Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
CAGL0A03949g7.351ON26826813450.0
YLR201C (COQ9)7.351ON2602457456e-99
Suva_10.2967.351ON2602487431e-98
TPHA0F029807.351ON2642687334e-97
TDEL0C019707.351ON2602567196e-95
Skud_12.2657.351ON2602457118e-94
ZYRO0F11726g7.351ON2512467064e-93
Kpol_530.307.351ON2602447013e-92
KAFR0L014807.351ON2642456822e-89
KNAG0B026207.351ON2652646753e-88
TBLA0E004507.351ON2792476764e-88
Smik_12.2607.351ON2602496614e-86
NCAS0E028707.351ON2612616598e-86
KLLA0D12320g7.351ON2502446422e-83
KLTH0H01232g7.351ON2572486129e-79
NDAI0E044707.351ON2642516093e-78
Kwal_56.246447.351ON2582466023e-77
SAKL0F11396g7.351ON2542465814e-74
ACL147W7.351ON2462445275e-66
Ecym_47227.351ON2532505144e-64
NCAS0J021104.341aON1299108731.2
NDAI0J028204.341aON1283108711.7
Kwal_55.198087.488ON825101702.3
AER354W8.737ON44676675.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0A03949g
         (268 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0A03949g Chr1 (399220..400026) [807 bp, 268 aa] {ON} similar...   522   0.0  
YLR201C Chr12 complement(549511..550293) [783 bp, 260 aa] {ON}  ...   291   6e-99
Suva_10.296 Chr10 complement(522345..523127) [783 bp, 260 aa] {O...   290   1e-98
TPHA0F02980 Chr6 (655375..656169) [795 bp, 264 aa] {ON} Anc_7.35...   286   4e-97
TDEL0C01970 Chr3 complement(343645..344427) [783 bp, 260 aa] {ON...   281   6e-95
Skud_12.265 Chr12 complement(496162..496944) [783 bp, 260 aa] {O...   278   8e-94
ZYRO0F11726g Chr6 (959943..960698) [756 bp, 251 aa] {ON} similar...   276   4e-93
Kpol_530.30 s530 complement(75011..75793) [783 bp, 260 aa] {ON} ...   274   3e-92
KAFR0L01480 Chr12 (274514..275308) [795 bp, 264 aa] {ON} Anc_7.3...   267   2e-89
KNAG0B02620 Chr2 complement(507597..508394) [798 bp, 265 aa] {ON...   264   3e-88
TBLA0E00450 Chr5 complement(83483..84322) [840 bp, 279 aa] {ON} ...   265   4e-88
Smik_12.260 Chr12 complement(496547..497329) [783 bp, 260 aa] {O...   259   4e-86
NCAS0E02870 Chr5 complement(561968..562753) [786 bp, 261 aa] {ON...   258   8e-86
KLLA0D12320g Chr4 complement(1048556..1049308) [753 bp, 250 aa] ...   251   2e-83
KLTH0H01232g Chr8 complement(119673..120446) [774 bp, 257 aa] {O...   240   9e-79
NDAI0E04470 Chr5 complement(1006109..1006903) [795 bp, 264 aa] {...   239   3e-78
Kwal_56.24644 s56 (1087270..1088046) [777 bp, 258 aa] {ON} YLR20...   236   3e-77
SAKL0F11396g Chr6 (886970..887734) [765 bp, 254 aa] {ON} similar...   228   4e-74
ACL147W Chr3 (92477..93217) [741 bp, 246 aa] {ON} Syntenic homol...   207   5e-66
Ecym_4722 Chr4 complement(1413860..1414621) [762 bp, 253 aa] {ON...   202   4e-64
NCAS0J02110 Chr10 (402095..405994) [3900 bp, 1299 aa] {ON}             33   1.2  
NDAI0J02820 Chr10 (698768..702619) [3852 bp, 1283 aa] {ON}             32   1.7  
Kwal_55.19808 s55 (136074..138551) [2478 bp, 825 aa] {ON} YBL047...    32   2.3  
AER354W Chr5 (1290374..1291714) [1341 bp, 446 aa] {ON} Syntenic ...    30   5.2  

>CAGL0A03949g Chr1 (399220..400026) [807 bp, 268 aa] {ON} similar to
           uniprot|Q05779 Saccharomyces cerevisiae YLR201c
          Length = 268

 Score =  522 bits (1345), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 253/268 (94%), Positives = 253/268 (94%)

Query: 1   MSLYNNLRLVTRQKQVSGLLSAVRRYHPTSNEYVNPKVWEPLTYTPESPEFKLLSHTMEN 60
           MSLYNNLRLVTRQKQVSGLLSAVRRYHPTSNEYVNPKVWEPLTYTPESPEFKLLSHTMEN
Sbjct: 1   MSLYNNLRLVTRQKQVSGLLSAVRRYHPTSNEYVNPKVWEPLTYTPESPEFKLLSHTMEN 60

Query: 61  SVPQHGFTEKAIVNSLNAMKMPSGMLTTIGASNSATFLHSSPAVMELIKFQLVEKRHRMV 120
           SVPQHGFTEKAIVNSLNAMKMPSGMLTTIGASNSATFLHSSPAVMELIKFQLVEKRHRMV
Sbjct: 61  SVPQHGFTEKAIVNSLNAMKMPSGMLTTIGASNSATFLHSSPAVMELIKFQLVEKRHRMV 120

Query: 121 EGITEIAEAXXXXXXXXXXXXXXXMDVPIASHLTQMTAQLMVPSSFMTNVSLPELERLAD 180
           EGITEIAEA               MDVPIASHLTQMTAQLMVPSSFMTNVSLPELERLAD
Sbjct: 121 EGITEIAEASKLPSLESLLLKRLKMDVPIASHLTQMTAQLMVPSSFMTNVSLPELERLAD 180

Query: 181 DMIYYSNEKDHHDFAWYTKRAALATTYLASKAFMAQDKSHNFMETMEFAQDKLHKVMTLG 240
           DMIYYSNEKDHHDFAWYTKRAALATTYLASKAFMAQDKSHNFMETMEFAQDKLHKVMTLG
Sbjct: 181 DMIYYSNEKDHHDFAWYTKRAALATTYLASKAFMAQDKSHNFMETMEFAQDKLHKVMTLG 240

Query: 241 DYYNNVEEFGWFTLMSAVNLTKSQMARV 268
           DYYNNVEEFGWFTLMSAVNLTKSQMARV
Sbjct: 241 DYYNNVEEFGWFTLMSAVNLTKSQMARV 268

>YLR201C Chr12 complement(549511..550293) [783 bp, 260 aa] {ON}
           COQ9Protein required for ubiquinone (coenzyme Q)
           biosynthesis and respiratory growth; localizes to the
           matrix face of the mitochondrial inner membrane in a
           large complex with ubiquinone biosynthetic enzymes
          Length = 260

