Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
CAGL0A03872g7.342ON5102547533e-93
Skud_12.2707.342ON6261336211e-72
Smik_12.2647.342ON6121336095e-71
NCAS0H006707.342ON4831335981e-70
YLR206W (ENT2)7.342ON6131336062e-70
Suva_10.3007.342ON6181336052e-70
KNAG0C038007.342ON4471295767e-68
TPHA0D045607.342ON4871345744e-67
ZYRO0F11550g7.342ON5381335767e-67
Kpol_2001.707.342ON5331335751e-66
Suva_4.837.342ON4621335682e-66
TDEL0C020507.342ON5011335693e-66
TBLA0E004807.342ON5991365754e-66
Skud_4.947.342ON4471335621e-65
KAFR0L014607.342ON5501335672e-65
Smik_4.757.342ON4601335551e-64
YDL161W (ENT1)7.342ON4541335532e-64
SAKL0F10934g7.342ON4981335492e-63
NDAI0D006107.342ON4861335458e-63
KAFR0B008907.342ON4141295241e-60
KLLA0C16731g7.342ON4781335272e-60
Kwal_56.246107.342ON5081335143e-58
KLTH0H01430g7.342ON5021335134e-58
KNAG0B026507.342ON6461334831e-52
Ecym_47317.342ON5141334752e-52
ACL157C7.342ON5151324532e-49
TBLA0E020407.342ON7011334182e-43
KLTH0D16896g4.346ON4011282112e-17
Kwal_47.168574.346ON3821282076e-17
TBLA0E047604.346ON4261282087e-17
KNAG0M003804.346ON4031282051e-16
SAKL0G17952g4.346ON4151282051e-16
NDAI0D032004.346ON4351282051e-16
KLLA0B04587g4.346ON4001282006e-16
TDEL0D007104.346ON3751281997e-16
Kpol_1001.24.346ON4181281981e-15
KAFR0B067404.346ON3991281971e-15
Suva_12.2164.346ON4101281943e-15
ZYRO0B14784g4.346ON4241281943e-15
NCAS0A062104.346ON4231281927e-15
Skud_10.3494.346ON4101281891e-14
YJR125C (ENT3)4.346ON4081281891e-14
Smik_10.4184.346ON4091281882e-14
CAGL0H04323g4.346ON4121191855e-14
AER155C4.346ON3641281827e-14
TPHA0B004004.346ON3991281829e-14
Ecym_11334.346ON3921281757e-13
SAKL0H25762g4.17ON2621121584e-11
Kwal_55.206114.17ON2541101503e-10
TDEL0G017404.17ON2571411415e-09
Kpol_388.54.17ON2681211407e-09
TPHA0F002304.17ON2801251321e-07
TBLA0G006504.17ON4231281312e-07
TBLA0B062204.346ON3391111302e-07
KLTH0E05874g4.17ON2551101255e-07
Ecym_84074.17ON2541041231e-06
ZYRO0G07876g4.17ON2591001221e-06
KLLA0D03949g4.17ON2251161193e-06
Suva_10.354.17ON2471241193e-06
CAGL0E03806g4.17ON2601211167e-06
Skud_12.304.17ON2471241168e-06
YLL038C (ENT4)4.17ON2471031141e-05
Smik_12.194.17ON2471031132e-05
ACL061C4.17ON2341141104e-05
NDAI0H002804.17ON3101451071e-04
NCAS0C058404.17ON2671111034e-04
YHR161C (YAP1801)5.84ON637981020.001
SAKL0H02530g5.84ON669961010.001
KAFR0I014604.17ON275136970.002
TBLA0H012108.335ON49199950.006
ZYRO0F13684g8.335ON40798940.007
Skud_8.2255.84ON62188940.007
Smik_8.2455.84ON62798920.014
NCAS0B036608.335ON416113860.054
KAFR0B058008.335ON38298860.060
Kpol_344.88.335ON384114850.081
CAGL0E01199g8.335ON41298830.13
NDAI0J009308.335ON418113830.16
KLLA0D16654g8.335ON399112820.17
KNAG0J028704.17ON329116800.31
TBLA0B057705.84ON680114770.82
KNAG0A051008.335ON42198760.92
Kwal_YGOB_27.112618.335ON404113761.1
KLTH0G11902g8.335ON399131751.1
TPHA0C007408.335ON38597751.1
TBLA0A040408.335ON415121751.4
Kwal_27.11263singletonOFF27597722.3
NCAS0E038205.84ON428100722.8
NDAI0A028305.84ON47377696.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0A03872g
         (510 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0A03872g Chr1 complement(392922..394454) [1533 bp, 510 aa] {...   294   3e-93
Skud_12.270 Chr12 (501192..503072) [1881 bp, 626 aa] {ON} YLR206...   243   1e-72
Smik_12.264 Chr12 (501598..503436) [1839 bp, 612 aa] {ON} YLR206...   239   5e-71
NCAS0H00670 Chr8 (117595..119046) [1452 bp, 483 aa] {ON} Anc_7.342    234   1e-70
YLR206W Chr12 (554578..556419) [1842 bp, 613 aa] {ON}  ENT2Epsin...   238   2e-70
Suva_10.300 Chr10 (527412..529268) [1857 bp, 618 aa] {ON} YLR206...   237   2e-70
KNAG0C03800 Chr3 (746891..748234) [1344 bp, 447 aa] {ON} Anc_7.3...   226   7e-68
TPHA0D04560 Chr4 complement(994552..996015) [1464 bp, 487 aa] {O...   225   4e-67
ZYRO0F11550g Chr6 complement(947131..948747) [1617 bp, 538 aa] {...   226   7e-67
Kpol_2001.70 s2001 complement(192214..193815) [1602 bp, 533 aa] ...   226   1e-66
Suva_4.83 Chr4 (155278..156666) [1389 bp, 462 aa] {ON} YDL161W (...   223   2e-66
TDEL0C02050 Chr3 (355071..356576) [1506 bp, 501 aa] {ON} Anc_7.3...   223   3e-66
TBLA0E00480 Chr5 complement(88019..89818) [1800 bp, 599 aa] {ON}...   226   4e-66
Skud_4.94 Chr4 (163372..164715) [1344 bp, 447 aa] {ON} YDL161W (...   221   1e-65
KAFR0L01460 Chr12 complement(270433..272085) [1653 bp, 550 aa] {...   223   2e-65
Smik_4.75 Chr4 (144483..145865) [1383 bp, 460 aa] {ON} YDL161W (...   218   1e-64
YDL161W Chr4 (167714..169078) [1365 bp, 454 aa] {ON}  ENT1Epsin-...   217   2e-64
SAKL0F10934g Chr6 (856966..858462) [1497 bp, 498 aa] {ON} some s...   216   2e-63
NDAI0D00610 Chr4 (133678..135138) [1461 bp, 486 aa] {ON} Anc_7.3...   214   8e-63
KAFR0B00890 Chr2 (166365..167609) [1245 bp, 414 aa] {ON} Anc_7.3...   206   1e-60
KLLA0C16731g Chr3 complement(1463616..1465052) [1437 bp, 478 aa]...   207   2e-60
Kwal_56.24610 s56 complement(1073855..1075381) [1527 bp, 508 aa]...   202   3e-58
KLTH0H01430g Chr8 (132738..134246) [1509 bp, 502 aa] {ON} some s...   202   4e-58
KNAG0B02650 Chr2 (511995..513935) [1941 bp, 646 aa] {ON} Anc_7.3...   190   1e-52
Ecym_4731 Chr4 (1427875..1429419) [1545 bp, 514 aa] {ON} similar...   187   2e-52
ACL157C Chr3 complement(79325..80872) [1548 bp, 515 aa] {ON} Syn...   179   2e-49
TBLA0E02040 Chr5 complement(494899..497004) [2106 bp, 701 aa] {O...   165   2e-43
KLTH0D16896g Chr4 complement(1395711..1396916) [1206 bp, 401 aa]...    86   2e-17
Kwal_47.16857 s47 (145176..146324) [1149 bp, 382 aa] {ON} YJR125...    84   6e-17
TBLA0E04760 Chr5 complement(1226806..1228086) [1281 bp, 426 aa] ...    85   7e-17
KNAG0M00380 Chr13 (56675..57886) [1212 bp, 403 aa] {ON} Anc_4.34...    84   1e-16
SAKL0G17952g Chr7 complement(1555520..1556767) [1248 bp, 415 aa]...    84   1e-16
NDAI0D03200 Chr4 complement(764129..765436) [1308 bp, 435 aa] {O...    84   1e-16
KLLA0B04587g Chr2 (411097..412299) [1203 bp, 400 aa] {ON} simila...    82   6e-16
TDEL0D00710 Chr4 (127174..128301) [1128 bp, 375 aa] {ON} Anc_4.3...    81   7e-16
Kpol_1001.2 s1001 (8057..9313) [1257 bp, 418 aa] {ON} (8057..931...    81   1e-15
KAFR0B06740 Chr2 (1406075..1407274) [1200 bp, 399 aa] {ON} Anc_4...    80   1e-15
Suva_12.216 Chr12 complement(334254..335486) [1233 bp, 410 aa] {...    79   3e-15
ZYRO0B14784g Chr2 complement(1205944..1207218) [1275 bp, 424 aa]...    79   3e-15
NCAS0A06210 Chr1 complement(1229758..1231029) [1272 bp, 423 aa] ...    79   7e-15
Skud_10.349 Chr10 complement(613398..614630) [1233 bp, 410 aa] {...    77   1e-14
YJR125C Chr10 complement(654737..655963) [1227 bp, 408 aa] {ON} ...    77   1e-14
Smik_10.418 Chr10 complement(643833..645062) [1230 bp, 409 aa] {...    77   2e-14
CAGL0H04323g Chr8 (407884..409122) [1239 bp, 412 aa] {ON} simila...    76   5e-14
AER155C Chr5 complement(929042..930136) [1095 bp, 364 aa] {ON} S...    75   7e-14
TPHA0B00400 Chr2 (83356..84555) [1200 bp, 399 aa] {ON} Anc_4.346...    75   9e-14
Ecym_1133 Chr1 (274069..275247) [1179 bp, 392 aa] {ON} similar t...    72   7e-13
SAKL0H25762g Chr8 (2256842..2257630) [789 bp, 262 aa] {ON} some ...    65   4e-11
Kwal_55.20611 s55 complement(489968..490732) [765 bp, 254 aa] {O...    62   3e-10
TDEL0G01740 Chr7 (342371..343144) [774 bp, 257 aa] {ON} Anc_4.17...    59   5e-09
Kpol_388.5 s388 complement(17825..18631) [807 bp, 268 aa] {ON} c...    59   7e-09
TPHA0F00230 Chr6 complement(43589..44431) [843 bp, 280 aa] {ON} ...    55   1e-07
TBLA0G00650 Chr7 (140678..141949) [1272 bp, 423 aa] {ON} Anc_4.1...    55   2e-07
TBLA0B06220 Chr2 (1466908..1467927) [1020 bp, 339 aa] {ON} Anc_4...    55   2e-07
KLTH0E05874g Chr5 complement(530814..531581) [768 bp, 255 aa] {O...    53   5e-07
Ecym_8407 Chr8 (843359..844123) [765 bp, 254 aa] {ON} similar to...    52   1e-06
ZYRO0G07876g Chr7 complement(636468..637247) [780 bp, 259 aa] {O...    52   1e-06
KLLA0D03949g Chr4 (333566..334243) [678 bp, 225 aa] {ON} similar...    50   3e-06
Suva_10.35 Chr10 complement(70188..70931) [744 bp, 247 aa] {ON} ...    50   3e-06
CAGL0E03806g Chr5 (356594..357376) [783 bp, 260 aa] {ON} similar...    49   7e-06
Skud_12.30 Chr12 complement(56967..57710) [744 bp, 247 aa] {ON} ...    49   8e-06
YLL038C Chr12 complement(65775..66518) [744 bp, 247 aa] {ON}  EN...    49   1e-05
Smik_12.19 Chr12 complement(50134..50877) [744 bp, 247 aa] {ON} ...    48   2e-05
ACL061C Chr3 complement(256803..257507) [705 bp, 234 aa] {ON} Sy...    47   4e-05
NDAI0H00280 Chr8 complement(48177..49109) [933 bp, 310 aa] {ON} ...    46   1e-04
NCAS0C05840 Chr3 (1202292..1203095) [804 bp, 267 aa] {ON} Anc_4....    44   4e-04
YHR161C Chr8 complement(420373..422286) [1914 bp, 637 aa] {ON}  ...    44   0.001
SAKL0H02530g Chr8 (250148..252157) [2010 bp, 669 aa] {ON} weakly...    44   0.001
KAFR0I01460 Chr9 (304865..305692) [828 bp, 275 aa] {ON} Anc_4.17...    42   0.002
TBLA0H01210 Chr8 (269471..270946) [1476 bp, 491 aa] {ON} Anc_8.3...    41   0.006
ZYRO0F13684g Chr6 complement(1125731..1126954) [1224 bp, 407 aa]...    41   0.007
Skud_8.225 Chr8 complement(391820..393685) [1866 bp, 621 aa] {ON...    41   0.007
Smik_8.245 Chr8 complement(397342..399225) [1884 bp, 627 aa] {ON...    40   0.014
NCAS0B03660 Chr2 complement(653627..654877) [1251 bp, 416 aa] {O...    38   0.054
KAFR0B05800 Chr2 complement(1200666..1201814) [1149 bp, 382 aa] ...    38   0.060
Kpol_344.8 s344 complement(20765..21919) [1155 bp, 384 aa] {ON} ...    37   0.081
CAGL0E01199g Chr5 (108041..109279) [1239 bp, 412 aa] {ON} simila...    37   0.13 
NDAI0J00930 Chr10 (209579..210835) [1257 bp, 418 aa] {ON} Anc_8....    37   0.16 
KLLA0D16654g Chr4 complement(1413507..1414706) [1200 bp, 399 aa]...    36   0.17 
KNAG0J02870 Chr10 (549107..550096) [990 bp, 329 aa] {ON} Anc_4.1...    35   0.31 
TBLA0B05770 Chr2 complement(1364772..1366814) [2043 bp, 680 aa] ...    34   0.82 
KNAG0A05100 Chr1 (744989..746254) [1266 bp, 421 aa] {ON} Anc_8.3...    34   0.92 
Kwal_YGOB_27.11261 s27 complement(716644..717033,717035..717859)...    34   1.1  
KLTH0G11902g Chr7 (1002588..1003787) [1200 bp, 399 aa] {ON} simi...    33   1.1  
TPHA0C00740 Chr3 (144476..145633) [1158 bp, 385 aa] {ON} Anc_8.3...    33   1.1  
TBLA0A04040 Chr1 complement(1004703..1005950) [1248 bp, 415 aa] ...    33   1.4  
Kwal_27.11263 s27 complement(717032..717859) [828 bp, 275 aa] {O...    32   2.3  
NCAS0E03820 Chr5 (750631..751917) [1287 bp, 428 aa] {ON} Anc_5.8...    32   2.8  
NDAI0A02830 Chr1 (636619..638040) [1422 bp, 473 aa] {ON} Anc_5.8...    31   6.7  

>CAGL0A03872g Chr1 complement(392922..394454) [1533 bp, 510 aa] {ON}
           highly similar to uniprot|Q05785 Saccharomyces
           cerevisiae YLR206w ENT2
          Length = 510

 Score =  294 bits (753), Expect = 3e-93,   Method: Compositional matrix adjust.
 Identities = 156/254 (61%), Positives = 156/254 (61%)

Query: 1   MPSQLVRSAKNMVKGYSSTQVMVRDATANDSTSPSVGVLEDLADKTYDTVEFFEIMDMLD 60
           MPSQLVRSAKNMVKGYSSTQVMVRDATANDSTSPSVGVLEDLADKTYDTVEFFEIMDMLD
Sbjct: 1   MPSQLVRSAKNMVKGYSSTQVMVRDATANDSTSPSVGVLEDLADKTYDTVEFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCKENLYIIKTLREFRHEDEVSGSDEG 120
           KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCKENLYIIKTLREFRHEDEVSGSDEG
Sbjct: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCKENLYIIKTLREFRHEDEVSGSDEG 120

Query: 121 QIIRVKAKELTSLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYDDDLQK 180
           QIIRVKAKELTSL                                        YDDDLQK
Sbjct: 121 QIIRVKAKELTSLLTDDERLREERALNRANRRNGDAKRRRRRSRSRSTSYRNAYDDDLQK 180

Query: 181 XXXXXXXXXXXXXXXXXXXXXXXXXDPDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 240
                                    DPD                                
Sbjct: 181 ALEESRMTAEEEEARRREQAQYENQDPDLLAALQLSKEEEELKKLQDMQRMQELQAQQQQ 240

Query: 241 XNVYYDIFGNPISP 254
            NVYYDIFGNPISP
Sbjct: 241 QNVYYDIFGNPISP 254

 Score =  196 bits (499), Expect = 5e-56,   Method: Compositional matrix adjust.
 Identities = 103/151 (68%), Positives = 103/151 (68%)

Query: 360 KTRTGNQSISDKYSELNNLLASGTGIDTFGNTGEARIPAQHTKTGTFINSQGTGYKQVTN 419
           KTRTGNQSISDKYSELNNLLASGTGIDTFGNTGEARIPAQHTKTGTFINSQGTGYKQVTN
Sbjct: 360 KTRTGNQSISDKYSELNNLLASGTGIDTFGNTGEARIPAQHTKTGTFINSQGTGYKQVTN 419

