Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
CAGL0B00242g1.1ON1841849881e-138
CAGL0B01243g1.120ON1431437691e-105
ZYRO0F18590g1.1ON2001422712e-29
ZYRO0F15840g1.120ON2001422712e-29
TDEL0C070101.1ON2051382687e-29
Kpol_2002.21.1ON2091852294e-23
TBLA0A070401.120ON2011492251e-22
TBLA0A075901.1ON2011492251e-22
Smik_92.1singletonON1561582184e-22
Suva_3.1481.1ON1751372189e-22
YCR040W (MATALPHA1)1.120ON175892153e-21
YCL066W (HMLALPHA1)1.1ON175892153e-21
TPHA0E036201.120ON1951772146e-21
TPHA0E040801.1ON1951772146e-21
Skud_71.1singletonON155612021e-19
Suva_69.2singletonON1451292002e-19
Skud_3.1191.120ON174612022e-19
NCAS0B091501.1ON150581496e-12
KLLA0C00352g1.1ON2611391423e-10
KNAG0C001501.1ON145481321e-09
NDAI0A001001.1ON135571312e-09
Kwal_33.matalpha1singletonOFF2441691343e-09
Kwal_33.12992singletonOFF2441691343e-09
Kwal_YGOB_matalpha11.120ON2441691343e-09
Kwal_YGOB_HMalpha11.1ON2441691343e-09
KAFR0D007101.120ON172511253e-08
Ecym_10031.1ON2631011203e-07
Ecym_11141.120ON2631011203e-07
KLTH0F00374g1.1ON2491271176e-07
KNAG0H007203.354ON51660682.0
SAKL0B07656g3.354ON30858654.4
KLLA0D07414gna 1ON69660654.4
NCAS0A111203.354ON37259654.6
SAKL0A02596g6.289ON63453645.9
TDEL0D00130singletonON15350626.3
NDAI0G019207.211ON34888636.8
NCAS0A064504.385ON60939638.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0B00242g
         (184 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0B00242g Chr2 complement(10582..11136) [555 bp, 184 aa] {ON}...   385   e-138
CAGL0B01243g Chr2 complement(112831..113262) [432 bp, 143 aa] {O...   300   e-105
ZYRO0F18590g Chr6 (1533781..1534383) [603 bp, 200 aa] {ON} simil...   108   2e-29
ZYRO0F15840g Chr6 (1303842..1304444) [603 bp, 200 aa] {ON} simil...   108   2e-29
TDEL0C07010 Chr3 (1274648..1275265) [618 bp, 205 aa] {ON} Anc_1....   107   7e-29
Kpol_2002.2 s2002 complement(3611..4240) [630 bp, 209 aa] {ON} c...    93   4e-23
TBLA0A07040 Chr1 complement(1727988..1728593) [606 bp, 201 aa] {...    91   1e-22
TBLA0A07590 Chr1 complement(1881757..1882362) [606 bp, 201 aa] {...    91   1e-22
Smik_92.1 Chr92 complement(3..470) [468 bp, 156 aa] {ON} YCR040W...    89   4e-22
Suva_3.148 Chr3 (222811..223338) [528 bp, 175 aa] {ON} YCL066W (...    89   9e-22
YCR040W Chr3 (200442..200969) [528 bp, 175 aa] {ON}  MATALPHA1Tr...    87   3e-21
YCL066W Chr3 (13282..13809) [528 bp, 175 aa] {ON}  HMLALPHA1Sile...    87   3e-21
TPHA0E03620 Chr5 (766068..766655) [588 bp, 195 aa] {ON} Anc_1.12...    87   6e-21
TPHA0E04080 Chr5 (850045..850632) [588 bp, 195 aa] {ON}   silenc...    87   6e-21
Skud_71.1 Chr71 complement(3..467) [465 bp, 155 aa] {ON} YCR040W...    82   1e-19
Suva_69.2 Chr69 (369..803) [435 bp, 145 aa] {ON} YCL066W (REAL)        82   2e-19
Skud_3.119 Chr3 (184941..185465) [525 bp, 174 aa] {ON} YCR040W (...    82   2e-19
NCAS0B09150 Chr2 (1755595..1756047) [453 bp, 150 aa] {ON} Anc_1.1      62   6e-12
KLLA0C00352g Chr3 complement(24124..24909) [786 bp, 261 aa] {ON}...    59   3e-10
KNAG0C00150 Chr3 complement(24902..25339) [438 bp, 145 aa] {ON} ...    55   1e-09
NDAI0A00100 Chr1 complement(783..1190) [408 bp, 135 aa] {ON} Anc...    55   2e-09
Kwal_33.matalpha1 s33 complement(283160..283894) [735 bp, 244 aa...    56   3e-09
Kwal_33.12992 s33 complement(31018..31752) [735 bp, 244 aa] {OFF...    56   3e-09
Kwal_YGOB_matalpha1 s33 complement(283160..283894) [735 bp, 244 ...    56   3e-09
Kwal_YGOB_HMalpha1 s33 complement(31018..31752) [735 bp, 244 aa]...    56   3e-09
KAFR0D00710 Chr4 complement(127819..128337) [519 bp, 172 aa] {ON...    53   3e-08
Ecym_1003 Chr1 (6314..7105) [792 bp, 263 aa] {ON} similar to Sac...    51   3e-07
Ecym_1114 Chr1 complement(236238..237029) [792 bp, 263 aa] {ON} ...    51   3e-07
KLTH0F00374g Chr6 complement(30927..31676) [750 bp, 249 aa] {ON}...    50   6e-07
KNAG0H00720 Chr8 (114623..116173) [1551 bp, 516 aa] {ON} Anc_3.3...    31   2.0  
SAKL0B07656g Chr2 (655693..656619) [927 bp, 308 aa] {ON} similar...    30   4.4  
KLLA0D07414g Chr4 complement(635851..637941) [2091 bp, 696 aa] {...    30   4.4  
NCAS0A11120 Chr1 (2209565..2210683) [1119 bp, 372 aa] {ON} Anc_3...    30   4.6  
SAKL0A02596g Chr1 complement(235391..237295) [1905 bp, 634 aa] {...    29   5.9  
TDEL0D00130 Chr4 (14810..15271) [462 bp, 153 aa] {ON}                  28   6.3  
NDAI0G01920 Chr7 (434073..435119) [1047 bp, 348 aa] {ON} Anc_7.2...    29   6.8  
NCAS0A06450 Chr1 (1273459..1275288) [1830 bp, 609 aa] {ON} Anc_4...    29   8.6  