 Score =  291 bits (745), Expect = 6e-99,   Method: Compositional matrix adjust.
 Identities = 135/245 (55%), Positives = 177/245 (72%), Gaps = 1/245 (0%)

Query: 24  RRYHPTSNEYVNPKVWEPLTYTPESPEFKLLSHTMENSVPQHGFTEKAIVNSLNAMKMPS 83
           R YH    E+V P   +PLTY  ESP++K+LS  ++  VP+HGF+E++IV SLN +  PS
Sbjct: 15  RLYHSNPIEHVKPIHIKPLTYGKESPQYKVLSLALQKFVPEHGFSERSIVESLNELGYPS 74

Query: 84  GMLTTIGASNSATFLHSSPAVMELIKFQLVEKRHRMVEGIT-EIAEAXXXXXXXXXXXXX 142
            M+++IGA NS +F HSS AVMELIKFQLV+KR+R+ EGI  ++                
Sbjct: 75  SMISSIGAPNSPSFFHSSTAVMELIKFQLVDKRYRLTEGINPDVTPQYKLPSLEHLLLKR 134

Query: 143 XXMDVPIASHLTQMTAQLMVPSSFMTNVSLPELERLADDMIYYSNEKDHHDFAWYTKRAA 202
             MD PI  HL+++ +QL +PS+F+   ++PEL RL+DDMIY+SNEKDHHD AWY KR A
Sbjct: 135 LEMDKPIGGHLSELMSQLAIPSAFLFETAIPELHRLSDDMIYFSNEKDHHDSAWYAKRLA 194

Query: 203 LATTYLASKAFMAQDKSHNFMETMEFAQDKLHKVMTLGDYYNNVEEFGWFTLMSAVNLTK 262
           +++TY+ SK FMAQDKSHN+ ET  FA+DKLH+VM LG+YYNN EEF W+TLMS VNL K
Sbjct: 195 VSSTYIGSKLFMAQDKSHNYKETFTFAKDKLHRVMRLGEYYNNTEEFAWYTLMSTVNLIK 254

Query: 263 SQMAR 267
           SQ+ R
Sbjct: 255 SQLVR 259

>Suva_10.296 Chr10 complement(522345..523127) [783 bp, 260 aa] {ON}
           YLR201C (REAL)
          Length = 260

 Score =  290 bits (743), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 134/248 (54%), Positives = 180/248 (72%), Gaps = 1/248 (0%)

Query: 21  SAVRRYHPTSNEYVNPKVWEPLTYTPESPEFKLLSHTMENSVPQHGFTEKAIVNSLNAMK 80
           +++R YH    E+VNP   +PL Y  +SP++K+LS  ++  VP+HGFTE++IV SLN + 
Sbjct: 12  ASLRLYHSNPIEHVNPLHIKPLAYGKQSPQYKVLSLALQEYVPKHGFTERSIVESLNKLG 71

Query: 81  MPSGMLTTIGASNSATFLHSSPAVMELIKFQLVEKRHRMVEGIT-EIAEAXXXXXXXXXX 139
            PS M+++IGASNS +F+HSS AVMEL+KFQLV+KR+R+ EGI  ++             
Sbjct: 72  YPSSMISSIGASNSPSFVHSSTAVMELLKFQLVDKRYRLTEGINPDVTPHYKLPSLEHLL 131

Query: 140 XXXXXMDVPIASHLTQMTAQLMVPSSFMTNVSLPELERLADDMIYYSNEKDHHDFAWYTK 199
                MD P+   LT + +QL +PS F+   ++PEL RL+DDMIY+SNEKDHHD AWY K
Sbjct: 132 LKRLEMDKPVGEQLTDLMSQLAIPSGFLFETAIPELHRLSDDMIYFSNEKDHHDSAWYAK 191

Query: 200 RAALATTYLASKAFMAQDKSHNFMETMEFAQDKLHKVMTLGDYYNNVEEFGWFTLMSAVN 259
           R A+++TY+ S+ FMAQDKSH+F ET  FA+DKLH+VM LG+YYNN EEF W+TLMS VN
Sbjct: 192 RLAVSSTYIGSQLFMAQDKSHDFHETFAFAKDKLHRVMRLGEYYNNTEEFAWYTLMSTVN 251

Query: 260 LTKSQMAR 267
           L KSQ+AR
Sbjct: 252 LVKSQLAR 259

>TPHA0F02980 Chr6 (655375..656169) [795 bp, 264 aa] {ON} Anc_7.351
           YLR201C
          Length = 264

 Score =  286 bits (733), Expect = 4e-97,   Method: Compositional matrix adjust.
 Identities = 131/268 (48%), Positives = 190/268 (70%), Gaps = 8/268 (2%)

Query: 3   LYNNLRLVTRQKQVSGLLSAVRRYHPTSNEYVNPKVWEPLTYTPESPEFKLLSHTMENSV 62
           + N  RL+ R+  V+      R +HP ++EYV P    P TYT +SP+FK+LSH ++N+V
Sbjct: 1   MINRGRLIFRKSGVNA-----RFFHPATDEYVLPNKLSPCTYTKDSPQFKILSHAIDNTV 55

Query: 63  PQHGFTEKAIVNSLNAMKMP--SGMLTTIGASNSATFLHSSPAVMELIKFQLVEKRHRMV 120
            + GF+E+AI+ ++  +K+   S ML+ IG+SNS +FLHSSP+VMEL+KF LV KR+RM+
Sbjct: 56  TKFGFSERAIIEAMKELKIENQSTMLSAIGSSNSPSFLHSSPSVMELLKFNLVLKRYRMI 115

Query: 121 EGITEIA-EAXXXXXXXXXXXXXXXMDVPIASHLTQMTAQLMVPSSFMTNVSLPELERLA 179
           EG+  +  +                MD+PI  H++   +QL++P  F+ + +LPEL RLA
Sbjct: 116 EGLDPLTMQQEELPSLESLLLKRLEMDIPIGKHISAFMSQLVIPGPFLLDSALPELHRLA 175

Query: 180 DDMIYYSNEKDHHDFAWYTKRAALATTYLASKAFMAQDKSHNFMETMEFAQDKLHKVMTL 239
           DDMIY+SNEKDHHDFAWY+KR  +++ Y++SK FMAQD S N+ ET++FA+DKL KVM L
Sbjct: 176 DDMIYFSNEKDHHDFAWYSKRLGVSSAYISSKLFMAQDNSCNYKETLQFAKDKLEKVMRL 235

Query: 240 GDYYNNVEEFGWFTLMSAVNLTKSQMAR 267
           GDYYNN EE+ W+ L+++VN+ KS+M+R
Sbjct: 236 GDYYNNTEEYAWYVLLNSVNMVKSRMSR 263

