  +
Sbjct: 125 LPKETVDILNNWLLAHLNYPYPSPQEKRELLIKTGLSKVQLSNWFINVRRRKVFSDYYPM 184

>Suva_7.172 Chr7 (319317..320129) [813 bp, 270 aa] {ON} YGL096W
           (REAL)
          Length = 270

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 20/47 (42%), Positives = 28/47 (59%)

Query: 120 VQILETWYRNHIDNPYLDHNSQQYLAQKTNLSKIQIKNWVANRRRKQ 166
           V IL  W   HI+NPY     ++ L  +T L+K+QI NW  N RR++
Sbjct: 206 VHILNKWLLEHINNPYPTLQEKRELLAQTGLTKLQISNWFINARRRK 252

>KLLA0B10450g Chr2 (912877..914046) [1170 bp, 389 aa] {ON} some
           similarities with uniprot|P41817 Saccharomyces
           cerevisiae YPL177C CUP9 Homeodomain-containing
           transcriptional repressor of PTR2 which encodes a major
           peptide transporter imported peptides activate
           ubiquitin- dependent proteolysis resulting in
           degradation of Cup9p and de-repression of PTR2
           transcription
          Length = 389

 Score = 38.1 bits (87), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 29/52 (55%)

Query: 115 FTRENVQILETWYRNHIDNPYLDHNSQQYLAQKTNLSKIQIKNWVANRRRKQ 166
             +E + +L  W   ++ NPY     ++ L +KT L+ +Q+ NW  N RR++
Sbjct: 256 LPKEVINVLNDWLLKNLHNPYPTPQVKRELLEKTGLNPVQLSNWFINVRRRK 307

>Skud_71.2 Chr71 (734..868) [135 bp, 45 aa] {ON} YCL067C (REAL)
          Length = 45

 Score = 32.0 bits (71), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 15/37 (40%), Positives = 23/37 (62%)

Query: 5  SRISITHLLNPIQEENLKEKLQEINNQLISLCSSLPK 41
          ++I I  LLNP   +  K  + +IN +L S+C +LPK
Sbjct: 2  NKIPIKDLLNPQITDEFKSNILDINKKLFSICCNLPK 38

>NDAI0A00670 Chr1
           complement(124998..125033,125093..125308,125369..125404)
           [288 bp, 95 aa] {ON}
          Length = 95

 Score = 30.0 bits (66), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 13/52 (25%), Positives = 31/52 (59%), Gaps = 3/52 (5%)

Query: 116 TRENVQILETWYRNHIDNPYLDHNSQQYLAQKTNLSKIQIKNWVANRRRKQK 167
           ++EN  +LE  ++     P+L+   ++++A+   +S +Q++ W  N+R + K
Sbjct: 45  SKENKLLLENIFQKK---PWLNTKEREFVAKSCGMSALQVRVWFINKRMRTK 93

>NDAI0H00100 Chr8 complement(758..793,853..1068,1129..1164) [288 bp,
           95 aa] {ON} silent copy of MATa1 gene at HMRa
          Length = 95

 Score = 30.0 bits (66), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 13/52 (25%), Positives = 31/52 (59%), Gaps = 3/52 (5%)

Query: 116 TRENVQILETWYRNHIDNPYLDHNSQQYLAQKTNLSKIQIKNWVANRRRKQK 167
           ++EN  +LE  ++     P+L+   ++++A+   +S +Q++ W  N+R + K
Sbjct: 45  SKENKLLLENIFQKK---PWLNTKEREFVAKSCGMSALQVRVWFINKRMRTK 93

>KLTH0G04884g Chr7 (389220..398984) [9765 bp, 3254 aa] {ON} similar to
            uniprot|Q7LIK7 Saccharomyces cerevisiae YDR457W TOM1
            Temperature dependent Organization in Mitotic nucleus
          Length = 3254

 Score = 30.0 bits (66), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 31/94 (32%), Positives = 43/94 (45%), Gaps = 4/94 (4%)

Query: 1    MSKKSRISITHLLNPIQEENLKEKLQEINNQLISLCSSLPKRQSLPGPSSDILRFLSRNN 60
            +S  SR +   L+NP+    L+E    I NQL S  SS   R  LP   SDIL F     
Sbjct: 2154 LSTGSRGTRGILMNPLGPSGLEEVENGILNQLTSTGSSSRPRNELPH-LSDIL-FSGEFF 2211

Query: 61   LDPQEIGLI--KTTYRLSTLLSKLREHEIVFNVV 92
             +   +G++   TT R S +     + +I  N V
Sbjct: 2212 DEKSSVGIVLKSTTARWSDIFDMFYDSKIYANNV 2245

>CAGL0H05291g Chr8 complement(509813..511519) [1707 bp, 568 aa] {ON}
           similar to uniprot|Q02866 Saccharomyces cerevisiae
           YPL070w
          Length = 568

 Score = 29.3 bits (64), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 31/112 (27%), Positives = 50/112 (44%), Gaps = 11/112 (9%)

Query: 21  LKEKLQEINNQLISLCSSLPKRQSLPGPSSDILRFLSRNNLDPQEIGLIKTTYRLSTLLS 80
           +K+KL  ++++L ++ +       + G + D L  L R+NL  +E  L          L 
Sbjct: 390 IKKKL--VDSELFAITNLEAALVFIEGLTLDDLPQLLRDNLTDREKSLFAVPISRKVKLP 447

Query: 81  KLREHEIVFNVVTKDHLLKKGVPNHYAASYRGHRFTRENVQILETWYRNHID 132
           +L  HEI    + KD  L K +     ASY G R       + ++  RN ID
Sbjct: 448 ELGRHEI---DIEKDAELTKRIEVSRTASYEGFR------SVFDSSLRNIID 490

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.134    0.394 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 22,652,257
Number of extensions: 978914
Number of successful extensions: 3628
Number of sequences better than 10.0: 97
Number of HSP's gapped: 3678
Number of HSP's successfully gapped: 102
Length of query: 210
Length of database: 53,481,399
Length adjustment: 105
Effective length of query: 105
Effective length of database: 41,441,469
Effective search space: 4351354245
Effective search space used: 4351354245
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 63 (28.9 bits)