>CAGL0B00242g Chr2 complement(10582..11136) [555 bp, 184 aa] {ON}
           some similarities with uniprot|P01365 Saccharomyces
           cerevisiae YCR040w MATALPHA1 mating type regulatory
           protein or uniprot|P01365 Saccharomyces cerevisiae
           YCL066w HMLALPHA1
          Length = 184

 Score =  385 bits (988), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 184/184 (100%), Positives = 184/184 (100%)

Query: 1   MKYTATKFRVRTNKRLRSQKYPEKHSDFLGCSSTKSSFGLNMLLTKPNKFQIPPPHPVLL 60
           MKYTATKFRVRTNKRLRSQKYPEKHSDFLGCSSTKSSFGLNMLLTKPNKFQIPPPHPVLL
Sbjct: 1   MKYTATKFRVRTNKRLRSQKYPEKHSDFLGCSSTKSSFGLNMLLTKPNKFQIPPPHPVLL 60

Query: 61  KRIREERMKLTSSFESGINIIDIETSWEIDKFISHHFNTSIGNVLKSKSSSKKRPMNAFM 120
           KRIREERMKLTSSFESGINIIDIETSWEIDKFISHHFNTSIGNVLKSKSSSKKRPMNAFM
Sbjct: 61  KRIREERMKLTSSFESGINIIDIETSWEIDKFISHHFNTSIGNVLKSKSSSKKRPMNAFM 120

Query: 121 AFRTYYAQLGTGLKQNTLSVILSEAWNAPETDQNIWDIFAQQFNFASPRCGFVNYIMAHA 180
           AFRTYYAQLGTGLKQNTLSVILSEAWNAPETDQNIWDIFAQQFNFASPRCGFVNYIMAHA
Sbjct: 121 AFRTYYAQLGTGLKQNTLSVILSEAWNAPETDQNIWDIFAQQFNFASPRCGFVNYIMAHA 180

Query: 181 SSAP 184
           SSAP
Sbjct: 181 SSAP 184

>CAGL0B01243g Chr2 complement(112831..113262) [432 bp, 143 aa] {ON}
           some similarities with uniprot|P01365 Saccharomyces
           cerevisiae YCR040w MATALPHA1 expressed copy at MAT locus
           or uniprot|P01365 Saccharomyces cerevisiae YCL066w
           HMLALPHA1 silenced copy at HML
          Length = 143

 Score =  300 bits (769), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 143/143 (100%), Positives = 143/143 (100%)

Query: 42  MLLTKPNKFQIPPPHPVLLKRIREERMKLTSSFESGINIIDIETSWEIDKFISHHFNTSI 101
           MLLTKPNKFQIPPPHPVLLKRIREERMKLTSSFESGINIIDIETSWEIDKFISHHFNTSI
Sbjct: 1   MLLTKPNKFQIPPPHPVLLKRIREERMKLTSSFESGINIIDIETSWEIDKFISHHFNTSI 60

Query: 102 GNVLKSKSSSKKRPMNAFMAFRTYYAQLGTGLKQNTLSVILSEAWNAPETDQNIWDIFAQ 161
           GNVLKSKSSSKKRPMNAFMAFRTYYAQLGTGLKQNTLSVILSEAWNAPETDQNIWDIFAQ
Sbjct: 61  GNVLKSKSSSKKRPMNAFMAFRTYYAQLGTGLKQNTLSVILSEAWNAPETDQNIWDIFAQ 120

Query: 162 QFNFASPRCGFVNYIMAHASSAP 184
           QFNFASPRCGFVNYIMAHASSAP
Sbjct: 121 QFNFASPRCGFVNYIMAHASSAP 143

>ZYRO0F18590g Chr6 (1533781..1534383) [603 bp, 200 aa] {ON} similar
           to uniprot|P01365 Saccharomyces cerevisiae YCR040W
           MATALPHA1 Transcriptional co-activator involved in
           regulation of mating-type-specific gene expression
           targets the transcription factor Mcm1p to the promoters
           of alpha- specific genes one of two genes encoded by the
           alpha mating type cassette
          Length = 200

 Score =  108 bits (271), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 61/142 (42%), Positives = 86/142 (60%), Gaps = 7/142 (4%)

Query: 40  LNMLLTKPNKFQIPPPHPVLLKRIREERMKLTSSFESGINII--DIETSWEIDKFISHHF 97
           +N+ +T     +IP P  VLL++I EE+ KL     +  NI+  D    W    F S   
Sbjct: 51  VNVFMTVSKLIKIPSPPEVLLRKIEEEKHKLKKDDFNMDNILLWDPYVYWGEGYFFSIA- 109

Query: 98  NTSIGNVLKSKSSSK---KRPMNAFMAFRTYYAQLGTGLKQNTLSVILSEAWNAPETDQN 154
           ++S+ N L +K S K   ++P+N+FMAFR Y +Q G GLKQN LS +L+ AW++    Q 
Sbjct: 110 DSSLNN-LSTKGSRKGCSEKPLNSFMAFRAYNSQFGNGLKQNILSSLLAAAWHSHPEQQK 168

Query: 155 IWDIFAQQFNFASPRCGFVNYI 176
           IWD FAQQFNF  P+CGFV ++
Sbjct: 169 IWDTFAQQFNFVKPKCGFVEWV 190

>ZYRO0F15840g Chr6 (1303842..1304444) [603 bp, 200 aa] {ON} similar
           to uniprot|P01365 Saccharomyces cerevisiae YCR040W
           MATALPHA1 Transcriptional co-activator involved in
           regulation of mating-type-specific gene expression
           targets the transcription factor Mcm1p to the promoters
           of alpha- specific genes one of two genes encoded by the
           alpha mating type cassette
          Length = 200

 Score =  108 bits (271), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 61/142 (42%), Positives = 86/142 (60%), Gaps = 7/142 (4%)

Query: 40  LNMLLTKPNKFQIPPPHPVLLKRIREERMKLTSSFESGINII--DIETSWEIDKFISHHF 97
           +N+ +T     +IP P  VLL++I EE+ KL     +  NI+  D    W    F S   
Sbjct: 51  VNVFMTVSKLIKIPSPPEVLLRKIEEEKHKLKKDDFNMDNILLWDPYVYWGEGYFFSIA- 109