>TDEL0C01970 Chr3 complement(343645..344427) [783 bp, 260 aa] {ON}
           Anc_7.351 YLR201C
          Length = 260

 Score =  281 bits (719), Expect = 6e-95,   Method: Compositional matrix adjust.
 Identities = 129/256 (50%), Positives = 179/256 (69%), Gaps = 1/256 (0%)

Query: 13  QKQVSGLLSAVRRYHPTSNEYVNP-KVWEPLTYTPESPEFKLLSHTMENSVPQHGFTEKA 71
           ++ ++G     R Y P   EY+NP     PL Y  +SP++K+LSHT+  SVP +GF E+A
Sbjct: 4   KRLIAGSRIFARGYRPAGFEYINPINSRGPLKYGKDSPQYKVLSHTLAKSVPMYGFNERA 63

Query: 72  IVNSLNAMKMPSGMLTTIGASNSATFLHSSPAVMELIKFQLVEKRHRMVEGITEIAEAXX 131
           IVNSLN +  PS ML+ IG+SN  +F HSSPA+MEL+KF LV+KR  + E I+       
Sbjct: 64  IVNSLNELGYPSTMLSVIGSSNGPSFFHSSPALMELLKFHLVDKRLNLTENISLETPVDQ 123

Query: 132 XXXXXXXXXXXXXMDVPIASHLTQMTAQLMVPSSFMTNVSLPELERLADDMIYYSNEKDH 191
                        M+VP+A HL+Q+ +QL +P  F+ + S+PEL RL+DDMIY+S EKDH
Sbjct: 124 LPSLEHLVIKRLEMNVPVAKHLSQLLSQLSIPGPFLVDYSMPELHRLSDDMIYFSTEKDH 183

Query: 192 HDFAWYTKRAALATTYLASKAFMAQDKSHNFMETMEFAQDKLHKVMTLGDYYNNVEEFGW 251
           +DFAWY+KR A++  Y++S+ FMAQD+S ++ ET EFA++KLH+V TLG+YYNN EEF W
Sbjct: 184 NDFAWYSKRLAVSCAYVSSELFMAQDRSPDYKETFEFAREKLHRVSTLGEYYNNTEEFAW 243

Query: 252 FTLMSAVNLTKSQMAR 267
           +TL+S +NL KSQ+AR
Sbjct: 244 YTLLSTINLVKSQLAR 259

>Skud_12.265 Chr12 complement(496162..496944) [783 bp, 260 aa] {ON}
           YLR201C (REAL)
          Length = 260

 Score =  278 bits (711), Expect = 8e-94,   Method: Compositional matrix adjust.
 Identities = 132/245 (53%), Positives = 172/245 (70%), Gaps = 1/245 (0%)

Query: 24  RRYHPTSNEYVNPKVWEPLTYTPESPEFKLLSHTMENSVPQHGFTEKAIVNSLNAMKMPS 83
           R YH    E+V P   +PLTY  +SP++K+LS  +   VP+HGF+E++IV SLN +  PS
Sbjct: 15  RLYHSNPIEHVKPLHIKPLTYGKQSPQYKVLSLALLEYVPKHGFSERSIVESLNKLGYPS 74

Query: 84  GMLTTIGASNSATFLHSSPAVMELIKFQLVEKRHRMVEGIT-EIAEAXXXXXXXXXXXXX 142
            M+++IGASNS +F HSS AVMEL+KFQLV+KR+R+ EGI  ++                
Sbjct: 75  SMVSSIGASNSPSFFHSSTAVMELVKFQLVDKRYRLTEGINPDVTSRYKLPSLEHLLLKR 134

Query: 143 XXMDVPIASHLTQMTAQLMVPSSFMTNVSLPELERLADDMIYYSNEKDHHDFAWYTKRAA 202
             MD  I   L  + +QL VPS  +   ++PEL RL+DDMIY+SNE+DHHD AWY KR A
Sbjct: 135 LEMDKLIGGQLADLMSQLAVPSRLLFETAIPELHRLSDDMIYFSNEEDHHDSAWYAKRLA 194

Query: 203 LATTYLASKAFMAQDKSHNFMETMEFAQDKLHKVMTLGDYYNNVEEFGWFTLMSAVNLTK 262
           +++TY+ SK FMAQDKSH+F ET  FA++KLHKVM LG+YYNN EEF W+TLMS VNL K
Sbjct: 195 VSSTYIGSKLFMAQDKSHDFKETFAFAKEKLHKVMRLGEYYNNTEEFAWYTLMSTVNLVK 254

Query: 263 SQMAR 267
           SQ+AR
Sbjct: 255 SQLAR 259

>ZYRO0F11726g Chr6 (959943..960698) [756 bp, 251 aa] {ON} similar to
           uniprot|Q05779 Saccharomyces cerevisiae YLR201C FMP53
          Length = 251

 Score =  276 bits (706), Expect = 4e-93,   Method: Compositional matrix adjust.
 Identities = 126/246 (51%), Positives = 177/246 (71%), Gaps = 4/246 (1%)

Query: 22  AVRRYHPTSNEYVNPKVWEPLTYTPESPEFKLLSHTMENSVPQHGFTEKAIVNSLNAMKM 81
           ++RRYHP+  E++N     PL Y  +SP++ +LSH ++ SVP  GF E+AIV+SLN +  
Sbjct: 9   SLRRYHPSKGEHLNSSRLGPLNYGLDSPQYAVLSHALKVSVPVVGFNERAIVHSLNQLNY 68

Query: 82  PSGMLTTIGASNSATFLHSSPAVMELIKFQLVEKRHRMVEGITEIAEAXXXXXXXXXXXX 141
           PS ML+ IGASNS + LHSSPAVMEL+KF LV+KR ++ + ++    +            
Sbjct: 69  PSTMLSVIGASNSPSLLHSSPAVMELVKFHLVQKRLQLSQDLS----SEEKPSLEDLFIK 124

Query: 142 XXXMDVPIASHLTQMTAQLMVPSSFMTNVSLPELERLADDMIYYSNEKDHHDFAWYTKRA 201
              ++VPIA HL+Q+ + + VP  F  + +LPEL RL+DD+IYYSNEKDHHDFAWY+KR 
Sbjct: 125 RLELNVPIAGHLSQLLSHVSVPGPFTVDTALPELHRLSDDLIYYSNEKDHHDFAWYSKRL 184

Query: 202 ALATTYLASKAFMAQDKSHNFMETMEFAQDKLHKVMTLGDYYNNVEEFGWFTLMSAVNLT 261
            ++  Y++S+ FMAQDKSHN+ ET +FA+DKL + M LG+YYNN EE+ W+TL++++NL 
Sbjct: 185 GISCAYVSSELFMAQDKSHNYEETFQFARDKLQRTMQLGEYYNNTEEWLWYTLLNSINLA 244

