Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
CAGL0A03883g7.345ON1381072562e-28
NOTE: 16 genes in the same pillar as CAGL0A03883g were not hit in these BLAST results
LIST: Kpol_2001.72 Zrou_YGOB_Anc_7.345 KAFR0L01475 Skud_12.267 Smik_12.262 YLR204W Suva_10.298 KLTH0H01364g Kwal_56.24628 ACL153C Ecym_4728 TPHA0D04575 KLLA0D12452g KNAG0B02635 NDAI0E04490 SAKL0F11264g

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0A03883g
         (138 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0A03883g Chr1 (394613..395029) [417 bp, 138 aa] {ON} similar...   103   2e-28

>CAGL0A03883g Chr1 (394613..395029) [417 bp, 138 aa] {ON} similar to
           uniprot|P32344 Saccharomyces cerevisiae YLR204w QRI5
          Length = 138

 Score =  103 bits (256), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 59/107 (55%), Positives = 59/107 (55%)

Query: 1   MQKLKLKLMLNCSSIATTTSARMSLLRMVRPFMXXXXXXXXXXXXXXXXXXXXMPMPFGK 60
           MQKLKLKLMLNCSSIATTTSARMSLLRMVRPFM                    MPMPFGK
Sbjct: 1   MQKLKLKLMLNCSSIATTTSARMSLLRMVRPFMAVVPGVRRVSSVPVAGVRVSMPMPFGK 60

Query: 61  MPLPLRASIXXXXXXXXXXXXXXXXXXXXXXXXXXXXLDKEVYVDSV 107
           MPLPLRASI                            LDKEVYVDSV
Sbjct: 61  MPLPLRASIQTTVQATVQATVQTMQPTVQPLPVTPQALDKEVYVDSV 107

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.326    0.134    0.377 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 4,720,990
Number of extensions: 55108
Number of successful extensions: 116
Number of sequences better than 10.0: 1
Number of HSP's gapped: 114
Number of HSP's successfully gapped: 1
Length of query: 138
Length of database: 53,481,399
Length adjustment: 98
Effective length of query: 40
Effective length of database: 42,244,131
Effective search space: 1689765240
Effective search space used: 1689765240
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 59 (27.3 bits)