Query: 98  NTSIGNVLKSKSSSK---KRPMNAFMAFRTYYAQLGTGLKQNTLSVILSEAWNAPETDQN 154
           ++S+ N L +K S K   ++P+N+FMAFR Y +Q G GLKQN LS +L+ AW++    Q 
Sbjct: 110 DSSLNN-LSTKGSRKGCSEKPLNSFMAFRAYNSQFGNGLKQNILSSLLAAAWHSHPEQQK 168

Query: 155 IWDIFAQQFNFASPRCGFVNYI 176
           IWD FAQQFNF  P+CGFV ++
Sbjct: 169 IWDTFAQQFNFVKPKCGFVEWV 190

>TDEL0C07010 Chr3 (1274648..1275265) [618 bp, 205 aa] {ON} Anc_1.121
           YCR040W silenced copy of alpha1 gene at T. delbrueckii
           HML locus
          Length = 205

 Score =  107 bits (268), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 52/138 (37%), Positives = 87/138 (63%), Gaps = 5/138 (3%)

Query: 42  MLLTKPNKFQIPPPHPVLLKRIREERMKLTSSFESGI-NIIDIETSWEIDKFISHHFNTS 100
           +++ +P K  +PP   +LL++I +E+ K+ S     I ++ D   +W+ +  +    +  
Sbjct: 62  VVILRPIKIPLPPN--ILLEKIEQEKRKVYSETSPEIGSLWDSPIAWDNEDLLFSIASDV 119

Query: 101 IGNVLK--SKSSSKKRPMNAFMAFRTYYAQLGTGLKQNTLSVILSEAWNAPETDQNIWDI 158
           +GN+ K  ++ ++  +P+N+FMAFR Y +Q G GLKQN LS +L+ AW++    Q IWD 
Sbjct: 120 LGNIYKKPARETASNKPLNSFMAFRAYNSQFGYGLKQNILSSLLASAWHSHPEQQGIWDT 179

Query: 159 FAQQFNFASPRCGFVNYI 176
           FAQQFNF  P+CGFV ++
Sbjct: 180 FAQQFNFVKPKCGFVEWV 197

>Kpol_2002.2 s2002 complement(3611..4240) [630 bp, 209 aa] {ON}
           complement(3611..4240) [630 nt, 210 aa]
          Length = 209

 Score = 92.8 bits (229), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 66/185 (35%), Positives = 103/185 (55%), Gaps = 17/185 (9%)

Query: 8   FRVRTNK--RLRSQKYPEKHSDFLGCSSTKSS--FGLNMLLTKPNKFQIP-PPHPVLL-- 60
           F+V+ NK  ++  QK      + L  S+ K S    +N+ +T     +IP PP  +LL  
Sbjct: 14  FKVKLNKSNKIEKQKKKGIAINKLANSAGKLSQKANVNVFITNSLVTKIPFPPSSLLLGI 73

Query: 61  --KRIREERMKLTSSFESGINIIDIETSW-EIDKFISHH------FNTSIGNVLKSKSSS 111
             +  + +  K + + ++  NI++  +SW E D F+S         +TS  +V++  +SS
Sbjct: 74  DEETKKMKSKKTSINIQNDTNILNFSSSWDEDDLFLSDTETEYDLLSTSPNSVIEVDTSS 133

Query: 112 KKRPMNAFMAFRTYYAQLGTGLKQNTLSVILSEAWNAPETDQNIWDIFAQQFNFASPRCG 171
           KK  +N FMAFR Y +Q G GLKQ  LS +LSEAW++    Q  W + +QQFNF  P+CG
Sbjct: 134 KKS-LNGFMAFRAYNSQFGYGLKQEILSSLLSEAWHSDPEQQKKWTVLSQQFNFVKPKCG 192

Query: 172 FVNYI 176
           FV ++
Sbjct: 193 FVEWV 197

>TBLA0A07040 Chr1 complement(1727988..1728593) [606 bp, 201 aa] {ON}
            MATalpha1 gene at MAT locus
          Length = 201

 Score = 91.3 bits (225), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 50/149 (33%), Positives = 81/149 (54%), Gaps = 12/149 (8%)

Query: 39  GLNMLLTKPNKFQIPPPHPVLLKRIREERMKLTSSFESGIN--IIDIETSWEIDKFISHH 96
           G+++LL K +  +IP P   LL  I  E+ K+ S+ +  +N   +D + ++  D F    
Sbjct: 42  GISILLYKNHNIKIPFPPTTLLYNIEVEKQKIIST-QHMLNEYTMDNDDNYLSDLFYEDE 100

Query: 97  FNTS---------IGNVLKSKSSSKKRPMNAFMAFRTYYAQLGTGLKQNTLSVILSEAWN 147
           +N +                   + +R +N F+AFR Y +Q G GLKQN LS +LS AW+
Sbjct: 101 YNDNNSLFDNGFPNNVNSNPNPVNSERVLNGFIAFRAYNSQFGYGLKQNILSSLLSTAWH 160

Query: 148 APETDQNIWDIFAQQFNFASPRCGFVNYI 176
                QN+W+ F+Q++NF  P+CGFV ++
Sbjct: 161 ENPNQQNVWNFFSQEYNFVKPKCGFVEWL 189

>TBLA0A07590 Chr1 complement(1881757..1882362) [606 bp, 201 aa] {ON}
           Anc_1.1 YCL066W silenced copy of alpha1 gene at HML
           locus
          Length = 201

 Score = 91.3 bits (225), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 50/149 (33%), Positives = 81/149 (54%), Gaps = 12/149 (8%)

Query: 39  GLNMLLTKPNKFQIPPPHPVLLKRIREERMKLTSSFESGIN--IIDIETSWEIDKFISHH 96
           G+++LL K +  +IP P   LL  I  E+ K+ S+ +  +N   +D + ++  D F    
Sbjct: 42  GISILLYKNHNIKIPFPPTTLLYNIEVEKQKIIST-QHMLNEYTMDNDDNYLSDLFYEDE 100

Query: 97  FNTS---------IGNVLKSKSSSKKRPMNAFMAFRTYYAQLGTGLKQNTLSVILSEAWN 147
           +N +                   + +R +N F+AFR Y +Q G GLKQN LS +LS AW+
Sbjct: 101 YNDNNSLFDNGFPNNVNSNPNPVNSERVLNGFIAFRAYNSQFGYGLKQNILSSLLSTAWH 160