Query: 262 KSQMAR 267
           KSQMAR
Sbjct: 245 KSQMAR 250

>Kpol_530.30 s530 complement(75011..75793) [783 bp, 260 aa] {ON}
           complement(75011..75793) [783 nt, 261 aa]
          Length = 260

 Score =  274 bits (701), Expect = 3e-92,   Method: Compositional matrix adjust.
 Identities = 125/244 (51%), Positives = 171/244 (70%)

Query: 24  RRYHPTSNEYVNPKVWEPLTYTPESPEFKLLSHTMENSVPQHGFTEKAIVNSLNAMKMPS 83
           R YHP   EYV      PL Y  +S ++K+LSH+++ SVP+ GF E+AIVNS+N +  PS
Sbjct: 16  RFYHPNPKEYVPQLTLPPLLYGKDSKQYKILSHSLDVSVPEFGFNERAIVNSINLLGYPS 75

Query: 84  GMLTTIGASNSATFLHSSPAVMELIKFQLVEKRHRMVEGITEIAEAXXXXXXXXXXXXXX 143
            +L+ IG+SN+ +FLHSS A+MEL+KF LV KR+++ E I                    
Sbjct: 76  SILSVIGSSNTPSFLHSSTALMELLKFNLVAKRYQLSEDIPLDTPVEELPSLEDLLIKRL 135

Query: 144 XMDVPIASHLTQMTAQLMVPSSFMTNVSLPELERLADDMIYYSNEKDHHDFAWYTKRAAL 203
            MDVPI  HL+Q+ AQL +P  F+T+ SLPEL RLADDMIY+S+EKDH DFAWY KR  +
Sbjct: 136 KMDVPIGPHLSQLIAQLSIPGPFLTDTSLPELHRLADDMIYFSSEKDHPDFAWYAKRMGV 195

Query: 204 ATTYLASKAFMAQDKSHNFMETMEFAQDKLHKVMTLGDYYNNVEEFGWFTLMSAVNLTKS 263
           +T Y++SK FMAQD+S  +++T EFA+DKL ++M LGDYYNN EE+ W+ LM+++N+ KS
Sbjct: 196 STAYMSSKLFMAQDRSPGYVDTFEFAKDKLKRIMKLGDYYNNAEEYAWYVLMNSINMAKS 255

Query: 264 QMAR 267
           + AR
Sbjct: 256 KAAR 259

>KAFR0L01480 Chr12 (274514..275308) [795 bp, 264 aa] {ON} Anc_7.351
           YLR201C
          Length = 264

 Score =  267 bits (682), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 130/245 (53%), Positives = 171/245 (69%), Gaps = 4/245 (1%)

Query: 24  RRYHPTSNEYVNPKVWEPLTYTPESPEFKLLSHTMENSVPQHGFTEKAIVNSLNAMKMPS 83
           R YHP SNEYVNP    PLTY+ +S + K+LSH+++  VP  GF EK+I+ S+N +   S
Sbjct: 24  RLYHPASNEYVNPTTISPLTYSMDSIQSKILSHSLKEYVPTSGFNEKSILKSINDLGYSS 83

Query: 84  GMLTTIGASNSATFLHSSPAVMELIKFQLVEKRHRMVEGITEIAEAXXXXXXXXXXXXXX 143
            M++ IGASNS +F HSSPAV+ELIK+ LV KR   +E +T+                  
Sbjct: 84  SMMSVIGASNSPSFAHSSPAVLELIKYNLVSKR---IE-LTKDTNDNTTTTLKELLLKRL 139

Query: 144 XMDVPIASHLTQMTAQLMVPSSFMTNVSLPELERLADDMIYYSNEKDHHDFAWYTKRAAL 203
            MD+PI+S L  + AQL  P  FM +VSLPEL +LADDMI++SNEKDHHD AWY+KR A+
Sbjct: 140 EMDIPISSQLRGLFAQLATPGKFMFDVSLPELFQLADDMIFFSNEKDHHDMAWYSKRLAV 199

Query: 204 ATTYLASKAFMAQDKSHNFMETMEFAQDKLHKVMTLGDYYNNVEEFGWFTLMSAVNLTKS 263
           +  Y+ SK FM QD S+NF  TM+FA DK+ +VM LG+YYNNVEE+ WFTLM+++NL KS
Sbjct: 200 SMAYVTSKMFMIQDTSNNFQMTMDFASDKVDRVMNLGEYYNNVEEYAWFTLMNSINLVKS 259

Query: 264 QMARV 268
           Q +R+
Sbjct: 260 QFSRM 264

>KNAG0B02620 Chr2 complement(507597..508394) [798 bp, 265 aa] {ON}
           Anc_7.351 YLR201C
          Length = 265

 Score =  264 bits (675), Expect = 3e-88,   Method: Compositional matrix adjust.
 Identities = 126/264 (47%), Positives = 174/264 (65%), Gaps = 3/264 (1%)

Query: 6   NLRLVTRQKQVSGLLSAVRRYHPTSNEYVNPKVWEPLTYTPESPEFKLLSHTMENSVPQH 65
           ++RL+        LLS  R YHP   EY N  V  PLTYT +SP+ ++L+H ++N VP  
Sbjct: 2   SIRLLKNSVSRRALLS-TRLYHPNPIEYANSTVVAPLTYTMDSPQSRILTHCLQNEVPHW 60

Query: 66  GFTEKAIVNSLNAMKMPSGMLTTIGASNSATFLHSSPAVMELIKFQLVEKRHRMVEGITE 125
           GFTE+A++ S+ A+   S M++ +GASNS +  HSSPAVMEL+KF LV+KRH + E +  
Sbjct: 61  GFTERALLKSIQAVGYDSSMMSVLGASNSPSIFHSSPAVMELVKFNLVKKRHALTESLAA 120

Query: 126 --IAEAXXXXXXXXXXXXXXXMDVPIASHLTQMTAQLMVPSSFMTNVSLPELERLADDMI 183
             +                  MDVP++  L  +  QL +PS FM NV++PEL RL+DDMI
Sbjct: 121 AGLGSPAALPSLEHLLVKRLQMDVPLSKQLGDLFTQLALPSQFMVNVAVPELFRLSDDMI 180

Query: 184 YYSNEKDHHDFAWYTKRAALATTYLASKAFMAQDKSHNFMETMEFAQDKLHKVMTLGDYY 243
           Y+SNEKDH D AWY+KR  ++  Y  SK FMAQD S N  +T+EFA+DKLH++MTLG+YY
Sbjct: 181 YFSNEKDHFDTAWYSKRLGVSLAYTTSKLFMAQDNSLNCQDTIEFARDKLHRIMTLGEYY 240