Query: 420 EPKNNPFLSSQYTGLPSTNIVPSHTGYGFGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 479
           EPKNNPFLSSQYTGLPSTNIVPSHTGYGFG                              
Sbjct: 420 EPKNNPFLSSQYTGLPSTNIVPSHTGYGFGNQQQQQQQQQQQQQQQQQQPQQNYNYNQQQ 479

Query: 480 XXXXXXXXXXXXXXXXXXFATPDQGVSLIDL 510
                             FATPDQGVSLIDL
Sbjct: 480 NYQYQQQPQQYQQQQQQQFATPDQGVSLIDL 510

>Skud_12.270 Chr12 (501192..503072) [1881 bp, 626 aa] {ON} YLR206W
           (REAL)
          Length = 626

 Score =  243 bits (621), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 112/133 (84%), Positives = 123/133 (92%), Gaps = 1/133 (0%)

Query: 1   MPSQLVRSAKNMVKGYSSTQVMVRDATANDSTSPSVGVLEDLADKTYDTVEFFEIMDMLD 60
           MP Q VRSAKNMVKGYSSTQV+VRDATANDS +PS+  L+DLA ++YD+V+FFEIMDMLD
Sbjct: 1   MPKQFVRSAKNMVKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCKENLYIIKTLREFRHEDEVSGSDEG 120
           KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWC+EN Y+IKTLREFRHE+E SG DEG
Sbjct: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENE-SGFDEG 119

Query: 121 QIIRVKAKELTSL 133
           QIIRVKAKEL SL
Sbjct: 120 QIIRVKAKELVSL 132

 Score =  172 bits (436), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 80/90 (88%), Positives = 88/90 (97%)

Query: 360 KTRTGNQSISDKYSELNNLLASGTGIDTFGNTGEARIPAQHTKTGTFINSQGTGYKQVTN 419
           +TRTGNQSISDKY++LN LLA+GTG+DTFGNTGEARIPAQHTKTGTFINSQGTGYKQVT+
Sbjct: 453 QTRTGNQSISDKYNDLNVLLATGTGLDTFGNTGEARIPAQHTKTGTFINSQGTGYKQVTS 512

Query: 420 EPKNNPFLSSQYTGLPSTNIVPSHTGYGFG 449
           EPKNNPFLS+QYTGLPSTNIVP+ TGYGFG
Sbjct: 513 EPKNNPFLSNQYTGLPSTNIVPTQTGYGFG 542

>Smik_12.264 Chr12 (501598..503436) [1839 bp, 612 aa] {ON} YLR206W
           (REAL)
          Length = 612

 Score =  239 bits (609), Expect = 5e-71,   Method: Compositional matrix adjust.
 Identities = 110/133 (82%), Positives = 122/133 (91%), Gaps = 1/133 (0%)

Query: 1   MPSQLVRSAKNMVKGYSSTQVMVRDATANDSTSPSVGVLEDLADKTYDTVEFFEIMDMLD 60
           M  Q VRSAKNM+KGYSSTQV+VRDATANDS +PS+  L+DLA ++YD+V+FFEIMDMLD
Sbjct: 1   MSKQFVRSAKNMMKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCKENLYIIKTLREFRHEDEVSGSDEG 120
           KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWC+EN Y+IKTLREFRHE+E SG DEG
Sbjct: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENE-SGFDEG 119

Query: 121 QIIRVKAKELTSL 133
           QIIRVKAKEL SL
Sbjct: 120 QIIRVKAKELVSL 132

 Score =  172 bits (436), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 80/90 (88%), Positives = 86/90 (95%)

Query: 360 KTRTGNQSISDKYSELNNLLASGTGIDTFGNTGEARIPAQHTKTGTFINSQGTGYKQVTN 419
           +TRTGNQSISDKY++LN LLA+GTG DTFGNTGEARIPAQHTKTGTFINSQGTGYKQV N
Sbjct: 428 QTRTGNQSISDKYNDLNTLLATGTGTDTFGNTGEARIPAQHTKTGTFINSQGTGYKQVIN 487

Query: 420 EPKNNPFLSSQYTGLPSTNIVPSHTGYGFG 449
           EPKNNPFLS+QYTGLPSTNIVP+ TGYGFG
Sbjct: 488 EPKNNPFLSNQYTGLPSTNIVPTQTGYGFG 517

>NCAS0H00670 Chr8 (117595..119046) [1452 bp, 483 aa] {ON} Anc_7.342
          Length = 483

 Score =  234 bits (598), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 108/133 (81%), Positives = 124/133 (93%), Gaps = 1/133 (0%)

Query: 1   MPSQLVRSAKNMVKGYSSTQVMVRDATANDSTSPSVGVLEDLADKTYDTVEFFEIMDMLD 60
           M  Q VRSAKNMVKGYS+TQV+VRDAT+ND+++PS  +L +LA +++D+V+FFEIMDMLD
Sbjct: 1   MSKQFVRSAKNMVKGYSTTQVLVRDATSNDASNPSFELLYELAQRSFDSVDFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCKENLYIIKTLREFRHEDEVSGSDEG 120
           KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCKENLYIIKTLREFRHED+  G+D+G
Sbjct: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCKENLYIIKTLREFRHEDD-GGADQG 119

Query: 121 QIIRVKAKELTSL 133
           QIIRVKAKELTSL
Sbjct: 120 QIIRVKAKELTSL 132

 Score =  167 bits (423), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 77/89 (86%), Positives = 85/89 (95%)

Query: 361 TRTGNQSISDKYSELNNLLASGTGIDTFGNTGEARIPAQHTKTGTFINSQGTGYKQVTNE 420
           TRTGNQSI+DKYS+LN LLA+GTGIDTFGNTGE RIPAQHT+TGTFINSQGTGY+QVTN+
Sbjct: 369 TRTGNQSITDKYSQLNTLLATGTGIDTFGNTGEQRIPAQHTQTGTFINSQGTGYRQVTND 428

Query: 421 PKNNPFLSSQYTGLPSTNIVPSHTGYGFG 449
           PKNNPFL+SQYTGLPSTNIV + TGYGFG
Sbjct: 429 PKNNPFLNSQYTGLPSTNIVSTQTGYGFG 457

>YLR206W Chr12 (554578..556419) [1842 bp, 613 aa] {ON}
           ENT2Epsin-like protein required for endocytosis and
           actin patch assembly and functionally redundant with
           Ent1p; contains clathrin-binding motif at C-terminus
          Length = 613

 Score =  238 bits (606), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 110/133 (82%), Positives = 122/133 (91%), Gaps = 1/133 (0%)

Query: 1   MPSQLVRSAKNMVKGYSSTQVMVRDATANDSTSPSVGVLEDLADKTYDTVEFFEIMDMLD 60
           M  Q VRSAKNM+KGYSSTQV+VRDATANDS +PS+  L+DLA ++YD+V+FFEIMDMLD
Sbjct: 1   MSKQFVRSAKNMMKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCKENLYIIKTLREFRHEDEVSGSDEG 120
           KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWC+EN Y+IKTLREFRHE+E SG DEG
Sbjct: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENE-SGFDEG 119

Query: 121 QIIRVKAKELTSL 133
           QIIRVKAKEL SL
Sbjct: 120 QIIRVKAKELVSL 132

 Score =  177 bits (449), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 83/90 (92%), Positives = 88/90 (97%)

Query: 360 KTRTGNQSISDKYSELNNLLASGTGIDTFGNTGEARIPAQHTKTGTFINSQGTGYKQVTN 419
           +TRTGNQSISDKYS+LN LLA+GTGIDTFGNTGEARIPAQHTKTGTFINSQGTGYKQVTN
Sbjct: 427 QTRTGNQSISDKYSDLNTLLATGTGIDTFGNTGEARIPAQHTKTGTFINSQGTGYKQVTN 486

Query: 420 EPKNNPFLSSQYTGLPSTNIVPSHTGYGFG 449
           EPKNNPFLS+QYTGLPSTNIVP+ TGYGFG
Sbjct: 487 EPKNNPFLSNQYTGLPSTNIVPTQTGYGFG 516

>Suva_10.300 Chr10 (527412..529268) [1857 bp, 618 aa] {ON} YLR206W
           (REAL)
          Length = 618

 Score =  237 bits (605), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 110/133 (82%), Positives = 121/133 (90%), Gaps = 1/133 (0%)

Query: 1   MPSQLVRSAKNMVKGYSSTQVMVRDATANDSTSPSVGVLEDLADKTYDTVEFFEIMDMLD 60
           M  Q VRSAKNMVKGYSSTQV+VRDATAND  +PS+  L+DLA ++YD+V+FFEIMDMLD
Sbjct: 1   MSKQFVRSAKNMVKGYSSTQVLVRDATANDPRTPSIDTLDDLAQRSYDSVDFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCKENLYIIKTLREFRHEDEVSGSDEG 120
           KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWC+EN Y+IKTLREFRHE+E SG DEG
Sbjct: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENE-SGFDEG 119

Query: 121 QIIRVKAKELTSL 133
           QIIRVKAKEL SL
Sbjct: 120 QIIRVKAKELVSL 132

 Score =  167 bits (424), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 78/90 (86%), Positives = 86/90 (95%)

Query: 360 KTRTGNQSISDKYSELNNLLASGTGIDTFGNTGEARIPAQHTKTGTFINSQGTGYKQVTN 419
           +TRTGNQSISDKY++LN LLA+GTG DTFGNTGE+RIPAQHTKTGTFINSQGTGYKQV N
Sbjct: 436 QTRTGNQSISDKYNDLNVLLATGTGADTFGNTGESRIPAQHTKTGTFINSQGTGYKQVVN 495

Query: 420 EPKNNPFLSSQYTGLPSTNIVPSHTGYGFG 449
           EPKNNPFL+SQYTGLPST+IVP+ TGYGFG
Sbjct: 496 EPKNNPFLNSQYTGLPSTSIVPTQTGYGFG 525

>KNAG0C03800 Chr3 (746891..748234) [1344 bp, 447 aa] {ON} Anc_7.342
           YLR206W
          Length = 447

 Score =  226 bits (576), Expect = 7e-68,   Method: Compositional matrix adjust.
 Identities = 103/129 (79%), Positives = 121/129 (93%), Gaps = 1/129 (0%)

Query: 5   LVRSAKNMVKGYSSTQVMVRDATANDSTSPSVGVLEDLADKTYDTVEFFEIMDMLDKRLN 64
           ++RSAKN+VKGYS T+V+VRDATAN+ST+PS  +L+DLADK+Y++VEFFEI+DMLDKR+N
Sbjct: 1   MLRSAKNIVKGYSDTEVLVRDATANNSTNPSRELLDDLADKSYNSVEFFEILDMLDKRIN 60

Query: 65  DKGKYWRHVAKSLTVLDYLVRFGSENCVLWCKENLYIIKTLREFRHEDEVSGSDEGQIIR 124
           DKGKYWRHVAK+LTVLDYLVRFGSENCV+WC+ENLYIIKTLREF HED   G DEG+IIR
Sbjct: 61  DKGKYWRHVAKALTVLDYLVRFGSENCVIWCQENLYIIKTLREFSHED-AGGEDEGKIIR 119

Query: 125 VKAKELTSL 133
           VKAKELTSL
Sbjct: 120 VKAKELTSL 128

 Score =  161 bits (407), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 74/90 (82%), Positives = 83/90 (92%)

Query: 360 KTRTGNQSISDKYSELNNLLASGTGIDTFGNTGEARIPAQHTKTGTFINSQGTGYKQVTN 419
           +TR+GNQ+ISDKYS LNNLLASGTGIDTFGNTGE RIPAQHT+TGTFINSQGTGY+QV N
Sbjct: 337 QTRSGNQAISDKYSALNNLLASGTGIDTFGNTGEQRIPAQHTQTGTFINSQGTGYRQVNN 396

Query: 420 EPKNNPFLSSQYTGLPSTNIVPSHTGYGFG 449
           + K NPFL+ QYTGLPSTNIVP+ TG+GFG
Sbjct: 397 DDKPNPFLNGQYTGLPSTNIVPTQTGFGFG 426

 Score = 33.1 bits (74), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 11/14 (78%), Positives = 14/14 (100%)

Query: 243 VYYDIFGNPISPEE 256
           +YYD+FGNPI+PEE
Sbjct: 230 MYYDVFGNPITPEE 243

>TPHA0D04560 Chr4 complement(994552..996015) [1464 bp, 487 aa] {ON}
           Anc_7.342 YLR206W
          Length = 487

 Score =  225 bits (574), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 104/134 (77%), Positives = 122/134 (91%), Gaps = 1/134 (0%)

Query: 1   MPSQLVRSAKNMVKGYSSTQVMVRDATANDSTSPSVGVLEDLADKTYDTVEFFEIMDMLD 60
           M +Q VRS KN+VKGYSSTQV+VR+ATAN+ T P++ +L D+A+KTYD+ +FFEIMDMLD
Sbjct: 1   MSNQFVRSMKNVVKGYSSTQVLVRNATANEGTGPNIDLLADIAEKTYDSADFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCKENLYIIKTLREFRHEDEVSGS-DE 119
           KRLNDKGKYW+H+AKSLTVLDYLVRFGSENCVLWCKENLY+IKTL EFR+EDE SG  D+
Sbjct: 61  KRLNDKGKYWKHIAKSLTVLDYLVRFGSENCVLWCKENLYLIKTLTEFRYEDENSGGVDQ 120

Query: 120 GQIIRVKAKELTSL 133
           GQIIRVKAKELT+L
Sbjct: 121 GQIIRVKAKELTAL 134

 Score =  151 bits (381), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 68/88 (77%), Positives = 80/88 (90%)

Query: 362 RTGNQSISDKYSELNNLLASGTGIDTFGNTGEARIPAQHTKTGTFINSQGTGYKQVTNEP 421
           RTGN+ +++KY+ELN LLASGTGIDTFGNTGE RIPAQHT+TGTFINSQGTGY+Q + E 
Sbjct: 375 RTGNKEMTNKYNELNQLLASGTGIDTFGNTGETRIPAQHTQTGTFINSQGTGYRQQSGES 434

Query: 422 KNNPFLSSQYTGLPSTNIVPSHTGYGFG 449
           K NPFLS+QYTGLPS+NI+P+ TGYGFG
Sbjct: 435 KVNPFLSNQYTGLPSSNIIPTQTGYGFG 462

>ZYRO0F11550g Chr6 complement(947131..948747) [1617 bp, 538 aa] {ON}
           some similarities with uniprot|Q12518 Saccharomyces
           cerevisiae YDL161W ENT1
          Length = 538

 Score =  226 bits (576), Expect = 7e-67,   Method: Compositional matrix adjust.
 Identities = 104/133 (78%), Positives = 121/133 (90%), Gaps = 1/133 (0%)

Query: 1   MPSQLVRSAKNMVKGYSSTQVMVRDATANDSTSPSVGVLEDLADKTYDTVEFFEIMDMLD 60
           MP+Q VRSAKN +KGY+S QV+VRDATAN+   PSV +L++LA ++YD+VEFFEIMDM+D
Sbjct: 1   MPTQFVRSAKNALKGYTSAQVLVRDATANEVEGPSVDMLDELAHRSYDSVEFFEIMDMID 60

Query: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCKENLYIIKTLREFRHEDEVSGSDEG 120
           KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWC+ENLYIIKTLREFRH+D+ +  D G
Sbjct: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENLYIIKTLREFRHDDDGT-QDGG 119

Query: 121 QIIRVKAKELTSL 133
           QIIRVKAKELT+L
Sbjct: 120 QIIRVKAKELTNL 132

 Score =  155 bits (392), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 68/88 (77%), Positives = 81/88 (92%)

Query: 362 RTGNQSISDKYSELNNLLASGTGIDTFGNTGEARIPAQHTKTGTFINSQGTGYKQVTNEP 421
           RTGNQSISDKY++LN LLA  TG+DTFGN G+ARIPAQHTKTGTFINSQGTG+KQ +NEP
Sbjct: 424 RTGNQSISDKYNDLNQLLAQPTGVDTFGNVGDARIPAQHTKTGTFINSQGTGFKQYSNEP 483

Query: 422 KNNPFLSSQYTGLPSTNIVPSHTGYGFG 449
           K NPFL +Q+TG+P++++VPSHTGYGFG
Sbjct: 484 KKNPFLPTQFTGIPTSSVVPSHTGYGFG 511

>Kpol_2001.70 s2001 complement(192214..193815) [1602 bp, 533 aa]
           {ON} complement(192214..193815) [1602 nt, 534 aa]
          Length = 533

 Score =  226 bits (575), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 106/133 (79%), Positives = 120/133 (90%), Gaps = 1/133 (0%)

Query: 1   MPSQLVRSAKNMVKGYSSTQVMVRDATANDSTSPSVGVLEDLADKTYDTVEFFEIMDMLD 60
           MP Q VRSAKN+VKGYSSTQVMVR+AT+NDS  P +  L+ LA+KTYD+VEFFEIMDMLD
Sbjct: 1   MPKQFVRSAKNVVKGYSSTQVMVRNATSNDSGGPDIDTLDALAEKTYDSVEFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCKENLYIIKTLREFRHEDEVSGSDEG 120
           KRLNDKGKYW+H+AKSLTVLDYLVRFGSENCVLWCKENLYII+TL+EF + D+ S  D+G
Sbjct: 61  KRLNDKGKYWKHIAKSLTVLDYLVRFGSENCVLWCKENLYIIQTLKEFSYIDD-SDHDQG 119