Query: 148 APETDQNIWDIFAQQFNFASPRCGFVNYI 176
                QN+W+ F+Q++NF  P+CGFV ++
Sbjct: 161 ENPNQQNVWNFFSQEYNFVKPKCGFVEWL 189

>Smik_92.1 Chr92 complement(3..470) [468 bp, 156 aa] {ON} YCR040W
           (REAL)
          Length = 156

 Score = 88.6 bits (218), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 54/158 (34%), Positives = 89/158 (56%), Gaps = 21/158 (13%)

Query: 33  STKSSFGLNMLLTKPNKFQIPPPHPVLLKRIREERMKLTSSFESGINII-----DIET-- 85
           ++K +F +N  ++K ++      +PV+ K+I+E R+       +  N+I     DI+   
Sbjct: 3   TSKPAFRINNKISKSHR------NPVVSKKIKERRITKHVK-PNCFNVIRPLKKDIQIPI 55

Query: 86  -------SWEIDKFISHHFNTSIGNVLKSKSSSKKRPMNAFMAFRTYYAQLGTGLKQNTL 138
                    +I +  S + +     + K+   S K+ +N+FMAFR YY+Q G+G+KQN L
Sbjct: 56  PSSRFLKKIQIHRIASGNQHIQCRQLNKTSIKSTKKYLNSFMAFRAYYSQFGSGVKQNIL 115

Query: 139 SVILSEAWNAPETDQNIWDIFAQQFNFASPRCGFVNYI 176
           S +LSE W+A +T   IWD FAQQ+NF +P  GFV ++
Sbjct: 116 SSLLSEEWHADKTQHGIWDYFAQQYNFINPGFGFVEWL 153

>Suva_3.148 Chr3 (222811..223338) [528 bp, 175 aa] {ON} YCL066W
           (REAL)
          Length = 175

 Score = 88.6 bits (218), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 50/137 (36%), Positives = 70/137 (51%), Gaps = 24/137 (17%)

Query: 40  LNMLLTKPNKFQIPPPHPVLLKRIREERMKLTSSFESGINIIDIETSWEIDKFISHHFNT 99
            N++       QIP P P+ LK+I+  R+       SG   I    S             
Sbjct: 41  FNIIRPLKKNIQIPAPSPLFLKKIQLYRI------ASGNQNIQCRQS------------- 81

Query: 100 SIGNVLKSKSSSKKRPMNAFMAFRTYYAQLGTGLKQNTLSVILSEAWNAPETDQNIWDIF 159
                 K+  +  K+ +N+FMAFR YY+Q G G+KQN LS +LSE W+A +    IWD F
Sbjct: 82  -----RKASITPSKKYLNSFMAFRAYYSQFGAGVKQNILSSLLSEEWHADKMQHGIWDYF 136

Query: 160 AQQFNFASPRCGFVNYI 176
           AQQ+NF +P  GFV ++
Sbjct: 137 AQQYNFINPGFGFVEWL 153

>YCR040W Chr3 (200442..200969) [528 bp, 175 aa] {ON}
           MATALPHA1Transcriptional co-activator involved in
           regulation of mating-type-specific gene expression;
           targets the transcription factor Mcm1p to the promoters
           of alpha-specific genes; one of two genes encoded by the
           MATalpha mating type cassette
          Length = 175

 Score = 87.4 bits (215), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 40/89 (44%), Positives = 57/89 (64%)

Query: 88  EIDKFISHHFNTSIGNVLKSKSSSKKRPMNAFMAFRTYYAQLGTGLKQNTLSVILSEAWN 147
           +I +  S   NT      K+   S K+ +N+FMAFR YY+Q G+G+KQN LS +L+E W+
Sbjct: 65  QIHRIASGSQNTQFRQFNKTSIKSSKKYLNSFMAFRAYYSQFGSGVKQNVLSSLLAEEWH 124

Query: 148 APETDQNIWDIFAQQFNFASPRCGFVNYI 176
           A +    IWD FAQQ+NF +P  GFV ++
Sbjct: 125 ADKMQHGIWDYFAQQYNFINPGFGFVEWL 153

>YCL066W Chr3 (13282..13809) [528 bp, 175 aa] {ON}
           HMLALPHA1Silenced copy of ALPHA1 at HML, encoding a
           transcriptional coactivator involved in the regulation
           of mating-type alpha-specific gene expression
          Length = 175

 Score = 87.4 bits (215), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 40/89 (44%), Positives = 57/89 (64%)

Query: 88  EIDKFISHHFNTSIGNVLKSKSSSKKRPMNAFMAFRTYYAQLGTGLKQNTLSVILSEAWN 147
           +I +  S   NT      K+   S K+ +N+FMAFR YY+Q G+G+KQN LS +L+E W+
Sbjct: 65  QIHRIASGSQNTQFRQFNKTSIKSSKKYLNSFMAFRAYYSQFGSGVKQNVLSSLLAEEWH 124

Query: 148 APETDQNIWDIFAQQFNFASPRCGFVNYI 176
           A +    IWD FAQQ+NF +P  GFV ++
Sbjct: 125 ADKMQHGIWDYFAQQYNFINPGFGFVEWL 153

>TPHA0E03620 Chr5 (766068..766655) [588 bp, 195 aa] {ON} Anc_1.121
           YCR040W MATalpha1 gene at MAT locus
          Length = 195

 Score = 87.0 bits (214), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 61/177 (34%), Positives = 98/177 (55%), Gaps = 13/177 (7%)

Query: 8   FRVRTNK-RLRSQKYPEKHSDFLGCSSTKSSFGLNMLLTKPNKFQIPPPHPVLLKRIREE 66
           F+V  NK R+RS K  + H + +     +S    +  + +  K +IP P   LL+ I  E
Sbjct: 13  FKVSLNKKRIRSIKI-KTHKNNVQLKKQRS----HQFIAENFKLKIPYPPTCLLRSIDAE 67

Query: 67  --RMKLTSSFES-GIN-IIDIETSWEIDKFISHH-FNTSIGNVLKSKSSSK--KRPMNAF 119
             R+++  S  +  +N + ++E +W+ D  +S    N  I  +  S       K+ +N+F
Sbjct: 68  LRRIEIKKSIVAQDVNSLFNVELTWDEDNVLSDDDINDDIAYINYSSEEELLFKKSLNSF 127

