Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
CAGL0A03905g7.344ON28228213580.0
SAKL0F11242g7.344ON3092577412e-97
TDEL0C020307.344ON3112547362e-96
ZYRO0F11594g7.344ON3092647282e-95
Suva_10.2997.344ON3202627205e-94
KLTH0H01386g7.344ON3072577186e-94
KLLA0D12474g7.344ON3122577171e-93
YLR205C (HMX1)7.344ON3172637162e-93
Kwal_56.246247.344ON3072577031e-91
Ecym_47297.344ON3262547032e-91
Smik_12.2637.344ON3182636962e-90
Skud_12.2687.344ON3182516929e-90
NCAS0E028907.344ON3152566222e-79
NDAI0E045007.344ON3272685991e-75
TPHA0F029207.344ON3202635493e-68
ACL154W7.344ON3192585093e-62
Kpol_530.367.344ON3112655074e-62
KAFR0L014707.344ON3002564543e-54
KNAG0B026407.344ON3022654464e-53
TDEL0A004503.26ON422140740.83
ZYRO0G06270g2.140ON23855692.5
TDEL0B050202.140ON25229666.3
TPHA0F005004.74ON47750666.5
ZYRO0G09592g4.87ON839104669.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0A03905g
         (282 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0A03905g Chr1 complement(395219..396067) [849 bp, 282 aa] {O...   527   0.0  
SAKL0F11242g Chr6 (878709..879638) [930 bp, 309 aa] {ON} similar...   290   2e-97
TDEL0C02030 Chr3 complement(351368..352303) [936 bp, 311 aa] {ON...   288   2e-96
ZYRO0F11594g Chr6 (951726..952655) [930 bp, 309 aa] {ON} similar...   285   2e-95
Suva_10.299 Chr10 complement(525524..526486) [963 bp, 320 aa] {O...   281   5e-94
KLTH0H01386g Chr8 complement(128402..129325) [924 bp, 307 aa] {O...   281   6e-94
KLLA0D12474g Chr4 complement(1058158..1059096) [939 bp, 312 aa] ...   280   1e-93
YLR205C Chr12 complement(552724..553677) [954 bp, 317 aa] {ON}  ...   280   2e-93
Kwal_56.24624 s56 (1078618..1079541) [924 bp, 307 aa] {ON} YLR20...   275   1e-91
Ecym_4729 Chr4 complement(1423384..1424364) [981 bp, 326 aa] {ON...   275   2e-91
Smik_12.263 Chr12 complement(499758..500714) [957 bp, 318 aa] {O...   272   2e-90
Skud_12.268 Chr12 complement(499347..500303) [957 bp, 318 aa] {O...   271   9e-90
NCAS0E02890 Chr5 complement(565154..566101) [948 bp, 315 aa] {ON...   244   2e-79
NDAI0E04500 Chr5 complement(1009814..1010797) [984 bp, 327 aa] {...   235   1e-75
TPHA0F02920 Chr6 (645567..646529) [963 bp, 320 aa] {ON} Anc_7.34...   216   3e-68
ACL154W Chr3 (83962..84921) [960 bp, 319 aa] {ON} Syntenic homol...   200   3e-62
Kpol_530.36 s530 complement(84853..85788) [936 bp, 311 aa] {ON} ...   199   4e-62
KAFR0L01470 Chr12 (272767..273669) [903 bp, 300 aa] {ON} Anc_7.3...   179   3e-54
KNAG0B02640 Chr2 complement(510618..511526) [909 bp, 302 aa] {ON...   176   4e-53
TDEL0A00450 Chr1 complement(80330..81598) [1269 bp, 422 aa] {ON}...    33   0.83 
ZYRO0G06270g Chr7 (494886..494939,495003..495665) [717 bp, 238 a...    31   2.5  
TDEL0B05020 Chr2 (879469..879528,879589..880287) [759 bp, 252 aa...    30   6.3  
TPHA0F00500 Chr6 complement(119121..120554) [1434 bp, 477 aa] {O...    30   6.5  
ZYRO0G09592g Chr7 complement(761703..764222) [2520 bp, 839 aa] {...    30   9.1  

>CAGL0A03905g Chr1 complement(395219..396067) [849 bp, 282 aa] {ON}
           similar to uniprot|P32339 Saccharomyces cerevisiae
           YLR205c
          Length = 282

 Score =  527 bits (1358), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 258/282 (91%), Positives = 258/282 (91%)

Query: 1   MSVRFAVALRHGKLYRQGILAFYYVFQAIEQEIDALLSIDXXXXXXXXXDVSDQKLLASK 60
           MSVRFAVALRHGKLYRQGILAFYYVFQAIEQEIDALLSID         DVSDQKLLASK
Sbjct: 1   MSVRFAVALRHGKLYRQGILAFYYVFQAIEQEIDALLSIDTATGATGATDVSDQKLLASK 60

Query: 61  IVKQFWMPEFRRTEQLYKDLLLLYSPEYPTSTELDAMLVDHQLPPQLQGFVDMVHATVRQ 120
           IVKQFWMPEFRRTEQLYKDLLLLYSPEYPTSTELDAMLVDHQLPPQLQGFVDMVHATVRQ
Sbjct: 61  IVKQFWMPEFRRTEQLYKDLLLLYSPEYPTSTELDAMLVDHQLPPQLQGFVDMVHATVRQ 120

Query: 121 NPVTVLAYCHVMYLALFAGGKVMRSTLYRNTGLFPKFEHLSSKELARKGTNFFTFSDAGV 180
           NPVTVLAYCHVMYLALFAGGKVMRSTLYRNTGLFPKFEHLSSKELARKGTNFFTFSDAGV
Sbjct: 121 NPVTVLAYCHVMYLALFAGGKVMRSTLYRNTGLFPKFEHLSSKELARKGTNFFTFSDAGV 180

Query: 181 DVENQLKWQYKKNYELATREALAENDKLEIIDVAKRIFERNMDIIQEIGQLNKEALTNNK 240
           DVENQLKWQYKKNYELATREALAENDKLEIIDVAKRIFERNMDIIQEIGQLNKEALTNNK
Sbjct: 181 DVENQLKWQYKKNYELATREALAENDKLEIIDVAKRIFERNMDIIQEIGQLNKEALTNNK 240

Query: 241 LDLLQYVFEELKFYNKDRSHQQXXXXXXXXXXXXXXXRIVYR 282
           LDLLQYVFEELKFYNKDRSHQQ               RIVYR
Sbjct: 241 LDLLQYVFEELKFYNKDRSHQQLVYAVLVLLALLVLYRIVYR 282