Query: 121 QIIRVKAKELTSL 133
           QIIRVKAKELTSL
Sbjct: 120 QIIRVKAKELTSL 132

 Score =  176 bits (445), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 81/89 (91%), Positives = 86/89 (96%)

Query: 361 TRTGNQSISDKYSELNNLLASGTGIDTFGNTGEARIPAQHTKTGTFINSQGTGYKQVTNE 420
           TRTGNQ I+DK+ ELN LLASGTGIDTFGNTGEARIPAQHTKTGTFINSQGTGY+QVTN+
Sbjct: 383 TRTGNQDITDKFGELNQLLASGTGIDTFGNTGEARIPAQHTKTGTFINSQGTGYRQVTND 442

Query: 421 PKNNPFLSSQYTGLPSTNIVPSHTGYGFG 449
           PKNNPFL+SQYTGLPSTNIVPSHTGYGFG
Sbjct: 443 PKNNPFLNSQYTGLPSTNIVPSHTGYGFG 471

>Suva_4.83 Chr4 (155278..156666) [1389 bp, 462 aa] {ON} YDL161W
           (REAL)
          Length = 462

 Score =  223 bits (568), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 102/133 (76%), Positives = 121/133 (90%), Gaps = 1/133 (0%)

Query: 1   MPSQLVRSAKNMVKGYSSTQVMVRDATANDSTSPSVGVLEDLADKTYDTVEFFEIMDMLD 60
           M  QLVRSAKN+VKGYSSTQV+VR+AT+ND+   S   L +LA+K+YD+ +FFEIMDMLD
Sbjct: 1   MSKQLVRSAKNLVKGYSSTQVLVRNATSNDNNQVSKDSLIELAEKSYDSADFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCKENLYIIKTLREFRHEDEVSGSDEG 120
           KRLNDKGKYWRH+AK+LTVLDYL+RFGSENCVLWCKENLYIIKTL+EFRH+D+  G+D+G
Sbjct: 61  KRLNDKGKYWRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHDDD-EGTDQG 119

Query: 121 QIIRVKAKELTSL 133
           QI+RVKAKELTSL
Sbjct: 120 QIVRVKAKELTSL 132

 Score =  161 bits (408), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 71/90 (78%), Positives = 85/90 (94%)

Query: 360 KTRTGNQSISDKYSELNNLLASGTGIDTFGNTGEARIPAQHTKTGTFINSQGTGYKQVTN 419
           +TRTGNQS++DKYS+LN LL +GTGIDTFGN G+ R+PAQHTKTGTFINSQGTGY+QV+N
Sbjct: 351 QTRTGNQSMTDKYSKLNELLGTGTGIDTFGNFGDTRVPAQHTKTGTFINSQGTGYRQVSN 410

Query: 420 EPKNNPFLSSQYTGLPSTNIVPSHTGYGFG 449
           +PK+NPFL+SQYTGLPSTN+VP+ TGYGFG
Sbjct: 411 DPKHNPFLNSQYTGLPSTNVVPAQTGYGFG 440

>TDEL0C02050 Chr3 (355071..356576) [1506 bp, 501 aa] {ON} Anc_7.342
           YLR206W
          Length = 501

 Score =  223 bits (569), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 104/133 (78%), Positives = 121/133 (90%), Gaps = 1/133 (0%)

Query: 1   MPSQLVRSAKNMVKGYSSTQVMVRDATANDSTSPSVGVLEDLADKTYDTVEFFEIMDMLD 60
           M  Q VRSAKN+VKGYSS QV+VR+ATAN+S  PSV  L++LA+KTYD+VEFFEIMDM+D
Sbjct: 1   MSKQFVRSAKNVVKGYSSAQVLVRNATANESEGPSVDELDELAEKTYDSVEFFEIMDMID 60

Query: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCKENLYIIKTLREFRHEDEVSGSDEG 120
           KRLNDKGKYWRH+AKSLTVLDYLVRFGSENCVLWC+ENLY+IKTL EFR++D+  G D+G
Sbjct: 61  KRLNDKGKYWRHIAKSLTVLDYLVRFGSENCVLWCRENLYVIKTLMEFRNDDD-GGVDQG 119

Query: 121 QIIRVKAKELTSL 133
           QIIRVKAKELT+L
Sbjct: 120 QIIRVKAKELTNL 132

 Score =  160 bits (404), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 71/88 (80%), Positives = 82/88 (93%)

Query: 362 RTGNQSISDKYSELNNLLASGTGIDTFGNTGEARIPAQHTKTGTFINSQGTGYKQVTNEP 421
           RTG+ ++++KY ELN LLA+GTGIDTFGNTG+ARIPAQHTKTGTFINSQGTGY+QVT EP
Sbjct: 390 RTGDLAMTEKYGELNKLLATGTGIDTFGNTGDARIPAQHTKTGTFINSQGTGYRQVTGEP 449

Query: 422 KNNPFLSSQYTGLPSTNIVPSHTGYGFG 449
           K NPFL SQYTG+PS+NIVP+HTGYGFG
Sbjct: 450 KKNPFLQSQYTGIPSSNIVPAHTGYGFG 477

 Score = 34.3 bits (77), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 13/13 (100%), Positives = 13/13 (100%)

Query: 244 YYDIFGNPISPEE 256
           YYDIFGNPISPEE
Sbjct: 233 YYDIFGNPISPEE 245

>TBLA0E00480 Chr5 complement(88019..89818) [1800 bp, 599 aa] {ON}
           Anc_7.342 YLR206W
          Length = 599

 Score =  226 bits (575), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 100/136 (73%), Positives = 121/136 (88%), Gaps = 3/136 (2%)

Query: 1   MPSQLVRSAKNMVKGYSSTQVMVRDATANDSTSPSVGVLEDLADKTYDTVEFFEIMDMLD 60
           M  Q +RS KNMVKGYSSTQ++VRDATAND  +PS+ +L+D+A+KTYD+V+FFEIMDMLD
Sbjct: 1   MSKQFLRSTKNMVKGYSSTQILVRDATANDENTPSIDILDDIAEKTYDSVDFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCKENLYIIKTLREFRHEDEV---SGS 117
           KRLNDKGKYW+HVAKSLTVLDYL+RFGSENCV WCKENLY+IKTL+EFR +D +   +G 
Sbjct: 61  KRLNDKGKYWKHVAKSLTVLDYLIRFGSENCVFWCKENLYLIKTLKEFRVDDAIDYNTGY 120

Query: 118 DEGQIIRVKAKELTSL 133
           D+GQI+RV+A ELTSL
Sbjct: 121 DQGQIVRVRATELTSL 136

 Score =  160 bits (405), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 73/90 (81%), Positives = 82/90 (91%)

Query: 360 KTRTGNQSISDKYSELNNLLASGTGIDTFGNTGEARIPAQHTKTGTFINSQGTGYKQVTN 419
           + RTGNQ ISDKY+ LN LLA+GTGIDTFGNTG+ RIPAQHT TGTFINSQGTGYKQ  N
Sbjct: 469 QMRTGNQEISDKYNNLNTLLATGTGIDTFGNTGDMRIPAQHTATGTFINSQGTGYKQYIN 528

Query: 420 EPKNNPFLSSQYTGLPSTNIVPSHTGYGFG 449
           +PKNNPF+S+QYTGLPSTN+VPS+TGYGFG
Sbjct: 529 DPKNNPFMSNQYTGLPSTNVVPSYTGYGFG 558

>Skud_4.94 Chr4 (163372..164715) [1344 bp, 447 aa] {ON} YDL161W
           (REAL)
          Length = 447

 Score =  221 bits (562), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 101/133 (75%), Positives = 119/133 (89%), Gaps = 1/133 (0%)

Query: 1   MPSQLVRSAKNMVKGYSSTQVMVRDATANDSTSPSVGVLEDLADKTYDTVEFFEIMDMLD 60
           M  Q VRSAKN+VKGYSSTQV+VR+AT+ND+   S   L +LA+K+YD+ +FFEIMDMLD
Sbjct: 1   MSKQFVRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEKSYDSADFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCKENLYIIKTLREFRHEDEVSGSDEG 120
           KRLNDKGKYWRH+AK+LTVLDYL+RFGSENCVLWCKENLYIIKTL+EFRHED+  G D+G
Sbjct: 61  KRLNDKGKYWRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHEDD-EGVDQG 119

Query: 121 QIIRVKAKELTSL 133
           QI+RVKAKELT+L
Sbjct: 120 QIVRVKAKELTTL 132

 Score =  164 bits (414), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 72/90 (80%), Positives = 85/90 (94%)

Query: 360 KTRTGNQSISDKYSELNNLLASGTGIDTFGNTGEARIPAQHTKTGTFINSQGTGYKQVTN 419
           +TRTGNQS++DKY +LN LLA+GTGIDTFGN G++R+PAQHTKTGTFINSQGTGY+QV+N
Sbjct: 336 QTRTGNQSMTDKYGKLNELLATGTGIDTFGNVGDSRVPAQHTKTGTFINSQGTGYRQVSN 395

Query: 420 EPKNNPFLSSQYTGLPSTNIVPSHTGYGFG 449
           +PK NPFL+SQYTGLPSTNIVP+ TGYGFG
Sbjct: 396 DPKQNPFLNSQYTGLPSTNIVPTQTGYGFG 425

 Score = 34.3 bits (77), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 12/14 (85%), Positives = 14/14 (100%)

Query: 243 VYYDIFGNPISPEE 256
           +YYD+FGNPISPEE
Sbjct: 265 MYYDVFGNPISPEE 278

 Score = 33.9 bits (76), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 12/14 (85%), Positives = 14/14 (100%)

Query: 243 VYYDIFGNPISPEE 256
           +YYDIFGNPI+PEE
Sbjct: 229 MYYDIFGNPITPEE 242

>KAFR0L01460 Chr12 complement(270433..272085) [1653 bp, 550 aa] {ON}
           Anc_7.342 YLR206W
          Length = 550

 Score =  223 bits (567), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 101/133 (75%), Positives = 121/133 (90%), Gaps = 1/133 (0%)

Query: 1   MPSQLVRSAKNMVKGYSSTQVMVRDATANDSTSPSVGVLEDLADKTYDTVEFFEIMDMLD 60
           M  Q VRSAKN++KGYSSTQV+VRDAT+ND+   ++  L+D+A ++YD+V+FFEIMDMLD
Sbjct: 1   MSKQFVRSAKNVMKGYSSTQVLVRDATSNDNRVTNIDTLDDIASRSYDSVDFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCKENLYIIKTLREFRHEDEVSGSDEG 120
           KRLNDKGKYW+H+ KSLTVLDYLVRFGSENCVLWCKENLY+IKTLREFR+ED+ +G D+G
Sbjct: 61  KRLNDKGKYWKHIVKSLTVLDYLVRFGSENCVLWCKENLYVIKTLREFRYEDD-TGIDQG 119

Query: 121 QIIRVKAKELTSL 133
           QIIRVKAKELTSL
Sbjct: 120 QIIRVKAKELTSL 132

 Score =  160 bits (406), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 75/89 (84%), Positives = 83/89 (93%), Gaps = 1/89 (1%)

Query: 362 RTGNQSISDKYSELNNLLASGTGIDTFGNTGEARIPAQHTKTGTFINSQGTGYKQVTNE- 420
           RTGN+ I++KYSELNNLLA GTG+DTFGNTG+ RIPAQHTKTGTFINSQGTGYKQVTNE 
Sbjct: 389 RTGNEEITEKYSELNNLLAQGTGVDTFGNTGQERIPAQHTKTGTFINSQGTGYKQVTNER 448

Query: 421 PKNNPFLSSQYTGLPSTNIVPSHTGYGFG 449
            KNNPFL++QYTGLPS+NIVPS TGYGFG
Sbjct: 449 SKNNPFLNTQYTGLPSSNIVPSSTGYGFG 477

 Score = 31.6 bits (70), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 12/15 (80%), Positives = 14/15 (93%)

Query: 242 NVYYDIFGNPISPEE 256
           NVYYD+FGNPIS +E
Sbjct: 245 NVYYDVFGNPISYDE 259

>Smik_4.75 Chr4 (144483..145865) [1383 bp, 460 aa] {ON} YDL161W
           (REAL)
          Length = 460

 Score =  218 bits (555), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 100/133 (75%), Positives = 119/133 (89%), Gaps = 1/133 (0%)

Query: 1   MPSQLVRSAKNMVKGYSSTQVMVRDATANDSTSPSVGVLEDLADKTYDTVEFFEIMDMLD 60
           M  Q VRSAKN+VKGYSSTQV+VR+AT+ND+   S   L +LA+K+YD+ +FFEIMDMLD
Sbjct: 1   MSKQFVRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEKSYDSADFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCKENLYIIKTLREFRHEDEVSGSDEG 120
           KRLNDKGKYWRH+AK+LTVLDYL+RFGSENCVLWCKENLYIIKTL+EFRHED+  G D+G
Sbjct: 61  KRLNDKGKYWRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHEDD-EGIDQG 119

Query: 121 QIIRVKAKELTSL 133
           QI+RVK+KELT+L
Sbjct: 120 QIVRVKSKELTAL 132

 Score =  163 bits (413), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 73/90 (81%), Positives = 85/90 (94%)

Query: 360 KTRTGNQSISDKYSELNNLLASGTGIDTFGNTGEARIPAQHTKTGTFINSQGTGYKQVTN 419
           +TRTGNQS++DKY++LN LLA+GTGIDTFGN G+AR+PAQHTKTGTFINSQGTGYKQV+N
Sbjct: 349 QTRTGNQSMTDKYNKLNELLATGTGIDTFGNVGDARVPAQHTKTGTFINSQGTGYKQVSN 408

Query: 420 EPKNNPFLSSQYTGLPSTNIVPSHTGYGFG 449
           +PK NPFLS QYTGLPSTN+VP+ TGYGFG
Sbjct: 409 DPKYNPFLSGQYTGLPSTNVVPTQTGYGFG 438

 Score = 33.9 bits (76), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 12/14 (85%), Positives = 14/14 (100%)

Query: 243 VYYDIFGNPISPEE 256
           +YYDIFGNPI+PEE
Sbjct: 229 MYYDIFGNPITPEE 242

 Score = 33.1 bits (74), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 11/14 (78%), Positives = 14/14 (100%)

Query: 243 VYYDIFGNPISPEE 256
           +YYD+FGNPI+PEE
Sbjct: 265 LYYDVFGNPITPEE 278

>YDL161W Chr4 (167714..169078) [1365 bp, 454 aa] {ON}
           ENT1Epsin-like protein involved in endocytosis and actin
           patch assembly and functionally redundant with Ent2p;
           binds clathrin via a clathrin-binding domain motif at
           C-terminus
          Length = 454

 Score =  217 bits (553), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 99/133 (74%), Positives = 119/133 (89%), Gaps = 1/133 (0%)

Query: 1   MPSQLVRSAKNMVKGYSSTQVMVRDATANDSTSPSVGVLEDLADKTYDTVEFFEIMDMLD 60
           M  Q VRSAKN+VKGYSSTQV+VR+AT+ND+   S   L +LA+K+YD+ +FFEIMDMLD
Sbjct: 1   MSKQFVRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEKSYDSADFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCKENLYIIKTLREFRHEDEVSGSDEG 120
           KRLNDKGKYWRH+AK+LTV+DYL+RFGSENCVLWC+ENLYIIKTL+EFRHED+  G D+G
Sbjct: 61  KRLNDKGKYWRHIAKALTVIDYLIRFGSENCVLWCRENLYIIKTLKEFRHEDD-EGIDQG 119

Query: 121 QIIRVKAKELTSL 133
           QI+RVKAKELT+L
Sbjct: 120 QIVRVKAKELTAL 132

 Score =  158 bits (399), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 70/89 (78%), Positives = 84/89 (94%)

Query: 360 KTRTGNQSISDKYSELNNLLASGTGIDTFGNTGEARIPAQHTKTGTFINSQGTGYKQVTN 419
           + RTGNQS++DKYS+LN LLA+GTGIDTFGN GEARIPAQHTKTGTFINSQGTGY+QV++
Sbjct: 343 QNRTGNQSMTDKYSKLNELLATGTGIDTFGNVGEARIPAQHTKTGTFINSQGTGYRQVSD 402

Query: 420 EPKNNPFLSSQYTGLPSTNIVPSHTGYGF 448
           +P +NPFL+SQYTGLPST++VP+ TGYGF
Sbjct: 403 DPNHNPFLNSQYTGLPSTSVVPTQTGYGF 431

 Score = 33.5 bits (75), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 12/14 (85%), Positives = 14/14 (100%)

Query: 243 VYYDIFGNPISPEE 256
           +YYDIFGNPI+PEE
Sbjct: 229 MYYDIFGNPITPEE 242

>SAKL0F10934g Chr6 (856966..858462) [1497 bp, 498 aa] {ON} some
           similarities with uniprot|Q12518 Saccharomyces
           cerevisiae YDL161W ENT1
          Length = 498

 Score =  216 bits (549), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 103/133 (77%), Positives = 117/133 (87%), Gaps = 1/133 (0%)

Query: 1   MPSQLVRSAKNMVKGYSSTQVMVRDATANDSTSPSVGVLEDLADKTYDTVEFFEIMDMLD 60
           M   L+R+AKN+V GYSS QV+VR+AT+N+ T P+V  L++LA+KTYD VEFFEIMDMLD
Sbjct: 1   MSKALLRTAKNVVNGYSSVQVLVRNATSNEPTGPTVDQLDELAEKTYDNVEFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCKENLYIIKTLREFRHEDEVSGSDEG 120
           KRLNDKGK WRHVAKSLTVLDYLVR+GSENCVLW +ENLYIIKTLREF HEDE+ G D G
Sbjct: 61  KRLNDKGKNWRHVAKSLTVLDYLVRYGSENCVLWSQENLYIIKTLREFMHEDEM-GVDHG 119