Query: 120 MAFRTYYAQLGTGLKQNTLSVILSEAWNAPETDQNIWDIFAQQFNFASPRCGFVNYI 176
           +AFR Y AQ G GL Q+ LS +LS AW++     ++WD+FAQQFNF  P+CGFV ++
Sbjct: 128 IAFRAYNAQFGNGLNQHLLSHLLSLAWHSAPEQHHVWDVFAQQFNFVKPKCGFVEWV 184

>TPHA0E04080 Chr5 (850045..850632) [588 bp, 195 aa] {ON}   silenced
           copy of alpha1 at HMLalpha locus
          Length = 195

 Score = 87.0 bits (214), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 61/177 (34%), Positives = 98/177 (55%), Gaps = 13/177 (7%)

Query: 8   FRVRTNK-RLRSQKYPEKHSDFLGCSSTKSSFGLNMLLTKPNKFQIPPPHPVLLKRIREE 66
           F+V  NK R+RS K  + H + +     +S    +  + +  K +IP P   LL+ I  E
Sbjct: 13  FKVSLNKKRIRSIKI-KTHKNNVQLKKQRS----HQFIAENFKLKIPYPPTCLLRSIDAE 67

Query: 67  --RMKLTSSFES-GIN-IIDIETSWEIDKFISHH-FNTSIGNVLKSKSSSK--KRPMNAF 119
             R+++  S  +  +N + ++E +W+ D  +S    N  I  +  S       K+ +N+F
Sbjct: 68  LRRIEIKKSIVAQDVNSLFNVELTWDEDNVLSDDDINDDIAYINYSSEEELLFKKSLNSF 127

Query: 120 MAFRTYYAQLGTGLKQNTLSVILSEAWNAPETDQNIWDIFAQQFNFASPRCGFVNYI 176
           +AFR Y AQ G GL Q+ LS +LS AW++     ++WD+FAQQFNF  P+CGFV ++
Sbjct: 128 IAFRAYNAQFGNGLNQHLLSHLLSLAWHSAPEQHHVWDVFAQQFNFVKPKCGFVEWV 184

>Skud_71.1 Chr71 complement(3..467) [465 bp, 155 aa] {ON} YCR040W
           (REAL)
          Length = 155

 Score = 82.4 bits (202), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 34/61 (55%), Positives = 46/61 (75%)

Query: 116 MNAFMAFRTYYAQLGTGLKQNTLSVILSEAWNAPETDQNIWDIFAQQFNFASPRCGFVNY 175
           +N+FMAFR YY+Q G+G+KQN LS +LSE W+A +    IWD FAQQ+NF +P  GFV +
Sbjct: 92  INSFMAFRAYYSQFGSGVKQNILSSLLSEEWHADKMQHGIWDYFAQQYNFINPGFGFVEW 151

Query: 176 I 176
           +
Sbjct: 152 L 152

>Suva_69.2 Chr69 (369..803) [435 bp, 145 aa] {ON} YCL066W (REAL)
          Length = 145

 Score = 81.6 bits (200), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 47/129 (36%), Positives = 65/129 (50%), Gaps = 24/129 (18%)

Query: 40  LNMLLTKPNKFQIPPPHPVLLKRIREERMKLTSSFESGINIIDIETSWEIDKFISHHFNT 99
            N++       QIP P P+ LK+I+  R+       SG   I    S             
Sbjct: 41  FNIIRPLKKNIQIPAPSPLFLKKIQLYRI------ASGNQNIQCRQS------------- 81

Query: 100 SIGNVLKSKSSSKKRPMNAFMAFRTYYAQLGTGLKQNTLSVILSEAWNAPETDQNIWDIF 159
                 K+  +  K+ +N+FMAFR YY+Q G G+KQN LS +LSE W+A +    IWD F
Sbjct: 82  -----RKASITPSKKYLNSFMAFRAYYSQFGAGVKQNILSSLLSEEWHADKMQHGIWDYF 136

Query: 160 AQQFNFASP 168
           AQQ+NF +P
Sbjct: 137 AQQYNFINP 145

>Skud_3.119 Chr3 (184941..185465) [525 bp, 174 aa] {ON} YCR040W
           (REAL)
          Length = 174

 Score = 82.4 bits (202), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 34/61 (55%), Positives = 46/61 (75%)

Query: 116 MNAFMAFRTYYAQLGTGLKQNTLSVILSEAWNAPETDQNIWDIFAQQFNFASPRCGFVNY 175
           +N+FMAFR YY+Q G+G+KQN LS +LSE W+A +    IWD FAQQ+NF +P  GFV +
Sbjct: 92  INSFMAFRAYYSQFGSGVKQNILSSLLSEEWHADKMQHGIWDYFAQQYNFINPGFGFVEW 151

Query: 176 I 176
           +
Sbjct: 152 L 152

>NCAS0B09150 Chr2 (1755595..1756047) [453 bp, 150 aa] {ON} Anc_1.1
          Length = 150

 Score = 62.0 bits (149), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 41/58 (70%)

Query: 106 KSKSSSKKRPMNAFMAFRTYYAQLGTGLKQNTLSVILSEAWNAPETDQNIWDIFAQQF 163
           K  +S+  +P+N F+ FR+YY++ G G+KQ  LS +L++ W + +TDQ +WD FA Q+
Sbjct: 82  KQVTSNPSKPINGFILFRSYYSRWGYGIKQTMLSQLLAKFWKSSDTDQALWDYFALQY 139

>KLLA0C00352g Chr3 complement(24124..24909) [786 bp, 261 aa] {ON}
           uniprot|Q08398 Kluyveromyces lactis HMLAPLHA1 Mating-
           type protein ALPHA1
          Length = 261

 Score = 59.3 bits (142), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 40/139 (28%), Positives = 70/139 (50%), Gaps = 18/139 (12%)

Query: 39  GLNMLLTKPNKFQIPPPHPVLLKRIREERMKLTSSFESGINIIDIETSWEIDKFISHHFN 98
           G+N+ ++K     IP P  VL+  I+E+   L  S              E+   + +   
Sbjct: 46  GVNLYMSKVTPTSIPAPPQVLVAYIKEKVKTLNKS--------------EVLMSLGNSNQ 91

Query: 99  TSIGNVLKSKSSSKKRPMNAFMAFRTYYAQLGTG-LKQNTLSVILSEAWNAPETDQNIWD 157
            S  +V   K+ +KK+ +N F+AFR+YY++L  G L Q  LS I+S+ W   +  +  W+
Sbjct: 92  LSSRDV---KTKTKKKQINDFIAFRSYYSRLLNGILTQTELSTIISKHWTVDKQTRKNWE 148