>SAKL0F11242g Chr6 (878709..879638) [930 bp, 309 aa] {ON} similar to
           uniprot|P32339 Saccharomyces cerevisiae YLR205C HMX1 ER
           localized, heme-binding peroxidase involved in the
           degradation of heme
          Length = 309

 Score =  290 bits (741), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 137/257 (53%), Positives = 182/257 (70%), Gaps = 11/257 (4%)

Query: 1   MSVRFAVALRHGKLYRQGILAFYYVFQAIEQEIDALLSIDXXXXXXXXXDVSDQKLLASK 60
           MSV+ A A++HG +YRQGILAFYY+F A+EQEID LL              +  +L   K
Sbjct: 34  MSVKLAFAMKHGHIYRQGILAFYYIFAAVEQEIDNLLQ----------NASTPLELQTQK 83

Query: 61  IVKQFWMPEFRRTEQLYKDLLLLYSPEYPTSTELDAMLVDHQLPPQLQGFVDMVHATVRQ 120
           I+ QFW  EFRR+  +++DL LLYS EY T TEL A L D+ LPPQ Q FV+ +H TVR+
Sbjct: 84  ILNQFWCEEFRRSNMIFQDLELLYSKEYSTRTELHAFLDDNVLPPQQQAFVEYIHQTVRE 143

Query: 121 NPVTVLAYCHVMYLALFAGGKVMRSTLYRNTGLFPKFEHLSSKELARKGTNFFTFSDAGV 180
            P T+LAYCHV+YLALFAGGK+M+S +YR+TGLFPKF+HL+ +++ R+GTNFFTFS+ G 
Sbjct: 144 KPYTILAYCHVLYLALFAGGKLMKSNIYRHTGLFPKFQHLTPEQIVRRGTNFFTFSEEGA 203

Query: 181 DVENQLKWQYKKNYELATREALAENDKLEIIDVAKRIFERNMDIIQEIGQLNKEALTNN- 239
           D E +L+W+YKK YELATR+ L E  K EII V+  IF+ NMD+I E+G++N+  L    
Sbjct: 204 DAEGKLRWEYKKGYELATRKELTEEQKQEIIKVSSEIFDWNMDVIGELGEINRNELMGKF 263

Query: 240 KLDLLQYVFEELKFYNK 256
              L+ ++ EE K+  K
Sbjct: 264 SFKLVSFILEEWKYSEK 280

>TDEL0C02030 Chr3 complement(351368..352303) [936 bp, 311 aa] {ON}
           Anc_7.344 YLR205C
          Length = 311

 Score =  288 bits (736), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 138/254 (54%), Positives = 186/254 (73%), Gaps = 11/254 (4%)

Query: 1   MSVRFAVALRHGKLYRQGILAFYYVFQAIEQEIDALLSIDXXXXXXXXXDVSDQKLLASK 60
           MSVR A AL+HG +YRQGILAFY++F A+EQE+D LL+             +D++     
Sbjct: 36  MSVRLAFALKHGFIYRQGILAFYHIFDAVEQELDRLLN----------DPQNDEERQMQH 85

Query: 61  IVKQFWMPEFRRTEQLYKDLLLLYSPEYPTSTELDAMLVDHQLPPQLQGFVDMVHATVRQ 120
           +++QFW+ EFRRT +++KDL +LYSPEY  S  L   +    L PQLQ FVD +H+TV+Q
Sbjct: 86  VLRQFWLEEFRRTNRIFKDLEVLYSPEYSDSESLRNFVEHQPLAPQLQSFVDSIHSTVQQ 145

Query: 121 NPVTVLAYCHVMYLALFAGGKVMRSTLYRNTGLFPKFEHLSSKELARKGTNFFTFSDAGV 180
           +  T+LAYCHV+YLALFAGGKVMRS LYR+TGLFPKFE+L+ KEL  +GTNFFTFSD G 
Sbjct: 146 DSCTILAYCHVLYLALFAGGKVMRSNLYRHTGLFPKFEYLTPKELVIRGTNFFTFSDEGS 205

Query: 181 DVENQLKWQYKKNYELATREALAENDKLEIIDVAKRIFERNMDIIQEIGQLNK-EALTNN 239
           D EN+L+W+YK+ YELATR+ L+E+ K  I+ V+ +IF+ NMD+I EIG++N+ E ++  
Sbjct: 206 DAENKLRWKYKEGYELATRQELSESQKTRILQVSSQIFDWNMDVIGEIGEMNRNELMSKF 265

Query: 240 KLDLLQYVFEELKF 253
              LL Y+ EE K+
Sbjct: 266 SFKLLTYLSEEWKY 279

>ZYRO0F11594g Chr6 (951726..952655) [930 bp, 309 aa] {ON} similar to
           uniprot|P32339 Saccharomyces cerevisiae YLR205C HMX1 ER
           localized, heme-binding peroxidase involved in the
           degradation of heme
          Length = 309

 Score =  285 bits (728), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 135/264 (51%), Positives = 190/264 (71%), Gaps = 12/264 (4%)

Query: 1   MSVRFAVALRHGKLYRQGILAFYYVFQAIEQEIDALLSIDXXXXXXXXXDVSDQKLLASK 60
           MSVR A AL+HG ++RQGILA+YY+FQAIEQE+D ++              +++++    
Sbjct: 32  MSVRLAFALKHGWIFRQGILAYYYIFQAIEQELDRIMD----------HARNEKEMQMQN 81

Query: 61  IVKQFWMPEFRRTEQLYKDLLLLYSPEYPTSTELDAMLVD-HQLPPQLQGFVDMVHATVR 119
           ++ +FWM +FRRT+++++DL LLYSPE+PT + L+  L   + L P LQ FVD +H  V+
Sbjct: 82  VLGKFWMNDFRRTDRIFQDLTLLYSPEFPTESSLEQFLTSGNHLAPTLQAFVDSIHKNVQ 141

Query: 120 QNPVTVLAYCHVMYLALFAGGKVMRSTLYRNTGLFPKFEHLSSKELARKGTNFFTFSDAG 179
           + P T+LAYCHV+YLALFAGGKVMRS LYR+TGLFPKF+HLS +EL ++GTNFFTFS+ G
Sbjct: 142 EEPCTILAYCHVLYLALFAGGKVMRSNLYRHTGLFPKFQHLSPRELVQRGTNFFTFSEEG 201