Query: 121 QIIRVKAKELTSL 133
           QIIRVKAKELTSL
Sbjct: 120 QIIRVKAKELTSL 132

 Score =  162 bits (409), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 75/90 (83%), Positives = 86/90 (95%), Gaps = 1/90 (1%)

Query: 361 TRTGNQSISDKYSELNNLLASGTGIDTFGNTGEARIPAQHTKTGTFINSQGTGYKQVTN- 419
           TRTGNQSIS KY++LNNLLASGTG+DTFGNTG+ RIPAQHT+TG FINSQGTGYKQVTN 
Sbjct: 374 TRTGNQSISQKYNDLNNLLASGTGLDTFGNTGQTRIPAQHTRTGNFINSQGTGYKQVTND 433

Query: 420 EPKNNPFLSSQYTGLPSTNIVPSHTGYGFG 449
           +PKNNPFL++QYTGLPST++VPS+TGYGFG
Sbjct: 434 QPKNNPFLAAQYTGLPSTSVVPSYTGYGFG 463

 Score = 32.3 bits (72), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 11/13 (84%), Positives = 13/13 (100%)

Query: 244 YYDIFGNPISPEE 256
           YYD+FGNPI+PEE
Sbjct: 237 YYDVFGNPITPEE 249

>NDAI0D00610 Chr4 (133678..135138) [1461 bp, 486 aa] {ON} Anc_7.342
           YDL161W
          Length = 486

 Score =  214 bits (545), Expect = 8e-63,   Method: Compositional matrix adjust.
 Identities = 97/133 (72%), Positives = 119/133 (89%), Gaps = 2/133 (1%)

Query: 1   MPSQLVRSAKNMVKGYSSTQVMVRDATANDSTSPSVGVLEDLADKTYDTVEFFEIMDMLD 60
           M  Q VRSAKNM+KGYS+TQV+VRDAT+NDS++PS  +L +++ +++D+V+FFEIMDMLD
Sbjct: 1   MSKQFVRSAKNMMKGYSTTQVLVRDATSNDSSNPSFEILYEISKRSFDSVDFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCKENLYIIKTLREFRHEDEVSGSDEG 120
           KRLNDKGKYW+H+AKSLTVLDYLVRFGSENCVLWCK+NLYIIKTL+EF+ ED+    DE 
Sbjct: 61  KRLNDKGKYWKHIAKSLTVLDYLVRFGSENCVLWCKQNLYIIKTLKEFKLEDD--NVDES 118

Query: 121 QIIRVKAKELTSL 133
            IIRVKAKELT+L
Sbjct: 119 SIIRVKAKELTAL 131

 Score =  166 bits (419), Expect = 8e-45,   Method: Compositional matrix adjust.
 Identities = 77/89 (86%), Positives = 85/89 (95%), Gaps = 1/89 (1%)

Query: 361 TRTGNQSISDKYSELNNLLASGTGIDTFGNTGEARIPAQHTKTGTFINSQGTGYKQVTNE 420
           TRTGNQSISDKY+ELNNLLASGTGIDTFGNTG+ RIPAQHT+TGTFINSQGTGYKQ+ N+
Sbjct: 368 TRTGNQSISDKYNELNNLLASGTGIDTFGNTGDQRIPAQHTQTGTFINSQGTGYKQIVND 427

Query: 421 P-KNNPFLSSQYTGLPSTNIVPSHTGYGF 448
           P K NPFL++QYTGLPS+NIVPSHTGYGF
Sbjct: 428 PVKKNPFLNNQYTGLPSSNIVPSHTGYGF 456

 Score = 36.2 bits (82), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 14/14 (100%), Positives = 14/14 (100%)

Query: 243 VYYDIFGNPISPEE 256
           VYYDIFGNPISPEE
Sbjct: 251 VYYDIFGNPISPEE 264

>KAFR0B00890 Chr2 (166365..167609) [1245 bp, 414 aa] {ON} Anc_7.342
           YLR206W
          Length = 414

 Score =  206 bits (524), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 94/129 (72%), Positives = 113/129 (87%), Gaps = 1/129 (0%)

Query: 5   LVRSAKNMVKGYSSTQVMVRDATANDSTSPSVGVLEDLADKTYDTVEFFEIMDMLDKRLN 64
           ++RSAKN+VKGYSSTQ +VRDAT+N   +P +  L +LA+ TY+ +EFFEIMDMLDKR+N
Sbjct: 1   MLRSAKNLVKGYSSTQKLVRDATSNSHDNPPIDQLSELAEMTYNNMEFFEIMDMLDKRIN 60

Query: 65  DKGKYWRHVAKSLTVLDYLVRFGSENCVLWCKENLYIIKTLREFRHEDEVSGSDEGQIIR 124
            KGKYW+HV KSL VLDYLVRFGSENCV+WCKENLYIIKTLREF +EDE SG D+GQ++R
Sbjct: 61  SKGKYWKHVIKSLIVLDYLVRFGSENCVIWCKENLYIIKTLREFTYEDE-SGMDQGQMVR 119

Query: 125 VKAKELTSL 133
           V+AKELTSL
Sbjct: 120 VRAKELTSL 128

 Score =  153 bits (387), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 74/90 (82%), Positives = 80/90 (88%)

Query: 360 KTRTGNQSISDKYSELNNLLASGTGIDTFGNTGEARIPAQHTKTGTFINSQGTGYKQVTN 419
           +TRTG+QSISDKYS LN LLA+GTGIDTFGNTG  RIPAQHTKTGTFINSQGTGYKQV+ 
Sbjct: 313 QTRTGSQSISDKYSALNTLLATGTGIDTFGNTGNQRIPAQHTKTGTFINSQGTGYKQVST 372

Query: 420 EPKNNPFLSSQYTGLPSTNIVPSHTGYGFG 449
              NN FL+SQYTGLPS+NIVPS TGYGFG
Sbjct: 373 NGFNNVFLNSQYTGLPSSNIVPSQTGYGFG 402

 Score = 33.9 bits (76), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 12/14 (85%), Positives = 14/14 (100%)

Query: 243 VYYDIFGNPISPEE 256
           +YYDIFGNPI+PEE
Sbjct: 218 MYYDIFGNPITPEE 231

>KLLA0C16731g Chr3 complement(1463616..1465052) [1437 bp, 478 aa]
           {ON} some similarities with uniprot|Q12518 Saccharomyces
           cerevisiae YDL161W ENT1
          Length = 478

 Score =  207 bits (527), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 95/133 (71%), Positives = 109/133 (81%)

Query: 1   MPSQLVRSAKNMVKGYSSTQVMVRDATANDSTSPSVGVLEDLADKTYDTVEFFEIMDMLD 60
           M    +RSAKN+V GYS  QV+VR AT+ND   PSV  LE+LA++T+D VEFFEIMDMLD
Sbjct: 1   MSKAFLRSAKNLVNGYSQAQVLVRSATSNDKDGPSVDQLEELAERTFDNVEFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCKENLYIIKTLREFRHEDEVSGSDEG 120
           KRLNDKG+ WRHVAKSLT LD+LVR GSENCV WCKENLYIIKTLREF H DE +  D G
Sbjct: 61  KRLNDKGRNWRHVAKSLTCLDFLVRCGSENCVFWCKENLYIIKTLREFTHTDEFTEIDNG 120

Query: 121 QIIRVKAKELTSL 133
           +I+RVKAKELT+L
Sbjct: 121 EIVRVKAKELTAL 133

 Score =  165 bits (418), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 77/91 (84%), Positives = 86/91 (94%), Gaps = 1/91 (1%)

Query: 360 KTRTGNQSISDKYSELNNLLASGTGIDTFGNTGEARIPAQHTKTGTFINSQGTGYKQVTN 419
           K RTGNQSISDK+SELNNLLASGTGIDTFGNTGE R+PAQHTKTGTFINSQGTGYKQ+TN
Sbjct: 358 KQRTGNQSISDKFSELNNLLASGTGIDTFGNTGETRVPAQHTKTGTFINSQGTGYKQITN 417

Query: 420 E-PKNNPFLSSQYTGLPSTNIVPSHTGYGFG 449
           + PK+NPFL+SQYTG+PS+ I PS+TGYGFG
Sbjct: 418 DAPKHNPFLTSQYTGIPSSAIAPSYTGYGFG 448

>Kwal_56.24610 s56 complement(1073855..1075381) [1527 bp, 508 aa]
           {ON} YDL161W (ENT1) - Ent1p [contig 161] FULL
          Length = 508

 Score =  202 bits (514), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 91/133 (68%), Positives = 116/133 (87%), Gaps = 1/133 (0%)

Query: 1   MPSQLVRSAKNMVKGYSSTQVMVRDATANDSTSPSVGVLEDLADKTYDTVEFFEIMDMLD 60
           M   L+R AKN+V GYS+TQV++R+AT+ND   PS+ +++++A++++D+V FFEIMDMLD
Sbjct: 1   MSKSLIRKAKNVVNGYSTTQVLLREATSNDPEGPSLDIMDEIAERSWDSVSFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCKENLYIIKTLREFRHEDEVSGSDEG 120
           KRLNDKGK WRHVAKSLTVLDYLVR GSE+CV W KENLY+IKTLREF HEDE+ G D+G
Sbjct: 61  KRLNDKGKNWRHVAKSLTVLDYLVRCGSEHCVPWAKENLYVIKTLREFMHEDEL-GIDQG 119

Query: 121 QIIRVKAKELTSL 133
           QI+RVKA+ELT+L
Sbjct: 120 QIVRVKARELTAL 132

 Score =  163 bits (413), Expect = 8e-44,   Method: Compositional matrix adjust.
 Identities = 74/89 (83%), Positives = 84/89 (94%)

Query: 361 TRTGNQSISDKYSELNNLLASGTGIDTFGNTGEARIPAQHTKTGTFINSQGTGYKQVTNE 420
           TRTGNQSI++K+SELNNLLASGTG+DTFGNTG+ RIPAQHTKTG FINSQGTGYKQV++ 
Sbjct: 395 TRTGNQSITEKHSELNNLLASGTGLDTFGNTGQTRIPAQHTKTGNFINSQGTGYKQVSST 454

Query: 421 PKNNPFLSSQYTGLPSTNIVPSHTGYGFG 449
           PK+NPFL  QYTGLPSTN+VPS+TGYGFG
Sbjct: 455 PKHNPFLGQQYTGLPSTNVVPSYTGYGFG 483

>KLTH0H01430g Chr8 (132738..134246) [1509 bp, 502 aa] {ON} some
           similarities with uniprot|Q12518 Saccharomyces
           cerevisiae YDL161W ENT1
          Length = 502

 Score =  202 bits (513), Expect = 4e-58,   Method: Compositional matrix adjust.
 Identities = 92/133 (69%), Positives = 116/133 (87%), Gaps = 1/133 (0%)

Query: 1   MPSQLVRSAKNMVKGYSSTQVMVRDATANDSTSPSVGVLEDLADKTYDTVEFFEIMDMLD 60
           M   L+R AKN+V GYS+TQV++R+AT+ND   PS+ +++++A++++D+V FFEIMDMLD
Sbjct: 1   MSKSLMRRAKNVVNGYSTTQVLLREATSNDPDGPSLDLMDEIAERSWDSVSFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCKENLYIIKTLREFRHEDEVSGSDEG 120
           KRLNDKGK WRHVAKSLTVLDYLVR GSE+CV W KENLYIIKTLREF HEDE +G D+G
Sbjct: 61  KRLNDKGKNWRHVAKSLTVLDYLVRCGSEHCVPWAKENLYIIKTLREFTHEDE-TGVDQG 119

Query: 121 QIIRVKAKELTSL 133
           QI+RVKA+ELT+L
Sbjct: 120 QIVRVKARELTAL 132

 Score =  160 bits (404), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 74/91 (81%), Positives = 85/91 (93%), Gaps = 2/91 (2%)

Query: 361 TRTGNQSISDKYSELNNLLASGTGIDTFGNTGEARIPAQHTKTGTFINSQGTGYKQVTNE 420
           TRTGNQS++DK+S+LNNLLASGTG+DTFGNTG+ RIPAQHTKTGTFINSQGTGYKQV+N 
Sbjct: 387 TRTGNQSVTDKFSDLNNLLASGTGLDTFGNTGQTRIPAQHTKTGTFINSQGTGYKQVSNM 446

Query: 421 P--KNNPFLSSQYTGLPSTNIVPSHTGYGFG 449
           P  K+NPFL  QYTGLPST++VPS+TGYGFG
Sbjct: 447 PQGKHNPFLGQQYTGLPSTSVVPSYTGYGFG 477

>KNAG0B02650 Chr2 (511995..513935) [1941 bp, 646 aa] {ON} Anc_7.342
           YLR206W
          Length = 646

 Score =  190 bits (483), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 84/133 (63%), Positives = 109/133 (81%)

Query: 1   MPSQLVRSAKNMVKGYSSTQVMVRDATANDSTSPSVGVLEDLADKTYDTVEFFEIMDMLD 60
           M  Q VRSAKN++KGYSSTQV+VRDATAND  +P +  LED+A  ++D+V+FFEIMD+L+
Sbjct: 1   MSRQFVRSAKNVMKGYSSTQVLVRDATANDGRTPHLDTLEDIAGLSFDSVDFFEIMDVLE 60

Query: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCKENLYIIKTLREFRHEDEVSGSDEG 120
           KRLND GKYWRH+ KSLTVLDYLVRFGSE+C  W +++L+++K LR FR  D+  G D+G
Sbjct: 61  KRLNDSGKYWRHIEKSLTVLDYLVRFGSEHCADWARDHLFLLKALRNFRFVDDGIGFDQG 120

Query: 121 QIIRVKAKELTSL 133
           QI+RVKA++L  L
Sbjct: 121 QIVRVKARDLVEL 133

 Score =  145 bits (366), Expect = 9e-37,   Method: Compositional matrix adjust.
 Identities = 68/93 (73%), Positives = 80/93 (86%), Gaps = 3/93 (3%)

Query: 360 KTRTGNQSISDKYSELNNLLASGTGIDTFGNTGEARIPAQHTKTGTFINSQGTGYKQVTN 419
           +  TGNQ +++KYSELNNLLA GTG+DTFGN G  RIPAQHT+TGTFINSQGTG+KQV +
Sbjct: 493 RMNTGNQEVTNKYSELNNLLAQGTGVDTFGNEGTQRIPAQHTQTGTFINSQGTGFKQVNS 552

Query: 420 E---PKNNPFLSSQYTGLPSTNIVPSHTGYGFG 449
           E   P +NPFL+SQYTGLPST IVP++TGYGFG
Sbjct: 553 EGKDPNSNPFLNSQYTGLPSTGIVPAYTGYGFG 585

>Ecym_4731 Chr4 (1427875..1429419) [1545 bp, 514 aa] {ON} similar to
           Ashbya gossypii ACL157C
          Length = 514

 Score =  187 bits (475), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 86/133 (64%), Positives = 106/133 (79%)

Query: 1   MPSQLVRSAKNMVKGYSSTQVMVRDATANDSTSPSVGVLEDLADKTYDTVEFFEIMDMLD 60
           M  QL+RSAKN++ GYS  QV+VR+AT+ND   PS+  +E+LA++TY  VEFFEIM MLD
Sbjct: 1   MSKQLLRSAKNVMNGYSQAQVLVRNATSNDEYGPSLDQMEELAERTYSAVEFFEIMVMLD 60

Query: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCKENLYIIKTLREFRHEDEVSGSDEG 120
           +RLNDK K WRHVAKSLTV DYLVR G+E CV W +EN++II+ L EF H DE SG+D G
Sbjct: 61  RRLNDKPKNWRHVAKSLTVTDYLVRTGAEACVDWARENMFIIRKLTEFVHVDESSGTDHG 120

Query: 121 QIIRVKAKELTSL 133
           Q+IRVKAKEL +L
Sbjct: 121 QLIRVKAKELIAL 133

 Score =  160 bits (406), Expect = 9e-43,   Method: Compositional matrix adjust.
 Identities = 76/90 (84%), Positives = 84/90 (93%), Gaps = 1/90 (1%)

Query: 361 TRTGNQSISDKYSELNNLLASGTGIDTFGNTGEARIPAQHTKTGTFINSQGTGYKQVTNE 420
           TRTGNQSISDKY ELN LLA+GTGIDTFGNTG+ARI +QHTKT TFINS GTG+KQV+NE
Sbjct: 403 TRTGNQSISDKYGELNALLATGTGIDTFGNTGQARISSQHTKTETFINSHGTGFKQVSNE 462

Query: 421 -PKNNPFLSSQYTGLPSTNIVPSHTGYGFG 449
            PK+NPFL++QYTGLPSTNIVPSHTGYGFG
Sbjct: 463 PPKHNPFLTTQYTGLPSTNIVPSHTGYGFG 492

>ACL157C Chr3 complement(79325..80872) [1548 bp, 515 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR206W
           (ENT2) and YDL161W (ENT1)
          Length = 515

 Score =  179 bits (453), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 80/132 (60%), Positives = 104/132 (78%)