Query: 158 IFAQQFNFASPRCGFVNYI 176
           + AQ++N  +    F N++
Sbjct: 149 LIAQEYNCDASGKHFFNWL 167

>KNAG0C00150 Chr3 complement(24902..25339) [438 bp, 145 aa] {ON}
           Anc_1.1 YCL066W silent copy of mating type alpha1 gene
           at HML locus
          Length = 145

 Score = 55.5 bits (132), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 21/48 (43%), Positives = 32/48 (66%)

Query: 116 MNAFMAFRTYYAQLGTGLKQNTLSVILSEAWNAPETDQNIWDIFAQQF 163
           +N+F+AFR YY+Q   G+ QN LS ILS+ W + ++ Q  WD   +Q+
Sbjct: 92  LNSFIAFRAYYSQFANGINQNKLSSILSKFWKSNQSQQTFWDRLTEQY 139

>NDAI0A00100 Chr1 complement(783..1190) [408 bp, 135 aa] {ON}
           Anc_1.1  silent copy of MATalpha1 gene at HMLalpha
           possible pseudogene; contains 2 copies of a 20 bp direct
           repeat, causing a frameshft; synthetic translation made
           by ignoring one copy.
          Length = 135

 Score = 55.1 bits (131), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 32/57 (56%), Positives = 41/57 (71%)

Query: 108 KSSSKKRPMNAFMAFRTYYAQLGTGLKQNTLSVILSEAWNAPETDQNIWDIFAQQFN 164
           +S    + +N FM FR+YY+Q G GLKQ+ LS +LS+ WNA ETDQ +WD FAQQ N
Sbjct: 55  QSRCYAKSINGFMLFRSYYSQYGKGLKQSLLSPLLSKLWNAHETDQLLWDQFAQQCN 111

>Kwal_33.matalpha1 s33 complement(283160..283894) [735 bp, 244 aa]
           {OFF} (matalpha1) - mating type alpha1 protein [contig
           MAT] FULL
          Length = 244

 Score = 56.2 bits (134), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 43/169 (25%), Positives = 76/169 (44%), Gaps = 27/169 (15%)

Query: 1   MKYTATKFRVRTNKRLRSQKYPEKHSDFLGCSSTKSSF---GLNMLLTKPNKFQIPPPHP 57
           MK+T   F+V  NKR  ++  P+     +   S K ++   G+N+ ++   +  IP P  
Sbjct: 1   MKFTKPSFKVSVNKRHGAKLKPK-----ISKKSLKRNYVSEGVNLYMSYSKQELIPKPPK 55

Query: 58  VLLKRIREERMK-LTSSFESGINIIDIETSWEIDKFISHHFNTSIGNVLKSKSSSKKRPM 116
            ++K +  +  K L+     GI                 H +      L S   + K+ +
Sbjct: 56  AVMKILGSDHGKGLSKGLSKGI-----------------HKDQKSQTFLGSGKCTSKKKI 98

Query: 117 NAFMAFRTYYAQLGTG-LKQNTLSVILSEAWNAPETDQNIWDIFAQQFN 164
           N F+ FR+YYA++  G ++Q  LS ILS+ W +       W+ F + +N
Sbjct: 99  NPFIGFRSYYARIVKGRIRQQELSTILSQYWLSHHQVHKTWEFFTEHYN 147

>Kwal_33.12992 s33 complement(31018..31752) [735 bp, 244 aa] {OFF}
           YCR040W (MATALPHA1) - transcription factor involved in
           the regulation of alpha-specific genes [contig 123] FULL
          Length = 244

 Score = 56.2 bits (134), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 43/169 (25%), Positives = 76/169 (44%), Gaps = 27/169 (15%)

Query: 1   MKYTATKFRVRTNKRLRSQKYPEKHSDFLGCSSTKSSF---GLNMLLTKPNKFQIPPPHP 57
           MK+T   F+V  NKR  ++  P+     +   S K ++   G+N+ ++   +  IP P  
Sbjct: 1   MKFTKPSFKVSVNKRHGAKLKPK-----ISKKSLKRNYVSEGVNLYMSYSKQELIPKPPK 55

Query: 58  VLLKRIREERMK-LTSSFESGINIIDIETSWEIDKFISHHFNTSIGNVLKSKSSSKKRPM 116
            ++K +  +  K L+     GI                 H +      L S   + K+ +
Sbjct: 56  AVMKILGSDHGKGLSKGLSKGI-----------------HKDQKSQTFLGSGKCTSKKKI 98

Query: 117 NAFMAFRTYYAQLGTG-LKQNTLSVILSEAWNAPETDQNIWDIFAQQFN 164
           N F+ FR+YYA++  G ++Q  LS ILS+ W +       W+ F + +N
Sbjct: 99  NPFIGFRSYYARIVKGRIRQQELSTILSQYWLSHHQVHKTWEFFTEHYN 147

>Kwal_YGOB_matalpha1 s33 complement(283160..283894) [735 bp, 244 aa]
           {ON} (matalpha1) - mating type alpha1 protein [contig
           MAT] FULL
          Length = 244

 Score = 56.2 bits (134), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 43/169 (25%), Positives = 76/169 (44%), Gaps = 27/169 (15%)

Query: 1   MKYTATKFRVRTNKRLRSQKYPEKHSDFLGCSSTKSSF---GLNMLLTKPNKFQIPPPHP 57
           MK+T   F+V  NKR  ++  P+     +   S K ++   G+N+ ++   +  IP P  
Sbjct: 1   MKFTKPSFKVSVNKRHGAKLKPK-----ISKKSLKRNYVSEGVNLYMSYSKQELIPKPPK 55

Query: 58  VLLKRIREERMK-LTSSFESGINIIDIETSWEIDKFISHHFNTSIGNVLKSKSSSKKRPM 116
            ++K +  +  K L+     GI                 H +      L S   + K+ +
Sbjct: 56  AVMKILGSDHGKGLSKGLSKGI-----------------HKDQKSQTFLGSGKCTSKKKI 98

Query: 117 NAFMAFRTYYAQLGTG-LKQNTLSVILSEAWNAPETDQNIWDIFAQQFN 164
           N F+ FR+YYA++  G ++Q  LS ILS+ W +       W+ F + +N
Sbjct: 99  NPFIGFRSYYARIVKGRIRQQELSTILSQYWLSHHQVHKTWEFFTEHYN 147