Query: 180 VDVENQLKWQYKKNYELATREALAENDKLEIIDVAKRIFERNMDIIQEIGQLNKEALTNN 239
            + EN+L+W+YK+ YELATR+ L E  K +II V+  IF+ NM+ I EIG+LN++ L  +
Sbjct: 202 SEAENKLRWRYKRGYELATRDELTEEQKQKIISVSSEIFQWNMETIAEIGELNRQELMGS 261

Query: 240 -KLDLLQYVFEELKFYNKDRSHQQ 262
               LL Y+ EE K  +K   +Q+
Sbjct: 262 VSFRLLTYLHEEWKHTDKLSKNQK 285

>Suva_10.299 Chr10 complement(525524..526486) [963 bp, 320 aa] {ON}
           YLR205C (REAL)
          Length = 320

 Score =  281 bits (720), Expect = 5e-94,   Method: Compositional matrix adjust.
 Identities = 138/262 (52%), Positives = 182/262 (69%), Gaps = 11/262 (4%)

Query: 1   MSVRFAVALRHGKLYRQGILAFYYVFQAIEQEIDALLSIDXXXXXXXXXDVSDQKLLASK 60
           M ++ A+A+RHG +YRQGILA+YYVF AIEQEID LL+            VS+++L A  
Sbjct: 39  MGIKMAIAMRHGFIYRQGILAYYYVFDAIEQEIDRLLN----------DAVSEKELQACG 88

Query: 61  IVKQFWMPEFRRTEQLYKDLLLLYSPEYPTSTELDAMLVDHQLPPQLQGFVDMVHATVRQ 120
           I+KQFW+ +FRR+ Q+YKDL LLYS  + ++  L+  L   + PP LQ FVD +H  +RQ
Sbjct: 89  ILKQFWLEDFRRSTQIYKDLKLLYSNTFKSTESLNEFLATFEKPPLLQQFVDDIHDNIRQ 148

Query: 121 NPVTVLAYCHVMYLALFAGGKVMRSTLYRNTGLFPKFEHLSSKELARKGTNFFTFSDAGV 180
            P T+L+YCHV+YLALFAGGK++RS LYR  GLFP FE L+ KEL +KGTNFFTFS+ G 
Sbjct: 149 EPCTILSYCHVLYLALFAGGKLIRSNLYRRLGLFPNFEKLTQKELVKKGTNFFTFSELGP 208

Query: 181 DVENQLKWQYKKNYELATREALAENDKLEIIDVAKRIFERNMDIIQEIGQLN-KEALTNN 239
             E +LKW+YKKNYELATR  L E  KL+II VA+ IF+ N +I+ EIG+LN +E ++  
Sbjct: 209 TEETRLKWEYKKNYELATRTELTEAQKLKIISVAEGIFDWNFNIVAEIGELNRRELMSKF 268

Query: 240 KLDLLQYVFEELKFYNKDRSHQ 261
               + YV+EE  F     S +
Sbjct: 269 SFKCVTYVYEEWMFSKGSASRK 290

>KLTH0H01386g Chr8 complement(128402..129325) [924 bp, 307 aa] {ON}
           similar to uniprot|P32339 Saccharomyces cerevisiae
           YLR205C HMX1 ER localized, heme-binding peroxidase
           involved in the degradation of heme
          Length = 307

 Score =  281 bits (718), Expect = 6e-94,   Method: Compositional matrix adjust.
 Identities = 135/257 (52%), Positives = 178/257 (69%), Gaps = 11/257 (4%)

Query: 1   MSVRFAVALRHGKLYRQGILAFYYVFQAIEQEIDALLSIDXXXXXXXXXDVSDQKLLASK 60
           MS +FA A++HG +YRQG+LAF+YVFQAIEQE+D L             D          
Sbjct: 32  MSAKFAFAMKHGFIYRQGVLAFFYVFQAIEQELDRLRQEAQTPEEEQTRD---------- 81

Query: 61  IVKQFWMPEFRRTEQLYKDLLLLYSPEYPTSTELDAMLVDHQLPPQLQGFVDMVHATVRQ 120
           I+ QFW  EFRR  ++ +DL LLY+ E+PTS  L   L +  L P+LQGFVD VHA++R 
Sbjct: 82  ILNQFWTEEFRRAPRILQDLELLYAKEFPTSASLRTFLEETTLAPELQGFVDYVHASIRS 141

Query: 121 NPVTVLAYCHVMYLALFAGGKVMRSTLYRNTGLFPKFEHLSSKELARKGTNFFTFSDAGV 180
            P  +LAYCHV+YLALFAGG+VMRST+YR+TGLFPKF +L+++E+ R+GTNFFTFSDAGV
Sbjct: 142 RPTAILAYCHVLYLALFAGGRVMRSTIYRSTGLFPKFPNLTTEEVVRRGTNFFTFSDAGV 201

Query: 181 DVENQLKWQYKKNYELATREALAENDKLEIIDVAKRIFERNMDIIQEIGQLNKEALTNN- 239
             ENQL+  YK+ YELATR+ L E  KL I+DV+  IFE N  ++ EIG++N++ L    
Sbjct: 202 QAENQLRKNYKRGYELATRQGLTEEQKLNILDVSNAIFEWNTRVVTEIGEINRQELMGKL 261

Query: 240 KLDLLQYVFEELKFYNK 256
              LL +V EE ++ +K
Sbjct: 262 SFRLLTFVIEEWQYSDK 278

>KLLA0D12474g Chr4 complement(1058158..1059096) [939 bp, 312 aa]
           {ON} similar to uniprot|P32339 Saccharomyces cerevisiae
           YLR205C HMX1 ER localized, heme-binding peroxidase
           involved in the degradation of heme
          Length = 312

 Score =  280 bits (717), Expect = 1e-93,   Method: Compositional matrix adjust.
 Identities = 139/257 (54%), Positives = 184/257 (71%), Gaps = 11/257 (4%)

Query: 1   MSVRFAVALRHGKLYRQGILAFYYVFQAIEQEIDALLSIDXXXXXXXXXDVSDQKLLASK 60
           MS++ A A+RHG +YRQGI+A+YYVF AIEQEID LL             V D+K+    
Sbjct: 37  MSMKMAFAMRHGFIYRQGIVAYYYVFHAIEQEIDRLLE--------HPVTVQDEKV--KG 86

Query: 61  IVKQFWMPEFRRTEQLYKDLLLLYSPEYPTSTELDAMLVDHQLPPQLQGFVDMVHATVRQ 120
           I++QFW  EFRR+++L  DL +LY+ EYP S +L   L   QLP +LQ FVD +H+ V++
Sbjct: 87  ILQQFWCEEFRRSDKLVLDLQVLYNDEYPGSEQLQEFLDGFQLPAKLQEFVDEIHSNVQK 146