Query: 1   MPSQLVRSAKNMVKGYSSTQVMVRDATANDSTSPSVGVLEDLADKTYDTVEFFEIMDMLD 60
           M  QL+RSAKN+V GYS  Q++VR+AT+N+   PS+  +E+LA+++Y  VEFFEI+ MLD
Sbjct: 1   MSKQLLRSAKNVVNGYSPAQILVRNATSNEEYGPSMDQMEELAERSYSAVEFFEIVVMLD 60

Query: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCKENLYIIKTLREFRHEDEVSGSDEG 120
           KRL+DK K+WRHVAKSLTV D+LVR G+E CV W +ENLY+ + L EF H DE +G D G
Sbjct: 61  KRLSDKPKHWRHVAKSLTVTDFLVRTGAETCVDWARENLYLFRRLTEFYHVDESTGVDHG 120

Query: 121 QIIRVKAKELTS 132
           QIIRVKA+EL +
Sbjct: 121 QIIRVKARELVA 132

 Score =  165 bits (418), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 78/90 (86%), Positives = 86/90 (95%), Gaps = 1/90 (1%)

Query: 361 TRTGNQSISDKYSELNNLLASGTGIDTFGNTGEARIPAQHTKTGTFINSQGTGYKQVTNE 420
           TRTGNQSI+DKYSELN LLASGTG+DTFGNTG+ RIPAQHTKTGTFINSQGTGYKQV NE
Sbjct: 401 TRTGNQSITDKYSELNTLLASGTGLDTFGNTGQTRIPAQHTKTGTFINSQGTGYKQVGNE 460

Query: 421 -PKNNPFLSSQYTGLPSTNIVPSHTGYGFG 449
            PK+NPF+++QYTGLPSTN+VPSHTGYGFG
Sbjct: 461 PPKHNPFIATQYTGLPSTNMVPSHTGYGFG 490

>TBLA0E02040 Chr5 complement(494899..497004) [2106 bp, 701 aa] {ON}
           Anc_7.342 YLR206W
          Length = 701

 Score =  165 bits (418), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 78/133 (58%), Positives = 100/133 (75%), Gaps = 1/133 (0%)

Query: 1   MPSQLVRSAKNMVKGYSSTQVMVRDATANDSTSPSVGVLEDLADKTYDTVEFFEIMDMLD 60
           M  Q VRS KNM KGYS TQV+VRDATAN+ +  S+ VL+ L + +YDT EF +I  +LD
Sbjct: 1   MSHQFVRSTKNMFKGYSPTQVLVRDATANNDSGTSIDVLDQLGEMSYDTHEFRDIFSVLD 60

Query: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCKENLYIIKTLREFRHEDEVSGSDEG 120
           +R++DK KYWRHVAKSLTV+DYLVRFGSE CV W ++N   ++ LR+F + D  +G D+G
Sbjct: 61  RRISDKPKYWRHVAKSLTVVDYLVRFGSEACVQWARDNARQLEILRDFYYSDS-AGIDQG 119

Query: 121 QIIRVKAKELTSL 133
           Q+IRVKA EL  L
Sbjct: 120 QLIRVKAAELIDL 132

 Score =  114 bits (284), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 56/78 (71%), Positives = 59/78 (75%)

Query: 363 TGNQSISDKYSELNNLLASGTGIDTFGNTGEARIPAQHTKTGTFINSQGTGYKQVTNEPK 422
           TGN  IS KYS LN LLA GTGIDTFGN G  RIPAQHTKTGTFINSQGTGYKQVT+   
Sbjct: 596 TGNSVISAKYSNLNQLLAQGTGIDTFGNEGATRIPAQHTKTGTFINSQGTGYKQVTSSSS 655

Query: 423 NNPFLSSQYTGLPSTNIV 440
             P L +QYTGLP+   V
Sbjct: 656 PIPLLPTQYTGLPAQTAV 673

>KLTH0D16896g Chr4 complement(1395711..1396916) [1206 bp, 401 aa]
           {ON} similar to uniprot|P47160 Saccharomyces cerevisiae
           YJR125C ENT3 Protein containing an N-terminal epsin-like
           domain involved in clathrin recruitment and traffic
           between the Golgi and endosomes associates with the
           clathrin adaptor Gga2p
          Length = 401

 Score = 85.9 bits (211), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 47/128 (36%), Positives = 73/128 (57%), Gaps = 2/128 (1%)

Query: 7   RSAKNMVKGYSSTQVMVRDATANDSTSPSVGVLEDLADKTYDTVEFFEIMDMLDKRLNDK 66
           R A+NMV  Y+  +  VR+AT N+    S  ++E ++  TY+  E  EI+ M+ +R  +K
Sbjct: 20  RKAQNMVFNYTEMEAKVREATNNEPWGASSTLMEQISQGTYNYREREEILGMIFRRFTEK 79

Query: 67  -GKYWRHVAKSLTVLDYLVRFGSENCVLWCKENLYIIKTLREFRHEDEVSGSDEGQIIRV 125
               WR + K+L +LDYL+R G+E  +   + NL +IK L  F + D   G D+G  +R 
Sbjct: 80  TASEWRQIYKALQLLDYLIRHGAERFIDDTRANLSLIKMLESFHYIDS-QGRDQGINVRN 138

Query: 126 KAKELTSL 133
           +A EL  L
Sbjct: 139 RAHELVLL 146

>Kwal_47.16857 s47 (145176..146324) [1149 bp, 382 aa] {ON} YJR125C
           (ENT3) - Ent3p [contig 219] FULL
          Length = 382

 Score = 84.3 bits (207), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 47/128 (36%), Positives = 73/128 (57%), Gaps = 2/128 (1%)

Query: 7   RSAKNMVKGYSSTQVMVRDATANDSTSPSVGVLEDLADKTYDTVEFFEIMDMLDKRLNDK 66
           R A+N+V  Y+  +  VR+AT N+    S  ++E +A  TY+  E  EI+ M+ +R  +K
Sbjct: 20  RKAQNVVFNYTEMEAKVREATNNEPWGASSTLMEQIAQGTYNYREREEILGMIFRRFTEK 79

Query: 67  -GKYWRHVAKSLTVLDYLVRFGSENCVLWCKENLYIIKTLREFRHEDEVSGSDEGQIIRV 125
               WR + K+L +LDYL+R G+E  +   + NL +IK L  F + D   G D+G  +R 
Sbjct: 80  TASEWRQIYKALQLLDYLIRHGAERFIDDTRANLSLIKMLESFHYIDS-QGRDQGINVRN 138

Query: 126 KAKELTSL 133
           +A EL  L
Sbjct: 139 RAHELALL 146

>TBLA0E04760 Chr5 complement(1226806..1228086) [1281 bp, 426 aa]
           {ON} Anc_4.346 YJR125C
          Length = 426

 Score = 84.7 bits (208), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 44/128 (34%), Positives = 75/128 (58%), Gaps = 2/128 (1%)

Query: 7   RSAKNMVKGYSSTQVMVRDATANDSTSPSVGVLEDLADKTYDTVEFFEIMDMLDKRLNDK 66
           R A+N+V  Y+  +  VR+AT N+    S  ++E +A  TY+  E  EI+ M+ +R  +K
Sbjct: 20  RKAQNVVFNYTDMEAKVREATNNEPWGASSTLMEQIAQGTYNPREREEILSMILRRFTEK 79

Query: 67  -GKYWRHVAKSLTVLDYLVRFGSENCVLWCKENLYIIKTLREFRHEDEVSGSDEGQIIRV 125
            G  WR + K+L +L+YL+  G+E  +   + +L +I+ L  F + D   G D+G  +R 
Sbjct: 80  SGNLWRQIYKALQLLEYLITHGAERFIDEARSSLGLIRMLESFHYVDS-EGRDQGANVRS 138

Query: 126 KAKELTSL 133
           +A+ +TSL
Sbjct: 139 RAQAMTSL 146

>KNAG0M00380 Chr13 (56675..57886) [1212 bp, 403 aa] {ON} Anc_4.346
           YJR125C
          Length = 403

 Score = 83.6 bits (205), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 46/128 (35%), Positives = 74/128 (57%), Gaps = 2/128 (1%)

Query: 7   RSAKNMVKGYSSTQVMVRDATANDSTSPSVGVLEDLADKTYDTVEFFEIMDMLDKRLNDK 66
           R A+N+V  ++  +  VR+AT N+    S  ++E +A  TY+  E  E+M ML +R  +K
Sbjct: 20  RKAQNVVFNFTEMESKVREATNNEPWGASSTLMEQIAQGTYNYKEREEVMMMLMRRFTEK 79

Query: 67  -GKYWRHVAKSLTVLDYLVRFGSENCVLWCKENLYIIKTLREFRHEDEVSGSDEGQIIRV 125
            G  WR + K+L +LDYL+R GSE  +   +  L I++ L  F + D   G D+G  +R 
Sbjct: 80  AGSEWRQIYKALQLLDYLIRRGSEKFIDDVRAALRIVRLLESFHYIDS-QGRDQGVNVRN 138

Query: 126 KAKELTSL 133
           +AK++  L
Sbjct: 139 RAKQIVEL 146

>SAKL0G17952g Chr7 complement(1555520..1556767) [1248 bp, 415 aa]
           {ON} similar to uniprot|P47160 Saccharomyces cerevisiae
           YJR125C ENT3 Protein containing an N-terminal epsin-like
           domain involved in clathrin recruitment and traffic
           between the Golgi and endosomes associates with the
           clathrin adaptor Gga2p
          Length = 415

 Score = 83.6 bits (205), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 45/128 (35%), Positives = 74/128 (57%), Gaps = 2/128 (1%)

Query: 7   RSAKNMVKGYSSTQVMVRDATANDSTSPSVGVLEDLADKTYDTVEFFEIMDMLDKRLNDK 66
           R A+N+V  Y+  +  VR+AT N+    S  ++E ++  TY+  E  EI+ M+ +R  +K
Sbjct: 20  RKAQNVVFNYTEMEAKVREATNNEPWGASSTLMEQISAGTYNYREREEILGMIFRRFTEK 79

Query: 67  -GKYWRHVAKSLTVLDYLVRFGSENCVLWCKENLYIIKTLREFRHEDEVSGSDEGQIIRV 125
               WR + K+L +L+YL++ GSE  +   + NL +IK L  F + D   G D+G  +R 
Sbjct: 80  TASEWRQIYKALQLLEYLIKHGSERFIDDSRANLTLIKMLESFHYTDS-QGRDQGINVRN 138

Query: 126 KAKELTSL 133
           +A+EL  L
Sbjct: 139 RAQELVKL 146

>NDAI0D03200 Chr4 complement(764129..765436) [1308 bp, 435 aa] {ON}
           Anc_4.346
          Length = 435

 Score = 83.6 bits (205), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 46/128 (35%), Positives = 75/128 (58%), Gaps = 2/128 (1%)

Query: 7   RSAKNMVKGYSSTQVMVRDATANDSTSPSVGVLEDLADKTYDTVEFFEIMDMLDKRLNDK 66
           R A+N+V  Y+  +  VR+AT N+    S  ++E +A  TY+  E +EI+ M+ +R  +K
Sbjct: 20  RKAQNVVFNYTEMESKVREATNNEPWGASSTLMEQIAQGTYNVRERYEIVGMIFRRFTEK 79

Query: 67  -GKYWRHVAKSLTVLDYLVRFGSENCVLWCKENLYIIKTLREFRHEDEVSGSDEGQIIRV 125
            G  WR + K+L +LDYL++ GSE  +   + +L +I+ L  F + D   G D+G  +R 
Sbjct: 80  AGSEWRQIYKALQLLDYLIKHGSEPFIDDVRSSLKLIQMLETFHYIDS-EGRDQGINVRN 138

Query: 126 KAKELTSL 133
           +AK L  L
Sbjct: 139 RAKLLVEL 146

>KLLA0B04587g Chr2 (411097..412299) [1203 bp, 400 aa] {ON} similar
           to uniprot|P47160 Saccharomyces cerevisiae YJR125C ENT3
           Protein containing an N-terminal epsin-like domain
           involved in clathrin recruitment and traffic between the
           Golgi and endosomes associates with the clathrin adaptor
           Gga2p
          Length = 400

 Score = 81.6 bits (200), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 45/128 (35%), Positives = 73/128 (57%), Gaps = 2/128 (1%)

Query: 7   RSAKNMVKGYSSTQVMVRDATANDSTSPSVGVLEDLADKTYDTVEFFEIMDMLDKRLNDK 66
           R A+N+V  Y+  +  VR+AT N+    S  ++E +A  TY+  E  EI+ M+ +R  +K
Sbjct: 20  RKAQNVVFNYTEMEAKVREATNNEPWGASSTLMEHIAQGTYNYREREEILGMIFRRFTEK 79

Query: 67  -GKYWRHVAKSLTVLDYLVRFGSENCVLWCKENLYIIKTLREFRHEDEVSGSDEGQIIRV 125
               WR + K+L +L+YLV+ GSE  +   + NL ++K L  F + D   G D+G  +R 
Sbjct: 80  TASEWRQIYKALQLLEYLVKHGSERFIDDVRTNLNLVKMLESFHYIDS-QGRDQGINVRN 138

Query: 126 KAKELTSL 133
           +A +L  L
Sbjct: 139 RASQLVKL 146

>TDEL0D00710 Chr4 (127174..128301) [1128 bp, 375 aa] {ON} Anc_4.346
           YJR125C
          Length = 375

 Score = 81.3 bits (199), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 45/128 (35%), Positives = 73/128 (57%), Gaps = 2/128 (1%)

Query: 7   RSAKNMVKGYSSTQVMVRDATANDSTSPSVGVLEDLADKTYDTVEFFEIMDMLDKRLNDK 66
           R A+N+V  Y+  +  VR+AT N+    S  ++E ++  TY+  E  EI+ M+ +RL +K
Sbjct: 20  RRAQNVVFNYTDMEAKVREATNNEPWGASTTLMEQISQGTYNMREREEILGMIFRRLTEK 79

Query: 67  -GKYWRHVAKSLTVLDYLVRFGSENCVLWCKENLYIIKTLREFRHEDEVSGSDEGQIIRV 125
               WR + K+L +LDYL+R  SE  +   + ++ +IK L  F + D   G D+G  +R 
Sbjct: 80  RANEWRQIYKALQLLDYLIRHASERFIDDTRSSISLIKMLESFHYIDS-QGRDQGINVRN 138

Query: 126 KAKELTSL 133
           +AK L  L
Sbjct: 139 RAKALAEL 146

>Kpol_1001.2 s1001 (8057..9313) [1257 bp, 418 aa] {ON} (8057..9313)
           [1257 nt, 419 aa]
          Length = 418

 Score = 80.9 bits (198), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 44/128 (34%), Positives = 75/128 (58%), Gaps = 2/128 (1%)

Query: 7   RSAKNMVKGYSSTQVMVRDATANDSTSPSVGVLEDLADKTYDTVEFFEIMDMLDKRLNDK 66
           R A+N++  Y+  +  VR+AT N+    S  ++E ++  TY+  E  EI+ M+ +R  +K
Sbjct: 20  RKAQNVMFNYTEMEGKVREATNNEPWGASSTLMEQISQGTYNIREREEILSMIFRRFTEK 79

Query: 67  -GKYWRHVAKSLTVLDYLVRFGSENCVLWCKENLYIIKTLREFRHEDEVSGSDEGQIIRV 125
               WR + K+L +L+YL++ GSE  +   + +L +IK L  F + D   G D+G  +R 
Sbjct: 80  TASEWRQIYKALQLLEYLIKHGSERFIDDVRSSLSLIKMLESFHYIDS-QGRDQGINVRN 138

Query: 126 KAKELTSL 133
           KA+ LT+L
Sbjct: 139 KAQSLTAL 146

>KAFR0B06740 Chr2 (1406075..1407274) [1200 bp, 399 aa] {ON}
           Anc_4.346 YJR125C
          Length = 399

 Score = 80.5 bits (197), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 47/128 (36%), Positives = 74/128 (57%), Gaps = 2/128 (1%)

Query: 7   RSAKNMVKGYSSTQVMVRDATANDSTSPSVGVLEDLADKTYDTVEFFEIMDMLDKRLNDK 66
           R A+N+V  Y+  +  VR+AT N+    S  ++E +A  TY+  E  EI+ M+ +R  +K
Sbjct: 20  RKAQNVVFNYTEMEGKVREATNNEPWGASSTLMEQIAQGTYNLREREEILGMIFRRFTEK 79

Query: 67  -GKYWRHVAKSLTVLDYLVRFGSENCVLWCKENLYIIKTLREFRHEDEVSGSDEGQIIRV 125
            G  WR + KSL +LDYL+R GSE  +   + ++ +I+ L  F + D   G D+G  +R 
Sbjct: 80  AGSEWRQIYKSLQLLDYLIRRGSERFIDDVRSSIRLIELLETFHYIDS-QGRDQGINVRN 138

Query: 126 KAKELTSL 133
           +AK L  L
Sbjct: 139 RAKALGEL 146

>Suva_12.216 Chr12 complement(334254..335486) [1233 bp, 410 aa] {ON}
           YJR125C (REAL)
          Length = 410

 Score = 79.3 bits (194), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 43/128 (33%), Positives = 73/128 (57%), Gaps = 2/128 (1%)

Query: 7   RSAKNMVKGYSSTQVMVRDATANDSTSPSVGVLEDLADKTYDTVEFFEIMDMLDKRLNDK 66
           R A+N+V  Y+  +  VR+AT N+    S  +++ ++  TY+  E  EI+ M+ +R  +K
Sbjct: 20  RKAQNVVFNYTEMEGKVREATNNEPWGASSTLMDQISQGTYNFREREEILSMIFRRFTEK 79