Query: 244 NNVEEFGWFTLMSAVNLTKSQMAR 267
           NNVEE+ W+++M+ VN  K+  +R
Sbjct: 241 NNVEEYAWYSIMTTVNRAKAGFSR 264

>TBLA0E00450 Chr5 complement(83483..84322) [840 bp, 279 aa] {ON}
           Anc_7.351 YLR201C
          Length = 279

 Score =  265 bits (676), Expect = 4e-88,   Method: Compositional matrix adjust.
 Identities = 124/247 (50%), Positives = 170/247 (68%), Gaps = 2/247 (0%)

Query: 21  SAVRRYHPTSNEYVNPKVWEPLTYTPESPEFKLLSHTMENSVPQHGFTEKAIVNSLNAMK 80
           + +R Y+  SN+       EPL Y  +S ++++L   ++NSVP  GFTE+AI+NS+N + 
Sbjct: 34  NGIRTYYSVSNDVKKSDHLEPLLYGKDSAQYRILEDAVQNSVPTFGFTERAIINSINKLG 93

Query: 81  MPSGMLTTIGASNSATFLHSSPAVMELIKFQLVEKRHRMVEGITEIAEAXXXXXXXXXXX 140
             S M++ +G+SN+   LHSSPAV+EL+KF LV KR ++ EGI    E            
Sbjct: 94  YNSSMISVLGSSNTHNILHSSPAVLELLKFNLVSKRLKLSEGID--PETKDLPSLEYLLL 151

Query: 141 XXXXMDVPIASHLTQMTAQLMVPSSFMTNVSLPELERLADDMIYYSNEKDHHDFAWYTKR 200
               MD  I S L +M  +L +P +F+   S+PEL RL+DDMIY+SNEKDHHD AWY+KR
Sbjct: 152 KRLQMDKAIQSRLNEMITKLSIPGTFLAETSIPELFRLSDDMIYFSNEKDHHDMAWYSKR 211

Query: 201 AALATTYLASKAFMAQDKSHNFMETMEFAQDKLHKVMTLGDYYNNVEEFGWFTLMSAVNL 260
            A++TTY+AS+ FMAQD S +  +T+EFAQDKL+KVM LG+YYNN EEF WFTLM++VN+
Sbjct: 212 LAVSTTYIASQIFMAQDTSVDCYKTLEFAQDKLNKVMNLGEYYNNTEEFLWFTLMTSVNI 271

Query: 261 TKSQMAR 267
            KSQ+AR
Sbjct: 272 VKSQLAR 278

>Smik_12.260 Chr12 complement(496547..497329) [783 bp, 260 aa] {ON}
           YLR201C (REAL)
          Length = 260

 Score =  259 bits (661), Expect = 4e-86,   Method: Compositional matrix adjust.
 Identities = 131/249 (52%), Positives = 176/249 (70%), Gaps = 1/249 (0%)

Query: 20  LSAVRRYHPTSNEYVNPKVWEPLTYTPESPEFKLLSHTMENSVPQHGFTEKAIVNSLNAM 79
            ++ R YHP   E+V     +PLTY  ESP++K+LS  +E  VP+HGF+E++IV SLN +
Sbjct: 11  CTSFRLYHPNPIEHVKSHHIKPLTYGKESPQYKVLSLALEQYVPKHGFSERSIVESLNEL 70

Query: 80  KMPSGMLTTIGASNSATFLHSSPAVMELIKFQLVEKRHRMVEGIT-EIAEAXXXXXXXXX 138
             PS M+++I ASNS +F HSS AVMELIKFQLV+KR+R+ E I  ++            
Sbjct: 71  GYPSSMISSISASNSPSFFHSSTAVMELIKFQLVDKRYRLTEAINPDVTPQYKLPSLEHL 130

Query: 139 XXXXXXMDVPIASHLTQMTAQLMVPSSFMTNVSLPELERLADDMIYYSNEKDHHDFAWYT 198
                 MD PI   L+++ +QL +PS F+   ++PEL RL+DDMIY+SNEKDHHD AWY 
Sbjct: 131 LLRRLEMDKPIGGCLSELMSQLAIPSGFLFETAIPELHRLSDDMIYFSNEKDHHDSAWYA 190

Query: 199 KRAALATTYLASKAFMAQDKSHNFMETMEFAQDKLHKVMTLGDYYNNVEEFGWFTLMSAV 258
           KR A+++TY+ SK FMAQDKSHN+ +T +FA+ KL++VM LG+YYNN EEF W+TLMS V
Sbjct: 191 KRLAVSSTYIGSKLFMAQDKSHNYKDTFDFAKHKLNRVMRLGEYYNNTEEFAWYTLMSTV 250

Query: 259 NLTKSQMAR 267
           NL KSQ+ R
Sbjct: 251 NLVKSQLVR 259

>NCAS0E02870 Chr5 complement(561968..562753) [786 bp, 261 aa] {ON}
           Anc_7.351 YLR201C
          Length = 261

 Score =  258 bits (659), Expect = 8e-86,   Method: Compositional matrix adjust.
 Identities = 125/261 (47%), Positives = 169/261 (64%), Gaps = 3/261 (1%)

Query: 9   LVTRQKQVSGLLSAVRRYHPTSNEYVNPKVWEPLTYTPESPEFKLLSHTMENSVPQHGFT 68
           ++ R     GL S  R YHP+  EYV P    PLTY  ES ++K+LS+ +   VP+HGF 
Sbjct: 1   MLNRSILKKGLFS-YRSYHPSLKEYVKPATLSPLTYNKESVQYKILSNALTKWVPKHGFK 59

Query: 69  EKAIVNSLNAMKMPSGMLTTIGASNS-ATFLHSSPAVMELIKFQLVEKRHRMVEGIT-EI 126
           EKAI +SLN +   S +L+ IGASNS A F   SPAVMELIKFQLV KR+ + E +  + 
Sbjct: 60  EKAITDSLNELGFSSSLLSVIGASNSPAIFRSISPAVMELIKFQLVSKRYELTENLCPDT 119

Query: 127 AEAXXXXXXXXXXXXXXXMDVPIASHLTQMTAQLMVPSSFMTNVSLPELERLADDMIYYS 186
                             MD  I   +  + A+L  PSSF+ +V+LPEL RL+DDMIY+S
Sbjct: 120 TPKNELPSLESLLLKRLEMDKAIGKQIPHLFAELATPSSFLFDVALPELHRLSDDMIYFS 179

Query: 187 NEKDHHDFAWYTKRAALATTYLASKAFMAQDKSHNFMETMEFAQDKLHKVMTLGDYYNNV 246
           NEKDHHD AWYTKR  ++  Y++SK +MAQD S +F +T+ FA+DKLH++M LG+YYNN 
Sbjct: 180 NEKDHHDMAWYTKRLGVSCAYVSSKLYMAQDNSRDFEDTLSFAKDKLHRIMKLGEYYNNT 239