Query: 121 NPVTVLAYCHVMYLALFAGGKVMRSTLYRNTGLFPKFEHLSSKELARKGTNFFTFSDAGV 180
            P T+LAYCHV+YLALFAGG+VM+S LYR+ GLFPKF HLS KEL R+ TNFFTFS+ GV
Sbjct: 147 EPHTILAYCHVLYLALFAGGRVMKSNLYRHIGLFPKFGHLSPKELVRRATNFFTFSEEGV 206

Query: 181 DVENQLKWQYKKNYELATREALAENDKLEIIDVAKRIFERNMDIIQEIGQLNKEALTNN- 239
           D EN+L+WQYKK YELATR  L E +KL II+V++ IF+RNM+++ EIG++N+  L    
Sbjct: 207 DDENRLRWQYKKGYELATRTELTEAEKLRIIEVSQTIFQRNMEVVAEIGEINRAELMGKF 266

Query: 240 KLDLLQYVFEELKFYNK 256
              L+ ++ EE K+  K
Sbjct: 267 SYKLISFLSEEWKYSEK 283

>YLR205C Chr12 complement(552724..553677) [954 bp, 317 aa] {ON}
           HMX1ER localized heme oxygenase, involved in heme
           degradation during iron starvation and in the oxidative
           stress response; expression is regulated by AFT1 and
           oxidative stress; relocates to the perinuclear region in
           the presence of oxidants
          Length = 317

 Score =  280 bits (716), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 137/263 (52%), Positives = 183/263 (69%), Gaps = 12/263 (4%)

Query: 1   MSVRFAVALRHGKLYRQGILAFYYVFQAIEQEIDALLSIDXXXXXXXXXDVSDQKLLASK 60
           M ++ A+A+RHG +YRQGILA+YYVF AIEQEID LL+            V++++L  S 
Sbjct: 37  MGIKMAIAMRHGFIYRQGILAYYYVFDAIEQEIDRLLN----------DPVTEEELQTST 86

Query: 61  IVKQFWMPEFRRTEQLYKDLLLLYSPEYPTSTELDAMLVDHQLPPQLQGFVDMVHATVRQ 120
           I+KQFW+ +FRR+ Q+YKDL LLYS  + ++  L+  L   Q PP LQ F++ +H  + +
Sbjct: 87  ILKQFWLEDFRRSTQIYKDLKLLYSNTFKSTESLNEFLATFQKPPLLQQFINNIHENIHK 146

Query: 121 NPVTVLAYCHVMYLALFAGGKVMRSTLYRNTGLFPKFEHLSSKELARKGTNFFTFSDAGV 180
            P T+L+YCHV+YLALFAGGK++RS LYR  GLFP FE LS KEL +KGTNFFTFSD G 
Sbjct: 147 EPCTILSYCHVLYLALFAGGKLIRSNLYRRLGLFPNFEKLSQKELVKKGTNFFTFSDLGP 206

Query: 181 DVENQLKWQYKKNYELATREALAENDKLEIIDVAKRIFERNMDIIQEIGQLNKEALTNN- 239
             E +LKW+YKKNYELATR  L E  KL+II VA+ IF+ N +I+ EIG+LN+  L    
Sbjct: 207 TEETRLKWEYKKNYELATRTELTEAQKLQIISVAEGIFDWNFNIVAEIGELNRRELMGKF 266

Query: 240 KLDLLQYVFEELKFYNKDRSHQQ 262
               + Y++EE  F NKD + ++
Sbjct: 267 SFKCITYLYEEWMF-NKDSATRR 288

>Kwal_56.24624 s56 (1078618..1079541) [924 bp, 307 aa] {ON} YLR205C
           (HMX1) - Putative heme oxygenase [contig 161] FULL
          Length = 307

 Score =  275 bits (703), Expect = 1e-91,   Method: Compositional matrix adjust.
 Identities = 134/257 (52%), Positives = 176/257 (68%), Gaps = 11/257 (4%)

Query: 1   MSVRFAVALRHGKLYRQGILAFYYVFQAIEQEIDALLSIDXXXXXXXXXDVSDQKLLASK 60
           MSV+FA A++HG +YRQG+LAF+YVFQAIEQEID LL            D          
Sbjct: 32  MSVKFAFAMKHGFIYRQGLLAFFYVFQAIEQEIDRLLQNAQTAEEVQTRD---------- 81

Query: 61  IVKQFWMPEFRRTEQLYKDLLLLYSPEYPTSTELDAMLVDHQLPPQLQGFVDMVHATVRQ 120
           I+ QFW+  F RT ++Y+DL LLY+ E+P+  +L   L  + LPP+ QGFVD VH +VR 
Sbjct: 82  ILLQFWVSSFSRTPRIYQDLKLLYAKEFPSDEQLSLFLQQNTLPPEQQGFVDFVHESVRA 141

Query: 121 NPVTVLAYCHVMYLALFAGGKVMRSTLYRNTGLFPKFEHLSSKELARKGTNFFTFSDAGV 180
            P ++LA+CHV+YLALFAGG+VMRST+YR+TGLFPKF  L+ +E+ RKGTNFFTFSD GV
Sbjct: 142 RPTSILAFCHVLYLALFAGGRVMRSTIYRSTGLFPKFPDLTPEEVVRKGTNFFTFSDDGV 201

Query: 181 DVENQLKWQYKKNYELATREALAENDKLEIIDVAKRIFERNMDIIQEIGQLNKEALTNN- 239
             ENQL+ +YK+ YELATRE L E+ KL I++VA   FE N  +I EIG++N++ L    
Sbjct: 202 QAENQLRKEYKRGYELATREGLTEDQKLNILEVAAATFEWNTRVISEIGEINRQELMGKL 261

Query: 240 KLDLLQYVFEELKFYNK 256
              L+ +  +E K   K
Sbjct: 262 SFKLVSFAIDEWKHTEK 278

>Ecym_4729 Chr4 complement(1423384..1424364) [981 bp, 326 aa] {ON}
           similar to Ashbya gossypii ACL154W
          Length = 326

 Score =  275 bits (703), Expect = 2e-91,   Method: Compositional matrix adjust.
 Identities = 138/254 (54%), Positives = 175/254 (68%), Gaps = 11/254 (4%)

Query: 4   RFAVALRHGKLYRQGILAFYYVFQAIEQEIDALLSIDXXXXXXXXXDVSDQKLLASKIVK 63
           + A+A+RHG +YRQGILAFYY+F A+EQ+ID LL              + ++L  S I++
Sbjct: 53  KMALAMRHGFIYRQGILAFYYIFHAVEQQIDRLLETPS----------TKEELQISAILR 102