Query: 67  -GKYWRHVAKSLTVLDYLVRFGSENCVLWCKENLYIIKTLREFRHEDEVSGSDEGQIIRV 125
            G  WR + K+L +LDYL++ GSE  +   + ++ +IK L  F + D   G D+G  +R 
Sbjct: 80  AGSEWRQIYKALQLLDYLIKHGSERFIDDTRSSINLIKILESFHYTDS-QGRDQGINVRT 138

Query: 126 KAKELTSL 133
           + K L  L
Sbjct: 139 RVKALVEL 146

>ZYRO0B14784g Chr2 complement(1205944..1207218) [1275 bp, 424 aa]
           {ON} similar to uniprot|P47160 Saccharomyces cerevisiae
           YJR125C ENT3 Protein containing an N-terminal epsin-like
           domain involved in clathrin recruitment and traffic
           between the Golgi and endosomes associates with the
           clathrin adaptor Gga2p
          Length = 424

 Score = 79.3 bits (194), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 44/128 (34%), Positives = 74/128 (57%), Gaps = 2/128 (1%)

Query: 7   RSAKNMVKGYSSTQVMVRDATANDSTSPSVGVLEDLADKTYDTVEFFEIMDMLDKRLNDK 66
           R A+N+V  Y+  +  VR+AT N+    S  ++E +A  TY+  E  EI+ M+ +R  +K
Sbjct: 55  RKAQNVVFNYTEMEAKVREATNNEPWGTSSTLMEYIAQGTYNLREREEILGMIFRRFTEK 114

Query: 67  -GKYWRHVAKSLTVLDYLVRFGSENCVLWCKENLYIIKTLREFRHEDEVSGSDEGQIIRV 125
               WR + K+L +L+YL++ GSE  +   + ++ ++K L  F + D   G D+G  +R 
Sbjct: 115 TANEWRQIYKALQLLEYLIKHGSERFIDDTRCSISLLKMLESFHYVDS-QGRDQGINVRT 173

Query: 126 KAKELTSL 133
           +AK LT L
Sbjct: 174 RAKALTEL 181

>NCAS0A06210 Chr1 complement(1229758..1231029) [1272 bp, 423 aa]
           {ON} Anc_4.346
          Length = 423

 Score = 78.6 bits (192), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 43/128 (33%), Positives = 73/128 (57%), Gaps = 2/128 (1%)

Query: 7   RSAKNMVKGYSSTQVMVRDATANDSTSPSVGVLEDLADKTYDTVEFFEIMDMLDKRLNDK 66
           R A+N+V  Y+  +  VR+AT N+    S  ++E +A  TY+  E  EI+ M+ +R  +K
Sbjct: 20  RKAQNVVFNYTEMEGKVREATNNEPWGASSTLMEQIAQGTYNIREREEILSMIFRRFTEK 79

Query: 67  -GKYWRHVAKSLTVLDYLVRFGSENCVLWCKENLYIIKTLREFRHEDEVSGSDEGQIIRV 125
            G  WR + K+L +LDYL++ GSE  +   + ++ ++K L+ F + D   G D+G  +R 
Sbjct: 80  TGSEWRQIYKALQLLDYLIKHGSEKFIDDVRSSVAVLKLLQTFHYID-AEGRDQGINVRN 138

Query: 126 KAKELTSL 133
           +   L  L
Sbjct: 139 RVTTLIEL 146

>Skud_10.349 Chr10 complement(613398..614630) [1233 bp, 410 aa] {ON}
           YJR125C (REAL)
          Length = 410

 Score = 77.4 bits (189), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 43/128 (33%), Positives = 73/128 (57%), Gaps = 2/128 (1%)

Query: 7   RSAKNMVKGYSSTQVMVRDATANDSTSPSVGVLEDLADKTYDTVEFFEIMDMLDKRLNDK 66
           R A+N+V  Y+  +  VR+AT N+    S  +++ ++  TY+  E  EI+ M+ +R  +K
Sbjct: 20  RKAQNVVFNYTEMEGKVREATNNEPWGASSTLMDQISQGTYNFREREEILSMIFRRFTEK 79

Query: 67  -GKYWRHVAKSLTVLDYLVRFGSENCVLWCKENLYIIKTLREFRHEDEVSGSDEGQIIRV 125
            G  WR + K+L +LDYL++ GSE  +   + ++ +IK L  F + D   G D+G  +R 
Sbjct: 80  AGSEWRQIYKALQLLDYLIKHGSERFIDDTRSSINLIKILETFHYIDS-QGRDQGINVRT 138

Query: 126 KAKELTSL 133
           + K L  L
Sbjct: 139 RVKTLIEL 146

>YJR125C Chr10 complement(654737..655963) [1227 bp, 408 aa] {ON}
           ENT3Protein containing an N-terminal epsin-like domain
           involved in clathrin recruitment and traffic between the
           Golgi and endosomes; associates with the clathrin
           adaptor Gga2p
          Length = 408

 Score = 77.4 bits (189), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 42/128 (32%), Positives = 73/128 (57%), Gaps = 2/128 (1%)

Query: 7   RSAKNMVKGYSSTQVMVRDATANDSTSPSVGVLEDLADKTYDTVEFFEIMDMLDKRLNDK 66
           R A+N+V  Y+  +  VR+AT N+    S  +++ ++  TY+  E  EI+ M+ +R  +K
Sbjct: 20  RKAQNVVFNYTEMEGKVREATNNEPWGASSTLMDQISQGTYNFREREEILSMIFRRFTEK 79

Query: 67  -GKYWRHVAKSLTVLDYLVRFGSENCVLWCKENLYIIKTLREFRHEDEVSGSDEGQIIRV 125
            G  WR + K+L +LDYL++ GSE  +   + ++ +I+ L  F + D   G D+G  +R 
Sbjct: 80  AGSEWRQIYKALQLLDYLIKHGSERFIDDTRNSINLIRILETFHYIDS-QGRDQGINVRT 138

Query: 126 KAKELTSL 133
           + K L  L
Sbjct: 139 RVKALIEL 146

>Smik_10.418 Chr10 complement(643833..645062) [1230 bp, 409 aa] {ON}
           YJR125C (REAL)
          Length = 409

 Score = 77.0 bits (188), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 42/128 (32%), Positives = 73/128 (57%), Gaps = 2/128 (1%)

Query: 7   RSAKNMVKGYSSTQVMVRDATANDSTSPSVGVLEDLADKTYDTVEFFEIMDMLDKRLNDK 66
           R A+N+V  Y+  +  VR+AT N+    S  +++ ++  TY+  E  EI+ M+ +R  +K
Sbjct: 20  RKAQNVVFNYTEMEGKVREATNNEPWGASSTLMDQISQGTYNFREREEILSMIFRRFTEK 79

Query: 67  -GKYWRHVAKSLTVLDYLVRFGSENCVLWCKENLYIIKTLREFRHEDEVSGSDEGQIIRV 125
            G  WR + K+L +LDYL++ GSE  +   + ++ +I+ L  F + D   G D+G  +R 
Sbjct: 80  AGSEWRQIYKALQLLDYLIKHGSERFIDDTRNSINLIRILETFHYIDS-QGRDQGINVRT 138

Query: 126 KAKELTSL 133
           + K L  L
Sbjct: 139 RVKALIDL 146

>CAGL0H04323g Chr8 (407884..409122) [1239 bp, 412 aa] {ON} similar
           to uniprot|P47160 Saccharomyces cerevisiae YJR125c ENT3
           cytoskeletal adaptor
          Length = 412

 Score = 75.9 bits (185), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 41/119 (34%), Positives = 69/119 (57%), Gaps = 2/119 (1%)

Query: 7   RSAKNMVKGYSSTQVMVRDATANDSTSPSVGVLEDLADKTYDTVEFFEIMDMLDKRLNDK 66
           R A+N+V  Y+  +  VR+AT N+    S  ++E +A  TY+  E  EI+ M+ +R  +K
Sbjct: 20  RKAQNVVYNYTDMESKVREATNNEPWGASSTLMEQIAQGTYNIREREEILGMIFRRFTEK 79

Query: 67  -GKYWRHVAKSLTVLDYLVRFGSENCVLWCKENLYIIKTLREFRHEDEVSGSDEGQIIR 124
            G  WR + K+L +L+YL++ GSE  +   + ++ I+K L  F + D   G D+G  +R
Sbjct: 80  SGSEWRQIYKALQLLEYLIKHGSERFIDDTRNSISIVKLLESFHYIDS-QGRDQGVNVR 137

>AER155C Chr5 complement(929042..930136) [1095 bp, 364 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJR125C
           (ENT3)
          Length = 364

 Score = 74.7 bits (182), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 43/128 (33%), Positives = 71/128 (55%), Gaps = 2/128 (1%)

Query: 7   RSAKNMVKGYSSTQVMVRDATANDSTSPSVGVLEDLADKTYDTVEFFEIMDMLDKRLNDK 66
           R A+N++  Y+  +  VR+AT N+    S  ++  +A  TY+  E  EI+ M+ +R  +K
Sbjct: 20  RKAQNVMLNYTGMEAKVREATNNEPWGASSTLMTQIAQGTYNFREREEILAMILRRFLEK 79

Query: 67  -GKYWRHVAKSLTVLDYLVRFGSENCVLWCKENLYIIKTLREFRHEDEVSGSDEGQIIRV 125
               WR + KS+ +L+YLV+ GSE  +   + NL +I+ L  F + D   G D+G  +R 
Sbjct: 80  SANEWRQIYKSMQLLEYLVKHGSERFIDDVRSNLNLIRMLETFHYIDS-QGRDQGINVRN 138

Query: 126 KAKELTSL 133
           + K L  L
Sbjct: 139 RTKALVKL 146

>TPHA0B00400 Chr2 (83356..84555) [1200 bp, 399 aa] {ON} Anc_4.346
           YJR125C
          Length = 399

 Score = 74.7 bits (182), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 42/128 (32%), Positives = 72/128 (56%), Gaps = 2/128 (1%)

Query: 7   RSAKNMVKGYSSTQVMVRDATANDSTSPSVGVLEDLADKTYDTVEFFEIMDMLDKRLNDK 66
           R A+N++  Y+  +  VR+AT N+    S  +++ +A  TY+  E  EI+ M+ +R  +K
Sbjct: 20  RKAQNVMFNYTDMEAKVREATNNEPWGASSTLMKQIAQGTYNIREREEILGMVFRRYTEK 79

Query: 67  -GKYWRHVAKSLTVLDYLVRFGSENCVLWCKENLYIIKTLREFRHEDEVSGSDEGQIIRV 125
               WR + KSL + DYL++ GSE  +   + ++ +IK L  F + D   G D+G  +R 
Sbjct: 80  TASEWRQIYKSLQLTDYLIKHGSERFIDDVRTSISLIKMLESFHYIDS-QGRDQGINVRN 138

Query: 126 KAKELTSL 133
           KA+ L + 
Sbjct: 139 KAQSLVAF 146

>Ecym_1133 Chr1 (274069..275247) [1179 bp, 392 aa] {ON} similar to
           Ashbya gossypii AER155C
          Length = 392

 Score = 72.0 bits (175), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 42/128 (32%), Positives = 69/128 (53%), Gaps = 2/128 (1%)

Query: 7   RSAKNMVKGYSSTQVMVRDATANDSTSPSVGVLEDLADKTYDTVEFFEIMDMLDKRLNDK 66
           R A+N+V  Y+  +  VR+AT N+S      ++  +A  TY+  E  EI+ M+ +R  +K
Sbjct: 20  RKAQNVVFNYTGMEAKVREATNNESWGAPSSLMAQIAQGTYNYRERKEILGMIFRRFVEK 79

Query: 67  -GKYWRHVAKSLTVLDYLVRFGSENCVLWCKENLYIIKTLREFRHEDEVSGSDEGQIIRV 125
               WR + KS+ +L+YL+  GSE  +   +  L +IK L  F + D   G D+G  +R 
Sbjct: 80  TASEWRQIYKSVQLLEYLIYHGSEGFIDDVRSGLNLIKMLESFHYIDS-QGRDQGINVRN 138

Query: 126 KAKELTSL 133
           + + L  L
Sbjct: 139 RTQALVQL 146

>SAKL0H25762g Chr8 (2256842..2257630) [789 bp, 262 aa] {ON} some
           similarities with uniprot|Q07872 Saccharomyces
           cerevisiae YLL038C ENT4 Protein of unknown function
           contains an N-terminal epsin-like domain
          Length = 262

 Score = 65.5 bits (158), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 39/112 (34%), Positives = 64/112 (57%), Gaps = 12/112 (10%)

Query: 5   LVRSAKNMVKGYSSTQVMVRDATANDSTSPSVGVL-EDLADKTYDTVEFFEIMDMLDKRL 63
            +RS +NM  G S+T+V V+ AT +D  S + G L  +++  TY      EI  ++ +RL
Sbjct: 3   FIRSVRNM--GQSTTEVKVKKATDDDEYSGATGALMNEISVLTYSAKTLREITQVIHRRL 60

Query: 64  NDKGKYWR-------HVAKSLTVLDYLVRFGSENCVLWCKENLYIIKTLREF 108
           +  G Y +       H+ K+LT++ YL+  GS + V W ++  Y++ TLREF
Sbjct: 61  S--GNYRKSSHRNAVHILKTLTLISYLINNGSNDFVSWIRQYAYLVDTLREF 110

>Kwal_55.20611 s55 complement(489968..490732) [765 bp, 254 aa] {ON}
           YLL038C (ENT4) - Ent4p [contig 144] FULL
          Length = 254

 Score = 62.4 bits (150), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 37/110 (33%), Positives = 65/110 (59%), Gaps = 8/110 (7%)

Query: 5   LVRSAKNMVKGYSSTQVMVRDATANDSTSPSVG-VLEDLADKTYDTVEFFEIMDMLDKRL 63
           L+++ +N+  G SST+V  R+AT +D  + + G ++ +L+  TY      EI  ++ KRL
Sbjct: 3   LLKTVRNI--GQSSTEVKTRNATNDDEHNGATGSLMNELSVLTYSPRTLREITQVIRKRL 60

Query: 64  NDKGKYWRH-----VAKSLTVLDYLVRFGSENCVLWCKENLYIIKTLREF 108
           +   +   H     + K+LT++ YL+  GS+  V+W +  LY+I TL+EF
Sbjct: 61  SGNSRMSSHKNAVHLLKTLTLIAYLINNGSDEFVVWIRSYLYLIDTLKEF 110

>TDEL0G01740 Chr7 (342371..343144) [774 bp, 257 aa] {ON} Anc_4.17
           YLL038C
          Length = 257

 Score = 58.9 bits (141), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 44/141 (31%), Positives = 79/141 (56%), Gaps = 15/141 (10%)

Query: 1   MPSQLVRSAKNMVKGYSSTQVMVRDATANDSTSPSVGVL-EDLADKTYDTVEFFEIMDML 59
           MP  L+ S + +V+  S+T++ V+ AT  + +S + G L  +++  TY      EI+ ++
Sbjct: 1   MP--LLDSVRTLVQ--STTELKVKQATDENESSGATGTLMNEISVLTYSPKTLKEIVQVV 56

Query: 60  DKRLNDKG-----KYWRHVAKSLTVLDYLVRFGSENCVLWCKENLYIIKTLREFRHEDEV 114
            KRL   G     K   H+ K+LT++ YL+  GS + + W + N+ ++  L+EF  +D  
Sbjct: 57  RKRLMGHGRRNSHKICIHLVKTLTLVTYLMNNGSNDFIAWVRGNMALVDCLKEFNVQDR- 115

Query: 115 SGSDE--GQIIRVKAKELTSL 133
             +DE  GQ IR  +++L +L
Sbjct: 116 --NDEKIGQQIRAMSQDLCTL 134

>Kpol_388.5 s388 complement(17825..18631) [807 bp, 268 aa] {ON}
           complement(17825..18631) [807 nt, 269 aa]
          Length = 268

 Score = 58.5 bits (140), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 38/121 (31%), Positives = 67/121 (55%), Gaps = 12/121 (9%)

Query: 1   MPSQLVRSAKNMVKGYSSTQVMVRDATANDSTSPSVGVL-EDLADKTYDTVEFFEIMDML 59
           MP  +  S +N V+  S+T+  V++AT ++ TS + G L  +++  TY      EI+ +L
Sbjct: 1   MP--IFDSVRNFVQ--SATEAKVKEATDDNETSGATGTLMNEISVLTYSPKTLKEIIQVL 56

Query: 60  DKRLNDKGKY-----WRHVAKSLTVLDYLVRFGSENCVLWCKENLYIIKTLREFR--HED 112
            KRL    K        H+ K++T++ YL+  GS + + W + N+ I + L++F   HED
Sbjct: 57  KKRLTGSSKKSSHRNCVHILKTMTLISYLINNGSNDFIAWARSNIMIFEVLKDFEVIHED 116

Query: 113 E 113
           +
Sbjct: 117 D 117

>TPHA0F00230 Chr6 complement(43589..44431) [843 bp, 280 aa] {ON}
           Anc_4.17 YLL038C
          Length = 280

 Score = 55.5 bits (132), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 42/125 (33%), Positives = 65/125 (52%), Gaps = 13/125 (10%)

Query: 1   MPSQLVRSAKNMVKGYSSTQVMVRDATANDSTSPSVGVL-EDLADKTYDTVEFFEIMDML 59
           MP  L  S +N V+  S T+  VR AT +D TS + G L  +++  TY      EI+ +L
Sbjct: 1   MP--LFDSVRNFVQ--SPTESKVRQATDDDETSGATGTLMNEISVLTYSPKTLKEIVQIL 56