Query: 247 EEFGWFTLMSAVNLTKSQMAR 267
           EE+ W+  M + NL ++++AR
Sbjct: 240 EEYAWYMFMVSTNLVRARLAR 260

>KLLA0D12320g Chr4 complement(1048556..1049308) [753 bp, 250 aa]
           {ON} similar to uniprot|Q05779 Saccharomyces cerevisiae
           YLR201C FMP53,
          Length = 250

 Score =  251 bits (642), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 119/244 (48%), Positives = 170/244 (69%), Gaps = 1/244 (0%)

Query: 24  RRYHPTSNEYVNPKVWEPLTYTPESPEFKLLSHTMENSVPQHGFTEKAIVNSLNAMKMPS 83
           R YHP + E+  PK+ +PLTY  +S +FK+LS+ +   VPQ+GF E+AIV SLN + M S
Sbjct: 7   RLYHPNNLEHALPKIIKPLTYGTDSVQFKVLSNALNKHVPQYGFNERAIVQSLNELGMGS 66

Query: 84  GMLTTIGASNSATFLHSSPAVMELIKFQLVEKRHRMVEGITEIAEAXXXXXXXXXXXXXX 143
             L+ +G+SNS +F + SP+V+EL+KF LV KR++++  +  +                 
Sbjct: 67  SYLSVLGSSNSPSFFNVSPSVLELVKFHLVSKRNQLITDLP-LDSDKPLPDLKTLFLQRL 125

Query: 144 XMDVPIASHLTQMTAQLMVPSSFMTNVSLPELERLADDMIYYSNEKDHHDFAWYTKRAAL 203
            ++  +A HL+Q+ + + VP  F+ + +L EL +L DDMI+YSNE+DH+DFAWY+KR AL
Sbjct: 126 KLNEHVAPHLSQLLSIMSVPGEFLASTALSELHKLTDDMIFYSNEQDHNDFAWYSKRIAL 185

Query: 204 ATTYLASKAFMAQDKSHNFMETMEFAQDKLHKVMTLGDYYNNVEEFGWFTLMSAVNLTKS 263
           +T Y++S+ FMAQDKSHNF ETMEFAQ KL+KV  LG  YNN EE+ WFTL+S++NL KS
Sbjct: 186 STAYVSSELFMAQDKSHNFQETMEFAQSKLNKVSQLGSMYNNTEEYLWFTLLSSINLAKS 245

Query: 264 QMAR 267
           Q+ R
Sbjct: 246 QITR 249

>KLTH0H01232g Chr8 complement(119673..120446) [774 bp, 257 aa] {ON}
           similar to uniprot|Q05779 Saccharomyces cerevisiae
           YLR201C FMP53
          Length = 257

 Score =  240 bits (612), Expect = 9e-79,   Method: Compositional matrix adjust.
 Identities = 114/248 (45%), Positives = 163/248 (65%), Gaps = 2/248 (0%)

Query: 22  AVRRYHPTSNEYVNPKVWEPLTYTPESPEFKLLSHTMENSVPQHGFTEKAIVNSLNAMKM 81
           A R YHP++ E+     + PLTY P S +FK+L H +   VP +GF E+A+V SLN + +
Sbjct: 9   ARRLYHPSALEHQLAHSFAPLTYGPGSTQFKVLEHALNKHVPSYGFNERALVASLNDLDL 68

Query: 82  PSGMLTTIGASNSATFLHSSPAVMELIKFQLVEKRHRMVEGI--TEIAEAXXXXXXXXXX 139
              +L+ IGASNS +FL++SPAV+ELIKF LV KR+ + + +     +            
Sbjct: 69  GPSLLSVIGASNSPSFLNASPAVLELIKFHLVTKRYALTKELDPARTSSPAEPPALETLF 128

Query: 140 XXXXXMDVPIASHLTQMTAQLMVPSSFMTNVSLPELERLADDMIYYSNEKDHHDFAWYTK 199
                ++ PIA HLTQ+ + L +P  F+   +LPEL RL+DDM+Y+S E D +DFAWY+K
Sbjct: 129 HRRLELNKPIAPHLTQLLSSLSIPGEFLVQTALPELHRLSDDMVYFSKEPDANDFAWYSK 188

Query: 200 RAALATTYLASKAFMAQDKSHNFMETMEFAQDKLHKVMTLGDYYNNVEEFGWFTLMSAVN 259
           R AL+  +++S+ FMAQD+S N+ +T EFA +KLH V  LG YYNN EE+ W+TL+ +VN
Sbjct: 189 RIALSCAFVSSELFMAQDRSANYADTFEFAAEKLHNVSKLGQYYNNTEEYMWYTLLMSVN 248

Query: 260 LTKSQMAR 267
           L KSQ+ R
Sbjct: 249 LAKSQLTR 256

>NDAI0E04470 Chr5 complement(1006109..1006903) [795 bp, 264 aa] {ON}
           Anc_7.351 YLR201C
          Length = 264

 Score =  239 bits (609), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 111/251 (44%), Positives = 166/251 (66%), Gaps = 3/251 (1%)

Query: 20  LSAVRRYHPTSNEYVNPKVWEPLTYTPESPEFKLLSHTMENSVPQHGFTEKAIVNSLNAM 79
           LS  R +H  + EY       PLTY  +S ++K+LS+ +   VP+ GFT++AI +SLN +
Sbjct: 13  LSINRAFHSNTLEYAKAATLSPLTYNKDSVQYKILSNALNKWVPKKGFTDEAITSSLNEL 72

Query: 80  KMPSGMLTTIGASNSATFLHS-SPAVMELIKFQLVEKRHRMVEGITEIAEAXXXX--XXX 136
            + S + + +G+SNS +   S SPAVMEL+KFQLV KR+++ E IT   E          
Sbjct: 73  DLSSSLFSVLGSSNSPSIFRSISPAVMELLKFQLVSKRYQLTENITPYIETAKDKLPSLE 132

Query: 137 XXXXXXXXMDVPIASHLTQMTAQLMVPSSFMTNVSLPELERLADDMIYYSNEKDHHDFAW 196
                   MD P+ + L+ +  QL++PS  + NV+LPEL  L+DD+IY+SNEKDHHD AW
Sbjct: 133 TLLIERLKMDQPLNNQLSSLFNQLIIPSPLLFNVALPELFNLSDDLIYFSNEKDHHDMAW 192

Query: 197 YTKRAALATTYLASKAFMAQDKSHNFMETMEFAQDKLHKVMTLGDYYNNVEEFGWFTLMS 256
           Y KR  ++  Y++SK +M ++   NF +T++FA+DKLH++M LG+YYNN EE+ W+TLM 
Sbjct: 193 YAKRLGVSCAYVSSKLYMVKNNGENFDKTIDFAKDKLHRIMNLGEYYNNTEEYAWYTLMV 252