Query: 64  QFWMPEFRRTEQLYKDLLLLYSPEYPTSTELDAMLVDHQLPPQLQGFVDMVHATVRQNPV 123
           QFW  EFRR+ +L +DL   Y  EYPT  EL   L D +LPP+LQ FVD +     +NP 
Sbjct: 103 QFWCEEFRRSGRLLRDLEFFYHHEYPTQNELQQFLNDFELPPKLQRFVDFIRDKTMENPS 162

Query: 124 TVLAYCHVMYLALFAGGKVMRSTLYRNTGLFPKFEHLSSKELARKGTNFFTFSDAGVDVE 183
           T+LAYCHV+Y ALFAGGKVMRS +YRN GLFPK + +S+ E +R GTNFFTFSD GVD E
Sbjct: 163 TILAYCHVLYNALFAGGKVMRSNIYRNIGLFPKPKGISAAESSRNGTNFFTFSDDGVDEE 222

Query: 184 NQLKWQYKKNYELATREALAENDKLEIIDVAKRIFERNMDIIQEIGQLNKEALTN-NKLD 242
           N+L+WQYKKNYELATRE L EN KLEIIDV+   F+  MDI+ EIG+ NK+ L N     
Sbjct: 223 NKLRWQYKKNYELATREGLDENQKLEIIDVSIANFQAVMDILGEIGETNKKELMNIFSFK 282

Query: 243 LLQYVFEELKFYNK 256
           LL ++  E ++  K
Sbjct: 283 LLTFLSNEWRYNQK 296

>Smik_12.263 Chr12 complement(499758..500714) [957 bp, 318 aa] {ON}
           YLR205C (REAL)
          Length = 318

 Score =  272 bits (696), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 136/263 (51%), Positives = 182/263 (69%), Gaps = 12/263 (4%)

Query: 1   MSVRFAVALRHGKLYRQGILAFYYVFQAIEQEIDALLSIDXXXXXXXXXDVSDQKLLASK 60
           M ++ A+A+RHG +YRQGILA+YYVF AIEQEID LL+            V+ ++L  S 
Sbjct: 37  MGIKMAIAMRHGFIYRQGILAYYYVFDAIEQEIDRLLN----------DPVTGKELQTSA 86

Query: 61  IVKQFWMPEFRRTEQLYKDLLLLYSPEYPTSTELDAMLVDHQLPPQLQGFVDMVHATVRQ 120
           I+KQFW+ +FRR+ Q+YKDL LLYS  + ++  L+  L   + PP LQ FV+ +H  +++
Sbjct: 87  ILKQFWLEDFRRSTQIYKDLKLLYSNTFKSTESLNEFLATFEKPPVLQQFVNNIHENIQK 146

Query: 121 NPVTVLAYCHVMYLALFAGGKVMRSTLYRNTGLFPKFEHLSSKELARKGTNFFTFSDAGV 180
            P T+L+YCHV+YLALFAGGK++RS LYR  GLFP FE LS KEL +KGTNFFTFSD G 
Sbjct: 147 EPCTILSYCHVLYLALFAGGKLIRSNLYRRLGLFPNFEKLSQKELVKKGTNFFTFSDLGP 206

Query: 181 DVENQLKWQYKKNYELATREALAENDKLEIIDVAKRIFERNMDIIQEIGQLNKEALTNN- 239
             E +LK +YKKNYELATR  L E  KL+II VA+ IF+ N +I+ EIG+LN+  L    
Sbjct: 207 TEETRLKLEYKKNYELATRTELTEAQKLQIISVAEGIFDWNFNIVAEIGELNRRELMGKF 266

Query: 240 KLDLLQYVFEELKFYNKDRSHQQ 262
               + YV+EE  F NK+ + ++
Sbjct: 267 SFKCVTYVYEEWMF-NKESATRK 288

>Skud_12.268 Chr12 complement(499347..500303) [957 bp, 318 aa] {ON}
           YLR205C (REAL)
          Length = 318

 Score =  271 bits (692), Expect = 9e-90,   Method: Compositional matrix adjust.
 Identities = 135/251 (53%), Positives = 173/251 (68%), Gaps = 11/251 (4%)

Query: 1   MSVRFAVALRHGKLYRQGILAFYYVFQAIEQEIDALLSIDXXXXXXXXXDVSDQKLLASK 60
           M +R A+A+RHG +YRQGILA+YYVF AIEQEID LL             V++++L  S 
Sbjct: 37  MGIRMAIAMRHGFIYRQGILAYYYVFDAIEQEIDRLLH----------DPVTEKELQTST 86

Query: 61  IVKQFWMPEFRRTEQLYKDLLLLYSPEYPTSTELDAMLVDHQLPPQLQGFVDMVHATVRQ 120
           I+KQFW+ +FRR+ Q+YKDL LLYS  + ++  L+  L   + PP LQ FV+ +H  +R+
Sbjct: 87  ILKQFWLEDFRRSTQIYKDLKLLYSNLFKSTESLNEFLAKFEKPPLLQQFVNDIHENIRK 146

Query: 121 NPVTVLAYCHVMYLALFAGGKVMRSTLYRNTGLFPKFEHLSSKELARKGTNFFTFSDAGV 180
            P T+L+YCHV+YLALFAGGK++RS LYR  GLFP FE LS KEL +KGTNFFTFSD G 
Sbjct: 147 EPCTILSYCHVLYLALFAGGKLIRSNLYRRLGLFPNFERLSQKELVKKGTNFFTFSDLGP 206

Query: 181 DVENQLKWQYKKNYELATREALAENDKLEIIDVAKRIFERNMDIIQEIGQLNKEALTNN- 239
             E +LK +YKKNYELATR  L E  KL+II VA  IF+ N  I+ EIG+LN+  L    
Sbjct: 207 TEETRLKLEYKKNYELATRTELTEAQKLQIISVAGGIFDWNFHIVAEIGELNRRELMGKF 266

Query: 240 KLDLLQYVFEE 250
               + YV+EE
Sbjct: 267 SFKCVTYVYEE 277

>NCAS0E02890 Chr5 complement(565154..566101) [948 bp, 315 aa] {ON}
           Anc_7.344 YLR205C
          Length = 315

 Score =  244 bits (622), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 117/256 (45%), Positives = 168/256 (65%), Gaps = 13/256 (5%)