Query: 60  DKRL-----NDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCKENLYIIKTLREFR---HE 111
            KRL      +  K   H+ K+LT++ YL+  GS + + W + N+ + + L+ F     E
Sbjct: 57  KKRLTGYSKKNSHKNCVHILKTLTLITYLINNGSNDFIAWTRSNIMLFEYLKNFEVQNLE 116

Query: 112 DEVSG 116
           DE  G
Sbjct: 117 DEKMG 121

>TBLA0G00650 Chr7 (140678..141949) [1272 bp, 423 aa] {ON} Anc_4.17
           YLL038C
          Length = 423

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 39/128 (30%), Positives = 66/128 (51%), Gaps = 10/128 (7%)

Query: 5   LVRSAKNMVKGYSSTQVMVRDATANDSTSPSVGVL-EDLADKTYDTVEFFEIMDMLDKRL 63
           +  S +N V+  S T++ VR AT ++  S + G L  +++  TY T    EI+ +L KRL
Sbjct: 3   IFESVRNFVQ--SPTELKVRTATDDNENSGATGTLMNEISVLTYSTKTNKEIVTVLKKRL 60

Query: 64  NDKGKYWRH-----VAKSLTVLDYLVRFGSENCVLWCKENLYIIKTLREFRHEDEVSGSD 118
              GK   H     + K+LT++ YL+  GS   + W  EN  + + ++ F   D +   D
Sbjct: 61  TGYGKKSSHRNCIHIIKTLTLIAYLMNNGSLEFIRWINENQLLFEVMKNFEVSDTI--HD 118

Query: 119 EGQIIRVK 126
           E   I+++
Sbjct: 119 EKFAIQIR 126

>TBLA0B06220 Chr2 (1466908..1467927) [1020 bp, 339 aa] {ON}
           Anc_4.346 YJR125C
          Length = 339

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 36/111 (32%), Positives = 58/111 (52%), Gaps = 1/111 (0%)

Query: 4   QLVRSAKNMVKGYSSTQVMVRDATANDSTSPSVGVLEDLADKTYDTVEFFEIMDMLDKRL 63
           +  R A+N +   +  +  VR+AT ND    SV ++  +   T++  +  +I++ML  R 
Sbjct: 17  KFFRMAENFLFNLTDMESKVREATNNDPWGTSVILMAQINAGTFEINQRADIINMLLNRF 76

Query: 64  NDK-GKYWRHVAKSLTVLDYLVRFGSENCVLWCKENLYIIKTLREFRHEDE 113
            +K G  WR + KS+ +L YL+  GS   V   K NL +IK L  F   D+
Sbjct: 77  LEKNGSQWRQIYKSVLLLQYLLINGSTEFVSEVKLNLTLIKNLMLFEFIDD 127

>KLTH0E05874g Chr5 complement(530814..531581) [768 bp, 255 aa] {ON}
           similar to uniprot|Q07872 Saccharomyces cerevisiae
           YLL038C ENT4 Protein of unknown function contains an N-
           terminal epsin-like domain
          Length = 255

 Score = 52.8 bits (125), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 34/110 (30%), Positives = 62/110 (56%), Gaps = 8/110 (7%)

Query: 5   LVRSAKNMVKGYSSTQVMVRDATANDSTSPSVG-VLEDLADKTYDTVEFFEIMDMLDKRL 63
           L+R+ ++   G S T++  ++AT +D  S + G ++ +++  TY +    EI  ++ KRL
Sbjct: 3   LLRTVRSF--GQSQTEIKTKNATNDDEYSGATGSLMNEISVLTYSSRTLREITAVVRKRL 60

Query: 64  ---NDKGKYWR--HVAKSLTVLDYLVRFGSENCVLWCKENLYIIKTLREF 108
              N K  +    H+ K+LT+  YL+  GS   V W +  +Y+I +L+EF
Sbjct: 61  SGNNRKSSHKNAVHILKTLTLTAYLINNGSNEFVAWIRSYVYLIDSLKEF 110

>Ecym_8407 Chr8 (843359..844123) [765 bp, 254 aa] {ON} similar to
           Ashbya gossypii ACL061C
          Length = 254

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 33/104 (31%), Positives = 56/104 (53%), Gaps = 6/104 (5%)

Query: 15  GYSSTQVMVRDATANDSTSPSVG-VLEDLADKTYDTVEFFEIMDMLDKRL-----NDKGK 68
           G SST V V+ AT +   + + G ++ ++A  TY      EI  +L KRL         K
Sbjct: 11  GSSSTTVKVKKATDDSEHNGAYGSLMNEIAILTYSPNTLREITQVLKKRLVGNYKKTPSK 70

Query: 69  YWRHVAKSLTVLDYLVRFGSENCVLWCKENLYIIKTLREFRHED 112
              ++ K+LT++ +LV  GSE C+ W + +L +I++ ++F   D
Sbjct: 71  RAVNLLKTLTLIRFLVINGSEECIAWLRRHLVLIRSFQDFTLRD 114

>ZYRO0G07876g Chr7 complement(636468..637247) [780 bp, 259 aa] {ON}
           similar to uniprot|Q07872 Saccharomyces cerevisiae
           YLL038C ENT4 Protein of unknown function contains an N-
           terminal epsin-like domain
          Length = 259

 Score = 51.6 bits (122), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 34/100 (34%), Positives = 53/100 (53%), Gaps = 6/100 (6%)

Query: 13  VKGYSSTQVMVRDATANDSTSPSVGVL-EDLADKTYDTVEFFEIMDMLDKRLNDKGKYWR 71
           V G SST++ VR AT  D  + + G L  +++  TY      EI  +L +RL+  G+   
Sbjct: 9   VFGPSSTELKVRKATNEDEKTGATGTLMNEISVLTYSPKTVREITQVLKRRLSSYGRRTS 68

Query: 72  H-----VAKSLTVLDYLVRFGSENCVLWCKENLYIIKTLR 106
           H     + K+LT++ YL+  GSE  V W + NL   + L+
Sbjct: 69  HKNSIHIVKALTLILYLINNGSEEFVAWVRGNLIYFECLK 108

>KLLA0D03949g Chr4 (333566..334243) [678 bp, 225 aa] {ON} similar to
           uniprot|Q07872 Saccharomyces cerevisiae YLL038C ENT4
           Protein of unknown function contains an N- terminal
           epsin- like domain
          Length = 225

 Score = 50.4 bits (119), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 35/116 (30%), Positives = 63/116 (54%), Gaps = 8/116 (6%)

Query: 15  GYSSTQVMVRDAT-ANDSTSPSVGVLEDLADKTYDTVEFFEIMDMLDKRLNDKGKYWR-- 71
           G S+TQ+ V+ AT +N+S   +  ++ +L+  TY      EI +++ KRL +     +  
Sbjct: 11  GQSTTQLKVKQATDSNESYGATGTLMNELSVLTYSEKSANEIYEVIRKRLMNGSSRLKNS 70

Query: 72  -----HVAKSLTVLDYLVRFGSENCVLWCKENLYIIKTLREFRHEDEVSGSDEGQI 122
                 V K+LT+++YL+  GSE  VLW + +L  I+ L+++   ++   S   QI
Sbjct: 71  HDSVVQVLKTLTLIEYLLYNGSEEFVLWMRRHLAYIEALKDYHCSNDKDKSKVKQI 126

>Suva_10.35 Chr10 complement(70188..70931) [744 bp, 247 aa] {ON}
           YLL038C (REAL)
          Length = 247

 Score = 50.4 bits (119), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 37/124 (29%), Positives = 63/124 (50%), Gaps = 8/124 (6%)

Query: 17  SSTQVMVRDATANDSTSPSVGVL-EDLADKTYDTVEFFEIMDMLDKRL------NDKGKY 69
           S T+  V+ AT+ D TS + G L  +++  TY      EI+ ++ KRL       +  + 
Sbjct: 13  SPTESKVKQATSEDETSGATGTLMNEISILTYSPKTVREIIQIVRKRLLLGQNRRNSHRS 72

Query: 70  WRHVAKSLTVLDYLVRFGSENCVLWCKENLYIIKTLREFRHEDEVSGSDEGQIIRVKAKE 129
              V K+LT++ YL+  GS   + W K N+ +I+ L +F+ +D       G+ IR  ++ 
Sbjct: 73  CIQVMKTLTLVSYLMNNGSNEFIKWLKGNMILIEILEDFQAQD-ARDDRNGEEIRKLSRN 131

Query: 130 LTSL 133
           L  L
Sbjct: 132 LHEL 135

>CAGL0E03806g Chr5 (356594..357376) [783 bp, 260 aa] {ON} similar to
           uniprot|Q07872 Saccharomyces cerevisiae YLL038c ENT4
          Length = 260

 Score = 49.3 bits (116), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 34/121 (28%), Positives = 66/121 (54%), Gaps = 11/121 (9%)

Query: 14  KGY--SSTQVMVRDATANDSTSPSVGVL-EDLADKTYDTVEFFEIMDMLDKRLN-----D 65
           KG+  S T++ VR AT ++  + + G L  +++  TY      +++ ++ KRL+     +
Sbjct: 8   KGFLLSPTELKVRQATDDNELAGATGTLMNEISVLTYSKKTLKDVIQVIRKRLSGVNKRN 67

Query: 66  KGKYWRHVAKSLTVLDYLVRFGSENCVLWCKENLYIIKTLREFRHEDEVSGSDEGQIIRV 125
             +   HV K+LT++ YL+  GS + + W K + Y+I+ L  F  +   S SDE  + ++
Sbjct: 68  SHRTCLHVLKTLTLVSYLLNNGSNDFIAWLKSSKYVIEYLSSFEAQ---SSSDEPMVNQI 124

Query: 126 K 126
           +
Sbjct: 125 R 125

>Skud_12.30 Chr12 complement(56967..57710) [744 bp, 247 aa] {ON}
           YLL038C (REAL)
          Length = 247

 Score = 49.3 bits (116), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 38/124 (30%), Positives = 63/124 (50%), Gaps = 8/124 (6%)

Query: 17  SSTQVMVRDATANDSTSPSVGVL-EDLADKTYDTVEFFEIMDMLDKRL----NDKGKYWR 71
           S T+  V+ AT+ D TS + G L  +++  TY      EI+ ++ KRL    N +  +  
Sbjct: 13  SPTESKVKQATSEDETSGATGTLMNEISILTYSPKTVREIIQVIRKRLLLGQNRRNSHRN 72

Query: 72  --HVAKSLTVLDYLVRFGSENCVLWCKENLYIIKTLREFRHEDEVSGSDEGQIIRVKAKE 129
              V K+LT++ YL+  GS   + W K N+ +I+ L  F H  +V    + + IR  ++ 
Sbjct: 73  CIQVMKTLTLVSYLMNNGSNEFIKWLKGNMILIEILENF-HIQDVRDERKREEIRKLSRN 131

Query: 130 LTSL 133
           L  L
Sbjct: 132 LLEL 135

>YLL038C Chr12 complement(65775..66518) [744 bp, 247 aa] {ON}
           ENT4Protein of unknown function, contains an N-terminal
           epsin-like domain; proposed to be involved in the
           trafficking of Arn1p in the absence of ferrichrome
          Length = 247

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 33/103 (32%), Positives = 55/103 (53%), Gaps = 7/103 (6%)

Query: 17  SSTQVMVRDATANDSTSPSVGVL-EDLADKTYDTVEFFEIMDMLDKRL----NDKGKYWR 71
           S T+  V+ AT  D TS + G L  +++  TY      EI+ ++ KRL    N +  +  
Sbjct: 13  SPTESKVKQATNEDETSGATGTLMNEISILTYSPKTVREIIQVIRKRLLLGQNRRNSHRN 72

Query: 72  --HVAKSLTVLDYLVRFGSENCVLWCKENLYIIKTLREFRHED 112
              V K+LT++ YL+  GS   + W K N+ +I+ L +F+ +D
Sbjct: 73  CIQVMKTLTLVSYLMNNGSNEFIKWLKGNMILIEILEDFQVQD 115

>Smik_12.19 Chr12 complement(50134..50877) [744 bp, 247 aa] {ON}
           YLL038C (REAL)
          Length = 247

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 32/103 (31%), Positives = 55/103 (53%), Gaps = 7/103 (6%)

Query: 17  SSTQVMVRDATANDSTSPSVGVL-EDLADKTYDTVEFFEIMDMLDKRL----NDKGKYWR 71
           S T+  V+ AT  D TS + G L  +++  TY      EI+ ++ KRL    N +  +  
Sbjct: 13  SPTESKVKQATNEDETSGATGTLMNEISILTYSPKTVREIIQVVRKRLLLGQNRRNSHRN 72

Query: 72  --HVAKSLTVLDYLVRFGSENCVLWCKENLYIIKTLREFRHED 112
              V K+LT++ YL+  GS   + W K N+ +++ L +F+ +D
Sbjct: 73  CIQVMKTLTLVSYLMNNGSNEFIKWLKSNMILVEILEDFQVQD 115

>ACL061C Chr3 complement(256803..257507) [705 bp, 234 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLL038C
           (ENT4)
          Length = 234

 Score = 47.0 bits (110), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 32/114 (28%), Positives = 54/114 (47%), Gaps = 6/114 (5%)

Query: 15  GYSSTQVMVRDATA-NDSTSPSVGVLEDLADKTYDTVEFFEIMDMLDKRLNDKG-----K 68
           G S T   VR AT  N+    S  ++ ++   TY      ++  +L KRL+        K
Sbjct: 11  GSSPTAAKVRKATDDNEFVGASSALISEITILTYSCKTLLDVTRVLKKRLSGNANKSSHK 70

Query: 69  YWRHVAKSLTVLDYLVRFGSENCVLWCKENLYIIKTLREFRHEDEVSGSDEGQI 122
              H+ K+LT+ +YL+  GSE+ V W +    +++ L++F   +E       QI
Sbjct: 71  NAVHILKALTLTNYLIANGSEDFVQWLQGCAVLLRRLKDFTTGNERDSHMASQI 124

>NDAI0H00280 Chr8 complement(48177..49109) [933 bp, 310 aa] {ON}
           Anc_4.17 YLL038C
          Length = 310

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 39/145 (26%), Positives = 76/145 (52%), Gaps = 16/145 (11%)

Query: 1   MPSQLVRSAKNMVKGYSSTQVMVRDATANDSTSPSVGVL-EDLADKTYDTVEFFEIMDML 59
           MP  L  + KN V+  + T+  V+ AT ++ T+ + G L  +++  TY      +I+ ++
Sbjct: 1   MP--LFDTVKNFVQ--TPTESKVKQATDDNETTGATGTLMNEISVLTYSPKTLKDIIQVI 56

Query: 60  DKRLND---KGKYWRH-----VAKSLTVLDYLVRFGSENCVLWCKENLYIIKTLRE---F 108
            KRL+      K   H     + K+LT++ YL+  GS   + W + N Y+++ + +   F
Sbjct: 57  KKRLSSATSSNKKLSHKTSVYIIKTLTLISYLINNGSNEFIEWLRLNFYLVENITKKCNF 116

Query: 109 RHEDEVSGSDEGQIIRVKAKELTSL 133
           + +D  + S     I+V A+++T+L
Sbjct: 117 QLQDNSADSKMIGQIKVIAEDMTNL 141

>NCAS0C05840 Chr3 (1202292..1203095) [804 bp, 267 aa] {ON} Anc_4.17
           YLL038C
          Length = 267

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 35/111 (31%), Positives = 55/111 (49%), Gaps = 10/111 (9%)

Query: 1   MPSQLVRSAKNMVKGYSSTQVMVRDATANDSTSPSVGVL-EDLADKTYDTVEFFEIMDML 59
           MP  L  + K+ V+  S T+  V+ AT  D T  + G L  +++  TY      EI+ +L
Sbjct: 1   MP--LFETVKSFVQ--SPTESKVKQATNEDETMGATGTLMNEISVLTYSPKTLKEIVQVL 56

Query: 60  DKRLNDKGKYWRH-----VAKSLTVLDYLVRFGSENCVLWCKENLYIIKTL 105
            KRL+   +   H     + K+LT++ YL+  GS   V W + N  +I  L
Sbjct: 57  KKRLSGYSRKTSHKNCIFIIKTLTLMAYLINNGSNEFVAWIRNNSSLISNL 107

>YHR161C Chr8 complement(420373..422286) [1914 bp, 637 aa] {ON}
           YAP1801Protein involved in clathrin cage assembly; binds
           Pan1p and clathrin; homologous to Yap1802p, member of
           the AP180 protein family
          Length = 637

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 31/98 (31%), Positives = 49/98 (50%), Gaps = 10/98 (10%)

Query: 22  MVRDATANDSTSPSVGVLEDLADKTYDTVEFFEIMDMLDKRLNDKGKYWRHVAKSLTVLD 81
           +V+ AT   S  P    L+ +   T +  +F+EI+  LD R+ND    W  V KSL V+ 
Sbjct: 7   LVKGATKIKSAPPKQKYLDPILLGTSNEEDFYEIVKGLDSRINDTA--WTIVYKSLLVVH 64

Query: 82  YLVRFGSENCVL-WCKENLYIIKTLREFRHEDEVSGSD 118
            ++R GS++  L +   NL       EF   + + GS+
Sbjct: 65  LMIREGSKDVALRYYSRNL-------EFFDIENIRGSN 95