>Kwal_YGOB_HMalpha1 s33 complement(31018..31752) [735 bp, 244 aa]
           {ON} ANNOTATED BY YGOB - This is Kwal_33.12992
          Length = 244

 Score = 56.2 bits (134), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 43/169 (25%), Positives = 76/169 (44%), Gaps = 27/169 (15%)

Query: 1   MKYTATKFRVRTNKRLRSQKYPEKHSDFLGCSSTKSSF---GLNMLLTKPNKFQIPPPHP 57
           MK+T   F+V  NKR  ++  P+     +   S K ++   G+N+ ++   +  IP P  
Sbjct: 1   MKFTKPSFKVSVNKRHGAKLKPK-----ISKKSLKRNYVSEGVNLYMSYSKQELIPKPPK 55

Query: 58  VLLKRIREERMK-LTSSFESGINIIDIETSWEIDKFISHHFNTSIGNVLKSKSSSKKRPM 116
            ++K +  +  K L+     GI                 H +      L S   + K+ +
Sbjct: 56  AVMKILGSDHGKGLSKGLSKGI-----------------HKDQKSQTFLGSGKCTSKKKI 98

Query: 117 NAFMAFRTYYAQLGTG-LKQNTLSVILSEAWNAPETDQNIWDIFAQQFN 164
           N F+ FR+YYA++  G ++Q  LS ILS+ W +       W+ F + +N
Sbjct: 99  NPFIGFRSYYARIVKGRIRQQELSTILSQYWLSHHQVHKTWEFFTEHYN 147

>KAFR0D00710 Chr4 complement(127819..128337) [519 bp, 172 aa] {ON}
           mating type gene MATalpha1
          Length = 172

 Score = 52.8 bits (125), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 34/51 (66%)

Query: 112 KKRPMNAFMAFRTYYAQLGTGLKQNTLSVILSEAWNAPETDQNIWDIFAQQ 162
           + R +N FMAFR+YY+Q   GLKQ  LS +L++AW++   +QN W    Q+
Sbjct: 117 QNRNLNPFMAFRSYYSQYAQGLKQIELSEVLAKAWHSDTKEQNYWISLTQK 167

>Ecym_1003 Chr1 (6314..7105) [792 bp, 263 aa] {ON} similar to
           Saccharomyces cerevisiae YCL066W HMLALPHA1
          Length = 263

 Score = 50.8 bits (120), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 27/101 (26%), Positives = 53/101 (52%), Gaps = 1/101 (0%)

Query: 84  ETSWEIDKFISHHFNTSIGNVLKSKSSSKKRPMNAFMAFRTYYAQLGTGL-KQNTLSVIL 142
           + ++E +     + N SI    ++    K++ +N FMAFR+YY++   G+  Q  LS IL
Sbjct: 81  QQNFEFEDIKQSNNNKSIAYSEETDIPKKRKKINEFMAFRSYYSRFFRGIVPQLELSRIL 140

Query: 143 SEAWNAPETDQNIWDIFAQQFNFASPRCGFVNYIMAHASSA 183
           ++ W+     +  W++FA+ +N   P   F  ++    +S+
Sbjct: 141 AQLWHEKPKMKRTWEMFAEHYNMEQPDQSFPEWLEKTYTSS 181

>Ecym_1114 Chr1 complement(236238..237029) [792 bp, 263 aa] {ON}
           similar to YCL066W HMLALPHA1
          Length = 263

 Score = 50.8 bits (120), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 27/101 (26%), Positives = 53/101 (52%), Gaps = 1/101 (0%)

Query: 84  ETSWEIDKFISHHFNTSIGNVLKSKSSSKKRPMNAFMAFRTYYAQLGTGL-KQNTLSVIL 142
           + ++E +     + N SI    ++    K++ +N FMAFR+YY++   G+  Q  LS IL
Sbjct: 81  QQNFEFEDIKQSNNNKSIAYSEETDIPKKRKKINEFMAFRSYYSRFFRGIVPQLELSRIL 140

Query: 143 SEAWNAPETDQNIWDIFAQQFNFASPRCGFVNYIMAHASSA 183
           ++ W+     +  W++FA+ +N   P   F  ++    +S+
Sbjct: 141 AQLWHEKPKMKRTWEMFAEHYNMEQPDQSFPEWLEKTYTSS 181

>KLTH0F00374g Chr6 complement(30927..31676) [750 bp, 249 aa] {ON}
           weakly similar to uniprot|P01365 Saccharomyces
           cerevisiae YCR040W MATALPHA1 Transcriptional
           co-activator involved in regulation of
           mating-type-specific gene expression targets the
           transcription factor Mcm1p to the promoters of
           alpha-specific genes one of two genes encoded by the
           alpha mating type cassette
          Length = 249

 Score = 49.7 bits (117), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 37/127 (29%), Positives = 58/127 (45%), Gaps = 14/127 (11%)

Query: 39  GLNMLLTKPNKFQIPPPHPVLLKRIREERMKLTSSFESGINIIDIETSWEIDKFISHHFN 98
           G N+ ++      IP P   L+  +R +  K + S    +    I    ++ K   +  N
Sbjct: 34  GANLYMSYSKPQAIPKPPNTLINLVRSK--KTSQSSRKCLKNDYILKELDVKKLSIYSNN 91

Query: 99  TSIGNVLKSKSSSKKRPMNAFMAFRTYYAQLGTG-LKQNTLSVILSEAWNAPETDQNIWD 157
           T    VLK K       +N F+ FR+YYA+   G ++Q  LS ILSE W       ++W+
Sbjct: 92  T----VLKKK-------INPFIGFRSYYAKFAKGRVRQQELSKILSEYWTKNSKIHSVWE 140

Query: 158 IFAQQFN 164
            F Q +N
Sbjct: 141 FFTQHYN 147

>KNAG0H00720 Chr8 (114623..116173) [1551 bp, 516 aa] {ON} Anc_3.354
           YPR065W
          Length = 516

 Score = 30.8 bits (68), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 31/60 (51%), Gaps = 12/60 (20%)

Query: 114 RPMNAFMAFRTYYAQL--------GTGLKQNT-LSVILSEAWN--APETDQNIWDIFAQQ 162
           RP NAF+ FR +Y ++        G  +  NT +S IL   W    PE +++ WD  A+Q
Sbjct: 57  RPRNAFILFRQHYHRILIDDWTKHGVDIPHNTQISKILGTKWKELGPE-EKHQWDELARQ 115