Query: 1   MSVRFAVALRHGKLYRQGILAFYYVFQAIEQEIDALLSIDXXXXXXXXXDVSDQKLLASK 60
           MS++ A+ALRHG +YRQGIL +YY+F+ +E+EI  L +             + +++    
Sbjct: 37  MSIKLAIALRHGFIYRQGILTYYYIFKVVEEEIIKLTT----------SPTTSEEVKIGN 86

Query: 61  IVKQFWMPEFRRTEQLYKDLLLLYSPEYPTSTELDAMLVDH--QLPPQLQGFVDMVHATV 118
           ++ + W+PEF RTE L KDL LLY  EYPT   L   L  +  +LPP L  F+  +H ++
Sbjct: 87  LLSKTWIPEFNRTENLLKDLQLLYHDEYPTKEALQLFLETNATELPPVLDSFIKYIHQSI 146

Query: 119 RQNPVTVLAYCHVMYLALFAGGKVMRSTLYRNTGLFPKFEHLSSKELARKGTNFFTFSDA 178
            +NP ++ AYCHV+YLALFAGGK++RS +Y+N G  P F HLSSKE+  KGTNFF F   
Sbjct: 147 LENPCSIFAYCHVLYLALFAGGKIIRSKIYKNLGFLPNFNHLSSKEVFEKGTNFFKFGSD 206

Query: 179 GVDVENQLKWQYKKNYELATREALAENDKLEIIDVAKRIFERNMDIIQEIGQLNKEALTN 238
           GV  E +LK ++KKNYEL TRE+L E +K  II+ +K+IF+ N+  ++E+G +NKE L +
Sbjct: 207 GVIEETKLKLEFKKNYELNTRESLNEKEKSIIIETSKKIFDYNLMAMEELGSINKEQLMS 266

Query: 239 N-KLDLLQYVFEELKF 253
                ++ Y+ EE KF
Sbjct: 267 KLNFKMVTYLLEEWKF 282

>NDAI0E04500 Chr5 complement(1009814..1010797) [984 bp, 327 aa] {ON}
           Anc_7.344 YLR205C
          Length = 327

 Score =  235 bits (599), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 115/268 (42%), Positives = 173/268 (64%), Gaps = 23/268 (8%)

Query: 1   MSVRFAVALRHGKLYRQGILAFYYVFQAIEQEIDALLSIDXXXXXXXXXDVSDQKLLASK 60
           M+++ AVALRHG +YRQGIL +YY+FQA+E EI+ LLS +         D + ++     
Sbjct: 37  MTLKLAVALRHGDIYRQGILTYYYIFQAVESEINYLLSFNT--------DATKEQKRTGS 88

Query: 61  IVKQFWMPEFRRTEQLYKDLLLLYSPEYPTSTEL------DAMLVDHQLPPQLQGFVDMV 114
           ++ + W+ EF RT++L+KDL LLYS  +    +L      +  L+      +L  FV+ +
Sbjct: 89  LLSKIWLTEFNRTDKLFKDLKLLYSDRFQNDQDLLNFINEEFKLIHQNKNSKLYQFVNFI 148

Query: 115 HATVRQNPVTVLAYCHVMYLALFAGGKVMRSTLYRNTGLFPKFEHLSSKELARKGTNFFT 174
           H +++ NP  +LAYCHV+YLALFAGGK+++S +Y+N G  P F HLSSKEL    TNFF 
Sbjct: 149 HISIQTNPCCILAYCHVLYLALFAGGKIIKSKIYKNLGFLPNFNHLSSKELFNNATNFFQ 208

Query: 175 FSD--------AGVDVENQLKWQYKKNYELATREALAENDKLEIIDVAKRIFERNMDIIQ 226
           F++          +  EN+LK ++K+N+EL TR  L EN+KL II++AK+IF+ N++ ++
Sbjct: 209 FTENSDSLEGINSISNENKLKLKFKRNFELNTRSNLNENEKLTIIEIAKQIFQWNLESME 268

Query: 227 EIGQLNKEALTN-NKLDLLQYVFEELKF 253
           E+GQ N++ L N     L+ Y+FEE KF
Sbjct: 269 ELGQRNQKELMNLFSFKLINYLFEEWKF 296

>TPHA0F02920 Chr6 (645567..646529) [963 bp, 320 aa] {ON} Anc_7.344
           YLR205C
          Length = 320

 Score =  216 bits (549), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 110/263 (41%), Positives = 171/263 (65%), Gaps = 14/263 (5%)

Query: 1   MSVRFAVALRHGKLYRQGILAFYYVFQAIEQEIDALLSIDXXXXXXXXXDVSDQKLLASK 60
           MS+R A+ALRHG +YRQG++AFY++F  IE EID LL+           ++   ++   K
Sbjct: 35  MSIRLALALRHGFIYRQGLVAFYHIFGTIENEIDNLLN-------TLDSELDSVQIQTKK 87

Query: 61  IVKQFWMPEFRRTEQLYKDLLLLYSPEYPTSTE-----LDAMLVDHQLPPQLQGFVDMVH 115
           I+K F++ EFRR + L +DL +LY PE+  + +     L++   + +  P+L  F D + 
Sbjct: 88  ILKSFYVNEFRRKDNLLQDLTVLYYPEFKGNRQDVLDFLNSETFNKENYPELNFFTDYIK 147

Query: 116 ATVRQNPVTVLAYCHVMYLALFAGGKVMRSTLYRNTGLFPKFEHLSSKELARKGTNFFTF 175
            T ++ P T++AYCHV+YLALFAGGK+M+S + +N GLFPKF+H+S +E+  +G+NFF F
Sbjct: 148 DTTKEKPYTIIAYCHVLYLALFAGGKIMKSNVLKNVGLFPKFDHMSHEEVTNQGSNFFRF 207

Query: 176 S-DAGVDVENQLKWQYKKNYELATREALAENDKLEIIDVAKRIFERNMDIIQEIGQLNKE 234
           + +   D +++L+++YKKNYEL+TR+ L E  K +II+V+K IF    ++I EIG  N+ 
Sbjct: 208 TQEDTADFDSKLRFEYKKNYELSTRDELNEMQKNDIIEVSKNIFVMLENVIAEIGAKNRT 267

Query: 235 ALTNN-KLDLLQYVFEELKFYNK 256
            L     L  + Y+ EE K+  K
Sbjct: 268 KLMGGFTLKTITYLVEEWKYNEK 290

>ACL154W Chr3 (83962..84921) [960 bp, 319 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YLR205C (HMX1)
          Length = 319

 Score =  200 bits (509), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 108/258 (41%), Positives = 159/258 (61%), Gaps = 12/258 (4%)