Query: 257 AVNLTKSQMAR 267
           ++NL K+++AR
Sbjct: 253 SMNLVKARLAR 263

>Kwal_56.24644 s56 (1087270..1088046) [777 bp, 258 aa] {ON} YLR201C
           - Hypothetical ORF [contig 161] FULL
          Length = 258

 Score =  236 bits (602), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 115/246 (46%), Positives = 159/246 (64%), Gaps = 2/246 (0%)

Query: 24  RRYHPTSNEYVNPKVWEPLTYTPESPEFKLLSHTMENSVPQHGFTEKAIVNSLNAMKMPS 83
           R Y P   EY       PL Y  +S +FK+L H ++N VP +GF E+A+V SLN + + S
Sbjct: 12  RFYQPNPLEYQLTTKLAPLAYGTQSIQFKVLDHALKNHVPSYGFNERALVASLNDLGLGS 71

Query: 84  GMLTTIGASNSATFLHSSPAVMELIKFQLVEKRHRMVEG--ITEIAEAXXXXXXXXXXXX 141
            +L++IGA NS   L+SSPAV+EL+KF LV KR+ + +   I   A              
Sbjct: 72  QVLSSIGAPNSPPLLNSSPAVLELVKFHLVTKRYALTKDLDIARCASPAEPPALETLFHK 131

Query: 142 XXXMDVPIASHLTQMTAQLMVPSSFMTNVSLPELERLADDMIYYSNEKDHHDFAWYTKRA 201
              +++PIA H+TQ+ A L +P  F+   +LPEL RL+DDMIY+S E D +DFAWY+KRA
Sbjct: 132 RLELNIPIAQHMTQLLAILAMPGEFLLQSALPELHRLSDDMIYFSKEPDANDFAWYSKRA 191

Query: 202 ALATTYLASKAFMAQDKSHNFMETMEFAQDKLHKVMTLGDYYNNVEEFGWFTLMSAVNLT 261
           A++  +++S+ FMAQDKS N+ +T EFA DKLH V  LG YY N EE+ W+TL+ +VNL 
Sbjct: 192 AISCAFVSSELFMAQDKSPNYADTFEFAADKLHNVTKLGQYYTNTEEYMWYTLLMSVNLA 251

Query: 262 KSQMAR 267
           KSQ+ R
Sbjct: 252 KSQITR 257

>SAKL0F11396g Chr6 (886970..887734) [765 bp, 254 aa] {ON} similar to
           uniprot|Q05779 Saccharomyces cerevisiae YLR201C FMP53
          Length = 254

 Score =  228 bits (581), Expect = 4e-74,   Method: Compositional matrix adjust.
 Identities = 109/246 (44%), Positives = 174/246 (70%), Gaps = 2/246 (0%)

Query: 22  AVRRYHPTSNEYVNPKVWEPLTYTPESPEFKLLSHTMENSVPQHGFTEKAIVNSLNAMKM 81
           A R YHP + E+ + KV  PL Y+ +SP++K+L++ ++  VP++GF E+A+ +S + +  
Sbjct: 10  ARRGYHPNNLEHASSKVLPPLIYSKDSPQWKILANALDEQVPKYGFNERALTSSCSDLGY 69

Query: 82  PSGMLTTIGASNSATFLHSSPAVMELIKFQLVEKRHRMVEGITEIAEAXXXXXXXXXXXX 141
            S  L+ +GASNS +F +SSPAV+EL+KF LV KR+ + +G+ +                
Sbjct: 70  SSSFLSVLGASNSPSFFNSSPAVLELLKFHLVSKRYSLTDGVAD--GTLESPSLENLFLK 127

Query: 142 XXXMDVPIASHLTQMTAQLMVPSSFMTNVSLPELERLADDMIYYSNEKDHHDFAWYTKRA 201
              M+ PIA+HL+Q+ + L +P +F+   ++PEL RL+DDM+Y+SNE DH+DFAWY+KR 
Sbjct: 128 RLEMNKPIAAHLSQLLSCLALPGAFLAEYAIPELHRLSDDMVYFSNEPDHNDFAWYSKRL 187

Query: 202 ALATTYLASKAFMAQDKSHNFMETMEFAQDKLHKVMTLGDYYNNVEEFGWFTLMSAVNLT 261
           A++T Y++S+ FMAQDKS ++ +T++FA++KL  +  LG+ YNNVEE+ W+TL+S+++L 
Sbjct: 188 AISTAYVSSELFMAQDKSIDYQDTVKFAKEKLKNIKQLGEAYNNVEEYAWYTLLSSISLA 247

Query: 262 KSQMAR 267
           KSQM R
Sbjct: 248 KSQMTR 253

>ACL147W Chr3 (92477..93217) [741 bp, 246 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YLR201C
          Length = 246

 Score =  207 bits (527), Expect = 5e-66,   Method: Compositional matrix adjust.
 Identities = 103/244 (42%), Positives = 146/244 (59%), Gaps = 5/244 (2%)

Query: 24  RRYHPTSNEYVNPKVWEPLTYTPESPEFKLLSHTMENSVPQHGFTEKAIVNSLNAMKMPS 83
           R YHP + E+       PL Y  +SP++K+L   +E  VP  GF E+AIV +   +   S
Sbjct: 7   RLYHPNTLEHAVGNRLRPLAYEQDSPQYKVLQRALEAHVPVLGFNERAIVRAAGDLGYGS 66

Query: 84  GMLTTIGASNSATFLHSSPAVMELIKFQLVEKRHRMVEGITEIAEAXXXXXXXXXXXXXX 143
            +L+ + A NS   L+   AV+EL+KF LV KR  + +     A A              
Sbjct: 67  AVLSALAAPNSPALLNVPSAVLELVKFHLVTKRVALAD-----AAAQGNVSMEQLFLQRV 121

Query: 144 XMDVPIASHLTQMTAQLMVPSSFMTNVSLPELERLADDMIYYSNEKDHHDFAWYTKRAAL 203
             D P+A  LTQ+ + L +P  F+ N ++PEL RL+DD+IYYS EKDH D AWY+KRAA+
Sbjct: 122 EADRPLAGQLTQLLSILSLPGEFLVNTAMPELFRLSDDLIYYSGEKDHPDLAWYSKRAAV 181

Query: 204 ATTYLASKAFMAQDKSHNFMETMEFAQDKLHKVMTLGDYYNNVEEFGWFTLMSAVNLTKS 263
           A  Y+++  FMA+D+S    ET+ FA+ +L +V +LG  YNNVEEF W+ L+ A+NL KS
Sbjct: 182 AMAYVSTNLFMARDRSPALEETLHFARRRLQQVDSLGTAYNNVEEFAWYQLLMAMNLVKS 241