>SAKL0B07656g Chr2 (655693..656619) [927 bp, 308 aa] {ON} similar to
           uniprot|P25042 Saccharomyces cerevisiae YPR065W ROX1
           Heme-dependent repressor of hypoxic genes contains an
           HMG domain that is responsible for DNA bending activity
          Length = 308

 Score = 29.6 bits (65), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 30/58 (51%), Gaps = 10/58 (17%)

Query: 114 RPMNAFMAFRTYYAQL--------GTGLKQNT-LSVILSEAWNAPETDQ-NIWDIFAQ 161
           RP NAF+ FR ++ +L        G  +  N+ +S +L   W +  TD+ + WD  AQ
Sbjct: 7   RPRNAFILFRQHHHKLLIDQLREEGKPIPHNSEISKLLGTRWRSLSTDEKSYWDSKAQ 64

>KLLA0D07414g Chr4 complement(635851..637941) [2091 bp, 696 aa] {ON}
           similar to uniprot|Q75BZ7 Ashbya gossypii ACR122C
           ACR122Cp and some similarities with YHR176W
           uniprot|P38866 Saccharomyces cerevisiae YHR176W FMO1
           Flavin-containing monooxygenase localized to the
           cytoplasmic face of the ER membrane catalyzes oxidation
           of biological thiols to maintain the ER redox buffer
           ratio for correct folding of disulfide-bonded proteins
          Length = 696

 Score = 29.6 bits (65), Expect = 4.4,   Method: Composition-based stats.
 Identities = 13/60 (21%), Positives = 30/60 (50%)

Query: 85  TSWEIDKFISHHFNTSIGNVLKSKSSSKKRPMNAFMAFRTYYAQLGTGLKQNTLSVILSE 144
           +++++DK   + + +  G VL  +  S + P+     + T+  +LG+G     L+ +  E
Sbjct: 162 SNFQLDKLADYRYTSGYGKVLMHEPKSGRPPVEWVQVYYTFENKLGSGKGIARLTAVYDE 221

>NCAS0A11120 Chr1 (2209565..2210683) [1119 bp, 372 aa] {ON}
           Anc_3.354
          Length = 372

 Score = 29.6 bits (65), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 29/59 (49%), Gaps = 10/59 (16%)

Query: 114 RPMNAFMAFRTYY--------AQLGTGLKQNT-LSVILSEAW-NAPETDQNIWDIFAQQ 162
           RP NAF+ FR +Y         + GT +  N+ +S IL   W N  E ++  W   A++
Sbjct: 72  RPKNAFILFRQHYHKELIDEWTKAGTDIPHNSEISKILGVKWKNISENEKTHWSDLAKE 130

>SAKL0A02596g Chr1 complement(235391..237295) [1905 bp, 634 aa] {ON}
           weakly similar to uniprot|Q01649 Saccharomyces
           cerevisiae YMR198W CIK1 is important for proper
           organiziation of microtubule arrays and establishment of
           a spindle is essential for karyogamy and expression is
           regulated by KAR4 and mating spindle pole body
           associated protein and to uniprot|Q12045 YPL253C VIK1
           Protein that forms a complex with Kar3p at the spindle
           pole body, possible regulator of Kar3p function in
           microtubule- mediated processes; required for sister
           chromatid cohesion
          Length = 634

 Score = 29.3 bits (64), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 31/53 (58%), Gaps = 5/53 (9%)

Query: 89  IDKFISHHFNTSIGNVLKSKSSSKKRPMNAFMAFRTYYAQLGTGLKQNTLSVI 141
           I++ +  H N +I ++    S++ K   NAF+ F T Y  LGT LK+N +S I
Sbjct: 425 IERCLKTHTNCNIISI----SNNNKALRNAFVRFITNYTGLGT-LKENEISNI 472

>TDEL0D00130 Chr4 (14810..15271) [462 bp, 153 aa] {ON} 
          Length = 153

 Score = 28.5 bits (62), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 22/50 (44%), Gaps = 1/50 (2%)

Query: 116 MNAFMAFRTYYAQLGTGLKQNTLSVILSEAWNA-PETDQNIWDIFAQQFN 164
           + AF  F TY     TGL      V L E   A P  D   W++ A++ N
Sbjct: 74  LVAFTGFITYLCSRDTGLTDENKLVFLKEVTVARPGIDNERWNVVARRLN 123

>NDAI0G01920 Chr7 (434073..435119) [1047 bp, 348 aa] {ON} Anc_7.211
           YER045C
          Length = 348

 Score = 28.9 bits (63), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 22/88 (25%), Positives = 39/88 (44%), Gaps = 17/88 (19%)

Query: 92  FISHHFNTSIGNVLKSKSSSKKRPMNAFMAFRTY----------YAQLGTGLKQNTLS-- 139
           F+S  F+T+ G  +K++S   +RP+N+ +   +Y          Y  L T  +Q  LS  
Sbjct: 32  FLSDSFDTNSGTGIKNQSFDNRRPINSTLDSPSYPPINNIPNIIYEPLLTNQRQQQLSPH 91

Query: 140 -----VILSEAWNAPETDQNIWDIFAQQ 162
                 +  E    PE   +  + FA++
Sbjct: 92  IIPQGQVRDENREGPEAPASFIEFFAEK 119

>NCAS0A06450 Chr1 (1273459..1275288) [1830 bp, 609 aa] {ON}
           Anc_4.385
          Length = 609

 Score = 28.9 bits (63), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 12/39 (30%), Positives = 22/39 (56%), Gaps = 1/39 (2%)

Query: 80  IIDIETSWEIDK-FISHHFNTSIGNVLKSKSSSKKRPMN 117
           + D+E SWE        HF+  + N+ +  ++SK+ PM+
Sbjct: 123 VTDVERSWEFKHPSFRRHFDEGLDNIKRKPTTSKRLPMD 161

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.131    0.391 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 19,803,427
Number of extensions: 792939
Number of successful extensions: 2470
Number of sequences better than 10.0: 57
Number of HSP's gapped: 2486
Number of HSP's successfully gapped: 57
Length of query: 184
Length of database: 53,481,399
Length adjustment: 103
Effective length of query: 81
Effective length of database: 41,670,801
Effective search space: 3375334881
Effective search space used: 3375334881
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 62 (28.5 bits)