Query: 1   MSVRFAVALRHGKLYRQGILAFYYVFQAIEQEIDALLSIDXXXXXXXXXDVSDQKLLASK 60
           +S +FAVALRH  +YRQG+LA YY+F+++EQ ID LL              +D+  +  +
Sbjct: 46  VSAKFAVALRHPSIYRQGLLAMYYIFRSVEQHIDRLLRAPA---------TADEARI-GE 95

Query: 61  IVKQFWMPEFRRTEQLYKDLLLLYSPEYPTSTELDAMLVDHQLPPQLQGFVDMVHATVRQ 120
           I++ FW PEF R   L +D  + Y+ EY TS +L   L  ++LPP+L   V  + A   +
Sbjct: 96  ILRAFWRPEFARAPALVQDFEVYYAAEYSTSAQLHQFLDSYELPPRLAAAVADIEAAALR 155

Query: 121 NPVTVLAYCHVMYLALFAGGKVMRSTLYRNTGLFPKFEHLSSKELARKGTNFFTFSDAGV 180
            P T+LA+CHV+YLALFAGG+VMRS L R  GL P+   LS++E   +GT+FFTF  AG 
Sbjct: 156 QPWTILAHCHVLYLALFAGGRVMRSALSRQLGLLPRAAGLSARETQLRGTHFFTFG-AGA 214

Query: 181 DVENQLKWQYKKNYELATREALAENDKLEIIDVAKRIFERNMDIIQEIGQLNK-EALTNN 239
             EN+ +  YK+ YELATR AL+E +K ++ID A+  F+    ++ E+   N+ E L + 
Sbjct: 215 GEENKARVAYKRAYELATRTALSEAEKADVIDAARADFDHIQAVMAELAVRNRQELLGSP 274

Query: 240 KLDLLQYVFEELKFYNKD 257
              LL ++ EE ++  K+
Sbjct: 275 SYRLLTFLGEEWRYRTKN 292

>Kpol_530.36 s530 complement(84853..85788) [936 bp, 311 aa] {ON}
           complement(84853..85788) [936 nt, 312 aa]
          Length = 311

 Score =  199 bits (507), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 112/265 (42%), Positives = 160/265 (60%), Gaps = 30/265 (11%)

Query: 1   MSVRFAVALRHGKLYRQGILAFYYVFQAIEQEIDALLSIDXXXXXXXXXDVSDQKLLASK 60
           M +R A+AL+HG +YR+G++ FY++F  IE EID +L+           D S  KL    
Sbjct: 33  MGIRLALALKHGFIYREGLVVFYHIFNTIETEIDLVLN---------NQDDSQMKL---- 79

Query: 61  IVKQFWMPEFRRTEQLYKDLLLLYSPEY----PTSTEL---DAMLVDHQLPPQLQGFVDM 113
           I+  F++ EFRR +++ KDL LLY PE+    P   E    D    D +   QLQ FV  
Sbjct: 80  ILSSFYLDEFRRKDKILKDLELLYYPEFQNDRPQLLEFINSDRFTNDSE---QLQNFVKY 136

Query: 114 VHATVRQNPVTVLAYCHVMYLALFAGGKVMRSTLYRNTGLFPKFEHLSSKELARKGTNFF 173
           +     ++P T+LAYCHV+YLALFAGGK+M+S + ++ G+FPKFEHLS KE+  +GTNF+
Sbjct: 137 IQTNATEDPCTLLAYCHVLYLALFAGGKIMKSNVTKHLGIFPKFEHLSHKEIIARGTNFY 196

Query: 174 TFSDA----GVDVENQLKWQYKKNYELATREALAENDKLEIIDVAKRIFERNMDIIQEIG 229
            F+D+      DV  +L+W YKKNYEL+TR+ L E  KL +I  +K +F    + I E+G
Sbjct: 197 QFTDSTNPETTDV--KLRWLYKKNYELSTRDELLEQQKLTVIKTSKDVFVMLENCIAEVG 254

Query: 230 QLNKEALTNN-KLDLLQYVFEELKF 253
             N+  L N     L  ++ EE K+
Sbjct: 255 TRNRNELMNIFSYKLFTFIVEEWKY 279

>KAFR0L01470 Chr12 (272767..273669) [903 bp, 300 aa] {ON} Anc_7.344
           YLR205C
          Length = 300

 Score =  179 bits (454), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 98/256 (38%), Positives = 157/256 (61%), Gaps = 24/256 (9%)

Query: 1   MSVRFAVALRHGKLYRQGILAFYYVFQAIEQEIDALLSIDXXXXXXXXXDVSDQKLLASK 60
           MS++   ALRH  +Y+  +L++YYVF+ +E EID ++S D                   +
Sbjct: 33  MSIKATFALRHSFIYKDILLSYYYVFRTLEDEIDFIISNDRSH--------------IGE 78

Query: 61  IVKQFWMPEFRRTEQLYKDLLLLYSPEYPTSTELDAMLVDHQLPPQLQGFVDMVHATVRQ 120
           I++ F+  +FRR +Q+ KDL  L   +  +    D  L      P+L  F++ + + + +
Sbjct: 79  ILRGFFNDKFRRKDQILKDLKFLNVIQDQSD---DQWLSSR---PELCKFLNFIKSNLHE 132

Query: 121 NPVTVLAYCHVMYLALFAGGKVMRSTLYRNTGLF--PKFEHLSSKELARKGTNFFTFSDA 178
           +PV VLAYCHV+YLALFAGG++MR+++ +N   F  PKF+ +S  ++    TNFF F D 
Sbjct: 133 HPVDVLAYCHVLYLALFAGGRIMRASMNKNLSFFFMPKFDKMSHTDVIMNATNFFKF-DK 191

Query: 179 GVDVENQLKWQYKKNYELATREALAENDKLEIIDVAKRIFERNMDIIQEIGQLNKEALTN 238
            +  EN+LK +YK+NY++ T+  L E++KLEIID+++ IF+ N +++QEIG +NK+ L  
Sbjct: 192 DIVSENKLKSEYKRNYDILTKAKLNEDEKLEIIDISREIFKFNFNLLQEIGTVNKDELMK 251

Query: 239 N-KLDLLQYVFEELKF 253
           N    ++ YV EE KF
Sbjct: 252 NFNYKMVTYVVEEWKF 267

>KNAG0B02640 Chr2 complement(510618..511526) [909 bp, 302 aa] {ON}
           Anc_7.344 YLR205C
          Length = 302

 Score =  176 bits (446), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 98/265 (36%), Positives = 151/265 (56%), Gaps = 30/265 (11%)