Query: 264 QMAR 267
           Q+ R
Sbjct: 242 QLTR 245

>Ecym_4722 Chr4 complement(1413860..1414621) [762 bp, 253 aa] {ON}
           similar to Ashbya gossypii ACL147W
          Length = 253

 Score =  202 bits (514), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 102/250 (40%), Positives = 148/250 (59%), Gaps = 7/250 (2%)

Query: 19  LLSAVRR-YHPTSNEYVNPKVWEPLTYTPESPEFKLLSHTMENSVPQHGFTEKAIVNSLN 77
           +L   RR YH  S EY       PL Y   SP++K+L+  +E  VP  GF + AIV++ N
Sbjct: 9   MLGGFRRFYHVNSAEYAVGNTLRPLIYGRCSPQYKVLNCALEKYVPFKGFKDSAIVDAAN 68

Query: 78  AMKMPSGMLTTIGASNSATFLHSSPAVMELIKFQLVEKRHRMVEGITEIAEAXXXXXXXX 137
            +   S +L  IGA+NS    + S +V EL+KF LV KR+    G+ E  E         
Sbjct: 69  ELGYNSAVLAAIGANNSPAMFNVSTSVQELVKFHLVTKRY----GLQEDQEGTKTLEELF 124

Query: 138 XXXXXXXMDVPIASHLTQMTAQLMVPSSFMTNVSLPELERLADDMIYYSNEKDHHDFAWY 197
                   +  +  HL ++ + L +P  F+ N  LPEL +LADDMIYYS EKD +D AWY
Sbjct: 125 LKRLEA--NKSLGPHLKEVLSILAIPGDFLVNTGLPELFQLADDMIYYSTEKDFNDLAWY 182

Query: 198 TKRAALATTYLASKAFMAQDKSHNFMETMEFAQDKLHKVMTLGDYYNNVEEFGWFTLMSA 257
           +KR A++  Y++++ FMA+D S NF  TMEFA+ +++++  +G  YNN+EEF WF L++ 
Sbjct: 183 SKRLAVSMAYISTELFMAKDSSPNFQATMEFAKGRINQIDEMGTAYNNIEEFAWFQLLTT 242

Query: 258 VNLTKSQMAR 267
           VNL +SQ+ R
Sbjct: 243 VNLARSQLVR 252

>NCAS0J02110 Chr10 (402095..405994) [3900 bp, 1299 aa] {ON} 
          Length = 1299

 Score = 32.7 bits (73), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 28/108 (25%), Positives = 46/108 (42%), Gaps = 25/108 (23%)

Query: 9   LVTRQKQVSGLLSAVRRYHPTSNEYVNPK-------------VWEPLTYTPESPEFKLLS 55
            + + + +  LL  ++ Y P  N  VNP              +   +  TP+S +F+ L 
Sbjct: 588 FIDKNRDIKDLLKGLKCYRPYINYSVNPDGTPKPPKKMQAKGIVGFVRETPDSMKFRTLP 647

Query: 56  HTME-NSVPQHGFTEKAIVNSLNA---------MKMPSGMLTTIGASN 93
             ME N VP+ G  EK I+ +  A         +K P   + ++G SN
Sbjct: 648 SNMEKNGVPKPG--EKEIMVTTTAYFAKKYDIKLKYPDVKMVSLGGSN 693

>NDAI0J02820 Chr10 (698768..702619) [3852 bp, 1283 aa] {ON} 
          Length = 1283

 Score = 32.0 bits (71), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 29/108 (26%), Positives = 46/108 (42%), Gaps = 25/108 (23%)

Query: 9   LVTRQKQVSGLLSAVRRYHPTSNEYVN-------PKVWEPLTY------TPESPEFKLLS 55
            V + + +  LL  ++ Y P  N  VN       P+  +P         TP+S +F+ L 
Sbjct: 576 FVDKNRDIQDLLKGLKVYRPYINYSVNPDGTPKPPRRMQPKGIVGFARETPDSLKFRTLP 635

Query: 56  HTME-NSVPQHGFTEKAIVNSLNA---------MKMPSGMLTTIGASN 93
             ME N VP+ G  EK I+ +  A         +K P   + ++G  N
Sbjct: 636 SDMEKNGVPKQG--EKEIMVTTTAYFAKKYDIKLKYPDVKMVSLGGKN 681

>Kwal_55.19808 s55 (136074..138551) [2478 bp, 825 aa] {ON} YBL047C
           (EDE1) - EH domain protein involved in endocytosis
           [contig 159] FULL
          Length = 825

 Score = 31.6 bits (70), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 28/101 (27%), Positives = 44/101 (43%), Gaps = 15/101 (14%)

Query: 147 VPIASHLTQMTAQLMVPSSFMTNVSLPELERLADDMIYYSNEKDHHDFAWYTKRAALATT 206
           +P+ S +++  + + VPSS  TN         A D      +K   D  + +   + A T
Sbjct: 243 MPLQSPVSRQPSLVRVPSSTFTNA--------ASDWTLSPEKKQQFDAIFDSLDKSRAGT 294

Query: 207 YLASKAFMAQDKSHNFMETMEFAQDKLHKVMTLGDYYNNVE 247
            L+S+A +       F  +   +QD L  V  L D YNN E
Sbjct: 295 -LSSQALVP------FFLSSRLSQDVLASVWDLADIYNNAE 328

>AER354W Chr5 (1290374..1291714) [1341 bp, 446 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR220W (ERG8)
          Length = 446

 Score = 30.4 bits (67), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 25/76 (32%), Positives = 35/76 (46%), Gaps = 7/76 (9%)

Query: 14  KQVSGLLSAVRRYHPTSNEYVNPKVWEPLTYTPESPEFKLLSHTMENSVPQHGFTEKAIV 73
           KQ  G   A  R   TS+++ N + WE   YT +   F+     +E    +H F EK + 
Sbjct: 42  KQTEGSAEAPLRVKLTSSQFNNDQ-WE---YTVD---FESNYELVETKGRRHPFIEKTLA 94

Query: 74  NSLNAMKMPSGMLTTI 89
           N LN  + P G L  I
Sbjct: 95  NVLNYFQPPRGQLAEI 110

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.127    0.364 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 25,391,537
Number of extensions: 965252
Number of successful extensions: 2859
Number of sequences better than 10.0: 29
Number of HSP's gapped: 2902
Number of HSP's successfully gapped: 29
Length of query: 268
Length of database: 53,481,399
Length adjustment: 108
Effective length of query: 160
Effective length of database: 41,097,471
Effective search space: 6575595360
Effective search space used: 6575595360
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 65 (29.6 bits)