Query: 1   MSVRFAVALRHGKLYRQGILAFYYVFQAIEQEIDALLSIDXXXXXXXXXDVSDQKLLASK 60
            SV+F +ALRH  +Y   +  FY VF  +EQ ID L++             S+       
Sbjct: 33  FSVKFMMALRHSFIYTDILKTFYTVFGTVEQRIDELIA-------------SEGGDGVGA 79

Query: 61  IVKQFWMPEFRRTEQLYKDLLLLYSPEYPTSTELDAMLVDHQLPPQLQGFVDMVHATVRQ 120
           I+ +F++PEFRR +++ +DL+ L   +   S +          PPQL GF+  + + + +
Sbjct: 80  ILGEFYVPEFRRADKIKRDLVFLGEWDTVESGQWTP-------PPQLAGFLQYLRSEMDR 132

Query: 121 NPVTVLAYCHVMYLALFAGGKVMRSTLYRNTGLFPKF-------EHLSSKELARKGTNFF 173
           +P+TVLA CHV+YLALFAGG+V +S+L++N G  P F       E +S   L    TNFF
Sbjct: 133 DPITVLAPCHVLYLALFAGGRVFKSSLFKNLGFLPNFRDKNGPGEEMSDHTLVSNATNFF 192

Query: 174 TFSDAGVDVENQLKWQYKKNYELATREALAENDKLEIIDVAKRIFERNMDIIQEIGQLNK 233
            F++  ++ EN+L+W YK+NYELATR+ L E+ KL +I  ++ +F     +I+EI Q N 
Sbjct: 193 QFAET-IEDENKLRWTYKRNYELATRDTLTEDQKLAVIAASRDVFRHTFAVIEEICQQNH 251

Query: 234 EALTN-NKLDLLQYVFEELKFYNKD 257
           + L +     ++ Y  EE KF NK+
Sbjct: 252 DELMSFRSFKIVTYFLEEWKF-NKN 275

>TDEL0A00450 Chr1 complement(80330..81598) [1269 bp, 422 aa] {ON}
           Anc_3.26 YOL136C
          Length = 422

 Score = 33.1 bits (74), Expect = 0.83,   Method: Compositional matrix adjust.
 Identities = 35/140 (25%), Positives = 58/140 (41%), Gaps = 39/140 (27%)

Query: 118 VRQNPVTVLAYCHVMYLALFAGGKVMRSTLYRNTGLFPKFEHLSSKELARKGTNFFTFSD 177
           ++ NP T     H +  ++F  GKV R   ++N G         S ELA   ++      
Sbjct: 132 LQSNPAT-----HSLRCSVFNAGKVRRKMSFKNLGKL-------SMELANNSSD------ 173

Query: 178 AGVDVENQLKWQYKKNYELATREALAENDKLEIIDVAKRIFERNMDIIQEIGQLNKEALT 237
              D+ N    + K+ Y   T + L +    ++ DV   IF+                 T
Sbjct: 174 ---DLFNPKNTEKKEKYARITLDKLLQELDSDVCDVG--IFD----------------AT 212

Query: 238 NNKLDLLQYVFEELKFYNKD 257
           N+++   Q+VFEEL  YN++
Sbjct: 213 NSRVQRRQFVFEELCAYNEN 232

>ZYRO0G06270g Chr7 (494886..494939,495003..495665) [717 bp, 238 aa]
           {ON} similar to uniprot|P53915 Saccharomyces cerevisiae
           YNL129W
          Length = 238

 Score = 31.2 bits (69), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 31/55 (56%), Gaps = 4/55 (7%)

Query: 190 YKKNYELATRE--ALAENDKLEIIDVAKRIFERNMDIIQEIGQLNKEALTNNKLD 242
           YK + E+   E   ++  D  E +D+A   FE  +D I+E GQ++ + + NN +D
Sbjct: 40  YKHDDEIPFNEKRGISNWDSPEALDLAH--FEAELDSIKETGQISSQLVHNNNVD 92

>TDEL0B05020 Chr2 (879469..879528,879589..880287) [759 bp, 252 aa]
           {ON} Anc_2.140 YNL129W
          Length = 252

 Score = 30.0 bits (66), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 10/29 (34%), Positives = 23/29 (79%)

Query: 217 IFERNMDIIQEIGQLNKEALTNNKLDLLQ 245
           +F++ +DII++ GQ+++E + NN +D ++
Sbjct: 69  LFDKELDIIKKTGQISQELIHNNNVDGIE 97

>TPHA0F00500 Chr6 complement(119121..120554) [1434 bp, 477 aa] {ON}
           Anc_4.74 YGL038C
          Length = 477

 Score = 30.0 bits (66), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 26/50 (52%), Gaps = 3/50 (6%)

Query: 96  AMLVDHQLPPQLQGF---VDMVHATVRQNPVTVLAYCHVMYLALFAGGKV 142
           +++ D QL P L+     V +V   +R  PVT+L      YL L+A G +
Sbjct: 146 SLITDQQLIPLLEDIYSNVPLVLEAIRAMPVTILKIDFFRYLILYAKGGI 195

>ZYRO0G09592g Chr7 complement(761703..764222) [2520 bp, 839 aa] {ON}
           similar to uniprot|P48237 Saccharomyces cerevisiae
           YGR150C Hypothetical ORF
          Length = 839

 Score = 30.0 bits (66), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 27/104 (25%), Positives = 44/104 (42%), Gaps = 7/104 (6%)

Query: 72  RTEQLYKDLLLLYSPEYPTSTELDAMLVDHQLPPQLQGFVDMVHATVRQNPVTVLAYCHV 131
           R E+LYK L L+ S   P S E D  +   ++   ++ F  M H  V +N +    Y  +
Sbjct: 664 RIEKLYKGLKLVESRVEPNSHERDLAINQIEMDENVKWFASMKHKIVAKNYI----YELM 719

Query: 132 MYLALFAGGKVMRSTLYRNTGLFPK---FEHLSSKELARKGTNF 172
           M  A       +    +++ G + K   F+ + SK      T F
Sbjct: 720 MKAASAFKDSAISKDAWQSRGEYRKTKLFQQMDSKRRIESDTQF 763

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.323    0.137    0.394 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 26,303,508
Number of extensions: 1091225
Number of successful extensions: 3442
Number of sequences better than 10.0: 38
Number of HSP's gapped: 3535
Number of HSP's successfully gapped: 38
Length of query: 282
Length of database: 53,481,399
Length adjustment: 108
Effective length of query: 174
Effective length of database: 41,097,471
Effective search space: 7150959954
Effective search space used: 7150959954
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.5 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 65 (29.6 bits)