>SAKL0H02530g Chr8 (250148..252157) [2010 bp, 669 aa] {ON} weakly
           similar to uniprot|P53309 Saccharomyces cerevisiae
           YGR241C YAP1802 Yeast Assembly Polypeptide, member of
           AP180 protein family, binds Pan1p and clathrin; member
           of clathrin assembly polypeptide AP180 family and weakly
           similar to uniprot|P38856 Saccharomyces cerevisiae
           YHR161C YAP1801 Yeast Assembly Polypeptide member of
           AP180 protein family binds Pan1p and clathrin clathrin
           assembly protein
          Length = 669

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 29/96 (30%), Positives = 46/96 (47%), Gaps = 4/96 (4%)

Query: 22  MVRDATANDSTSPSVGVLEDLADKTYDTVEFFEIMDMLDKRLNDKGKYWRHVAKSLTVLD 81
           +V+ AT      P    ++ +   T D+ EF EIM  L+ R+ND    W  V KSL V+ 
Sbjct: 7   LVKGATKIKMAPPKQKYIDPILLGTSDSSEFMEIMKALESRINDTA--WTIVYKSLIVIH 64

Query: 82  YLVRFGSENCVL-WCKENLYIIKTLREFRHEDEVSG 116
            ++R G  +  + +   +L   + LR+  H    SG
Sbjct: 65  LMMRDGDRDVTIKYLSHHLEFFQ-LRDVFHSKLSSG 99

>KAFR0I01460 Chr9 (304865..305692) [828 bp, 275 aa] {ON} Anc_4.17
           YLL038C
          Length = 275

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 37/136 (27%), Positives = 68/136 (50%), Gaps = 15/136 (11%)

Query: 8   SAKNMVKGYSSTQVMVRDATANDSTSPSVGVL-EDLADKTYDTVEFFEIMDMLDKRL--- 63
           S +N+V  YS T++ VR AT  +    S G L  +++  TY      EI+ +L K+L   
Sbjct: 6   SVRNLV--YSQTELKVRQATDENEIIRSTGTLMNEISVLTYSAKTLKEIIGILKKKLSLL 63

Query: 64  ----NDKG----KYWRHVAKSLTVLDYLVRFGSENCVLWCKENLYIIKTLREFRHEDEVS 115
               N  G    K    V K+ T++ YL+  GS + + W K N  +++ L +    + ++
Sbjct: 64  YGLKNGNGIISHKVCVQVLKTFTLISYLLNNGSNDFINWLKLNNGVLQILAKVDSNNHIT 123

Query: 116 GSDEGQIIRVKAKELT 131
             ++  I+  +A+++T
Sbjct: 124 DDEDLHILN-QAQKIT 138

>TBLA0H01210 Chr8 (269471..270946) [1476 bp, 491 aa] {ON} Anc_8.335
           YDR153C
          Length = 491

 Score = 41.2 bits (95), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 32/99 (32%), Positives = 45/99 (45%), Gaps = 22/99 (22%)

Query: 6   VRSAKNMVKGYSSTQVMVRDATANDSTSPSVGVLED-LADKTYDTVEFFEIMDMLDKRLN 64
            R A+NM+  Y   Q+ +R AT  DS  P+   L+  L D+  + V   +I+D + KRL 
Sbjct: 20  ARYAQNMIIAYEPYQIDIRQATNTDSWGPTKKHLDQILLDR--NKVPLRKIVDYIMKRLM 77

Query: 65  DK-------------------GKYWRHVAKSLTVLDYLV 84
           D                    G  WR V KSL VL +L+
Sbjct: 78  DHINTRPRNLYDRARKDYVNYGTEWRVVFKSLIVLKFLL 116

>ZYRO0F13684g Chr6 complement(1125731..1126954) [1224 bp, 407 aa]
           {ON} highly similar to uniprot|Q6Q5U2 Saccharomyces
           cerevisiae YDR153C ENT5 Protein containing an N-terminal
           epsin-like domain involved in clathrin recruitment and
           traffic between the Golgi and endosomes associates with
           the clathrin adaptor Gga2p clathrin adaptor complex AP-1
           and clathrin
          Length = 407

 Score = 40.8 bits (94), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 33/98 (33%), Positives = 42/98 (42%), Gaps = 20/98 (20%)

Query: 6   VRSAKNMVKGYSSTQVMVRDATANDSTSPSVGVLEDLADKTYDTVEFFEIMDMLDKRLND 65
            R A+NM+  Y   QV VR AT  DS  P+   LE +    Y  V  + I +   KRL D
Sbjct: 20  ARFAQNMIVQYEPYQVDVRRATNTDSWGPTPKHLEKVLRNRYQ-VPMYLITEYTLKRLID 78

Query: 66  K-------------------GKYWRHVAKSLTVLDYLV 84
                               G  WR V K LTV++YL+
Sbjct: 79  HIATRPKNFYEKARKEYVNYGSEWRVVLKCLTVVEYLL 116

>Skud_8.225 Chr8 complement(391820..393685) [1866 bp, 621 aa] {ON}
           YHR161C (REAL)
          Length = 621

 Score = 40.8 bits (94), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 27/88 (30%), Positives = 45/88 (51%), Gaps = 5/88 (5%)

Query: 22  MVRDATANDSTSPSVGVLEDLADKTYDTVEFFEIMDMLDKRLNDKGKYWRHVAKSLTVLD 81
           +V+ AT   S  P    L+ +   T    +F+EI+  LD R+ND    W  V K+L V+ 
Sbjct: 7   LVKGATKIKSAPPKQKYLDPILLATGSEEDFYEIVKALDSRVNDTA--WTIVYKTLLVVH 64

Query: 82  YLVRFGSENCVL-WCKENL--YIIKTLR 106
            ++R G ++  L +   NL  + I+ +R
Sbjct: 65  LMMREGKKDVALRYYSRNLEFFSIENIR 92

>Smik_8.245 Chr8 complement(397342..399225) [1884 bp, 627 aa] {ON}
           YHR161C (REAL)
          Length = 627

 Score = 40.0 bits (92), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 29/98 (29%), Positives = 48/98 (48%), Gaps = 10/98 (10%)

Query: 22  MVRDATANDSTSPSVGVLEDLADKTYDTVEFFEIMDMLDKRLNDKGKYWRHVAKSLTVLD 81
           +V+ AT   S  P    L+ +   T    +F+EI+  L+ R+ND    W  V KSL V+ 
Sbjct: 7   LVKGATKIKSAPPKQKYLDPILLGTSSEEDFYEIVKGLNFRINDTA--WTIVYKSLLVVH 64

Query: 82  YLVRFGSENCVL-WCKENLYIIKTLREFRHEDEVSGSD 118
            ++R G+++  L +   NL       EF   + + GS+
Sbjct: 65  LMIREGAKDVALRYYSRNL-------EFFDIENIRGSN 95

>NCAS0B03660 Chr2 complement(653627..654877) [1251 bp, 416 aa] {ON}
           Anc_8.335 YDR153C
          Length = 416

 Score = 37.7 bits (86), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 33/113 (29%), Positives = 47/113 (41%), Gaps = 24/113 (21%)

Query: 6   VRSAKNMVKGYSSTQVMVRDATANDSTSPSVGVLEDLADKTYDTVEFFEIMDMLDKRLND 65
            R A+N++  Y   QV +R AT  D+  P+   L  +    Y  V  + +++   KRL D
Sbjct: 20  ARFAQNVIVQYEPYQVDIRRATNTDAWGPTPKHLSKVLRNRY-QVPLYLMVEYTLKRLVD 78

Query: 66  K-------------------GKYWRHVAKSLTVLDYLVRFGSE----NCVLWC 95
                               G  WR V K L V+D+L+   SE    N VL C
Sbjct: 79  HIASRPKNFYEKARKEYVNYGAEWRVVLKCLVVIDFLILNVSEGDELNQVLSC 131

>KAFR0B05800 Chr2 complement(1200666..1201814) [1149 bp, 382 aa]
           {ON} Anc_8.335 YDR153C
          Length = 382

 Score = 37.7 bits (86), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 28/98 (28%), Positives = 43/98 (43%), Gaps = 20/98 (20%)

Query: 6   VRSAKNMVKGYSSTQVMVRDATANDSTSPSVGVLEDLADKTYDTVEFFEIMDMLDKRLND 65
            R A+N++  Y   Q+ VR AT  D+  P+   LE +    +  V  + + + + KRL D
Sbjct: 20  ARFAQNVIVQYEPYQIDVRRATNTDAWGPTTKHLEKVMRNRF-QVPMYLVTEYILKRLID 78

Query: 66  K-------------------GKYWRHVAKSLTVLDYLV 84
                               G  WR V K LTV++YL+
Sbjct: 79  HIATKPKNLYEKARKEYVNYGSEWRVVLKCLTVIEYLL 116

>Kpol_344.8 s344 complement(20765..21919) [1155 bp, 384 aa] {ON}
           complement(20765..21919) [1155 nt, 385 aa]
          Length = 384

 Score = 37.4 bits (85), Expect = 0.081,   Method: Compositional matrix adjust.
 Identities = 34/114 (29%), Positives = 49/114 (42%), Gaps = 22/114 (19%)

Query: 7   RSAKNMVKGYSSTQVMVRDATANDSTSPSVGVLEDLADKTYDTVEFF-------EIMDML 59
           R  +NM+  Y   Q+ +R AT  D+  P+   L+ +    Y    +         I+D L
Sbjct: 21  RFMQNMIVQYEPYQIDIRRATNTDAWGPTTKHLQKVIRNKYSVPLYLMTEYVLKRIVDHL 80

Query: 60  DKR---LNDK--------GKYWRHVAKSLTVLDYLVRFGSE----NCVLWCKEN 98
            KR   L +K        G  WR + K L V++YL+   SE    N V  C EN
Sbjct: 81  AKRPKNLYEKARKEYVNYGSEWRIILKCLIVIEYLLLNVSEPEELNQVKSCLEN 134

>CAGL0E01199g Chr5 (108041..109279) [1239 bp, 412 aa] {ON} similar
           to uniprot|Q03769 Saccharomyces cerevisiae YDR153c ENT5
          Length = 412

 Score = 36.6 bits (83), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 30/98 (30%), Positives = 41/98 (41%), Gaps = 20/98 (20%)

Query: 6   VRSAKNMVKGYSSTQVMVRDATANDSTSPSVGVLEDLADKTYDTVEFFEIMDMLDKRLND 65
            R A+N++  Y   QV VR AT  DS  P+   L  +    Y  V  + I + + KRL D
Sbjct: 20  ARFAQNVIVQYEPYQVDVRRATNTDSWGPTPKHLAKVLRNRY-QVPLYLITEYILKRLID 78

Query: 66  K-------------------GKYWRHVAKSLTVLDYLV 84
                               G  WR V K L V++YL+
Sbjct: 79  HIAQRPKNLYEKARKDYVNYGSEWRVVLKCLVVIEYLL 116

>NDAI0J00930 Chr10 (209579..210835) [1257 bp, 418 aa] {ON} Anc_8.335
           YDR153C
          Length = 418

 Score = 36.6 bits (83), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 34/113 (30%), Positives = 49/113 (43%), Gaps = 24/113 (21%)

Query: 6   VRSAKNMVKGYSSTQVMVRDATANDSTSPSVGVLEDLADKTYDTVEFFEIMDMLDKRLND 65
            R A+N++  Y   QV +R AT  D+  P+   L+ +    Y  V  + +++   KRL D
Sbjct: 20  ARFAQNVIVQYEPYQVDIRRATNTDAWGPTPKHLQKVLRNRY-QVPLYLMVEYTLKRLVD 78

Query: 66  K-------------------GKYWRHVAKSLTVLDYL---VRFGSE-NCVLWC 95
                               G  WR V K LTV++YL   V  G E N V+ C
Sbjct: 79  HIAVKPKNFYERARKEYVNYGAEWRVVLKCLTVVEYLMLNVDDGDELNQVVRC 131

>KLLA0D16654g Chr4 complement(1413507..1414706) [1200 bp, 399 aa]
           {ON} similar to uniprot|Q6Q5U2 Saccharomyces cerevisiae
           YDR153C ENT5 Protein containing an N-terminal epsin-like
           domain involved in clathrin recruitment and traffic
           between the Golgi and endosomes associates with the
           clathrin adaptor Gga2p clathrin adaptor complex AP-1 and
           clathrin
          Length = 399

 Score = 36.2 bits (82), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 30/112 (26%), Positives = 46/112 (41%), Gaps = 22/112 (19%)

Query: 6   VRSAKNMVKGYSSTQVMVRDATANDSTSPSVGVLEDLADKTYDTVEFF-------EIMDM 58
            R A+N++  Y   Q+ +R AT  DS  P+   L  +    Y+   F         ++D 
Sbjct: 20  ARFAQNVIVQYEPYQIDIRRATNTDSWGPTPKHLAKVMRHRYEVSMFLMTEYTLKRLVDH 79

Query: 59  LDKRLNDK-----------GKYWRHVAKSLTVLDYLV----RFGSENCVLWC 95
           + KR  +            G  WR V K L +L+YL+    R    + VL C
Sbjct: 80  MAKRPKNMYEKARKQYVNYGNEWRVVLKCLVLLEYLLMRSDRGKETDQVLSC 131

>KNAG0J02870 Chr10 (549107..550096) [990 bp, 329 aa] {ON} Anc_4.17
           YLL038C
          Length = 329

 Score = 35.4 bits (80), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 35/116 (30%), Positives = 55/116 (47%), Gaps = 14/116 (12%)

Query: 1   MPSQLVRSAKNMVKGYSSTQVMVRDATANDST-SPSVG-VLEDLADKTYDTVEFFEIMDM 58
           MP  L  S +N V   S+T++ V+ AT +    S S G V+ +++  TY      EI  +
Sbjct: 1   MP--LFDSVRNFVN--STTELKVKQATDDSEVLSSSTGTVMNEISVLTYSPKTLKEIQSV 56

Query: 59  LDKRLNDKGKYWRHVA--------KSLTVLDYLVRFGSENCVLWCKENLYIIKTLR 106
           L KR +      R V         K+LT++ +L+  GS   V W K N+   + L+
Sbjct: 57  LRKRFHLMSTLPRKVLHRSCLIVLKTLTLILFLLNNGSNAFVSWIKSNVGAFEPLQ 112

>TBLA0B05770 Chr2 complement(1364772..1366814) [2043 bp, 680 aa]
           {ON} Anc_5.84 YGR241C
          Length = 680

 Score = 34.3 bits (77), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 30/114 (26%), Positives = 48/114 (42%), Gaps = 7/114 (6%)

Query: 22  MVRDATANDSTSPSVGVLEDLADKTYDTVEFFEIMDMLDKRLNDKGKYWRHVAKSLTVLD 81
           +V+ AT      P    ++ +   + D  +F EI+  L  R++D    W  V KSL V  
Sbjct: 7   LVKGATKIKMAPPKQKYIDPILMGSTDPRDFHEIIRALYSRISDSA--WTVVYKSLIVTH 64

Query: 82  YLVRFGSENCVL-WCKENLYIIK----TLREFRHEDEVSGSDEGQIIRVKAKEL 130
            L+R G ++  L +   NL           +F   D  +     Q + V+AKE 
Sbjct: 65  LLIREGEKDITLDYLSNNLDFFNLNGINTSKFSSGDVRALERYNQYLLVRAKEF 118

>KNAG0A05100 Chr1 (744989..746254) [1266 bp, 421 aa] {ON} Anc_8.335
           YDR153C
          Length = 421

 Score = 33.9 bits (76), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 27/98 (27%), Positives = 42/98 (42%), Gaps = 20/98 (20%)

Query: 6   VRSAKNMVKGYSSTQVMVRDATANDSTSPSVGVLEDLADKTYDTVEFFEIMDMLDKRLND 65
            R A+N++  Y   QV +R AT  D+  P+   L  +    Y  V  + + + + KRL D
Sbjct: 20  ARFAQNVIVQYEPYQVDIRRATNTDAWGPTPKHLSKVLRHRY-QVPMYLMTEYILKRLVD 78

Query: 66  K-------------------GKYWRHVAKSLTVLDYLV 84
                               G  WR V K LTV+++L+
Sbjct: 79  HIATRPKNLYEKARKDYVNYGAEWRVVLKCLTVIEFLM 116

>Kwal_YGOB_27.11261 s27 complement(716644..717033,717035..717859)
           [1215 bp, 404 aa] {ON} ANNOTATED BY YGOB -
          Length = 404

 Score = 33.9 bits (76), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 35/113 (30%), Positives = 46/113 (40%), Gaps = 24/113 (21%)

Query: 6   VRSAKNMVKGYSSTQVMVRDATANDSTSPSVGVLEDLADKTYDTVEFFEIMDMLDKRLND 65
            R A+N++  Y   QV +R AT  DS  P+   L  +    Y  V    + +   KRL D
Sbjct: 20  ARFAQNVIVQYEPYQVDIRRATNTDSWGPTPKHLFKVMRNKYQ-VPLHLMTEYTLKRLVD 78

Query: 66  K-------------------GKYWRHVAKSLTVLDYL---VRFGSE-NCVLWC 95
                               G  WR V K L VL+YL   V  GSE + V+ C
Sbjct: 79  HIASRPKNLYEKARKQYVNYGNEWRVVLKCLVVLEYLLLNVDSGSEVDQVIGC 131

>KLTH0G11902g Chr7 (1002588..1003787) [1200 bp, 399 aa] {ON} similar
           to uniprot|Q6Q5U2 Saccharomyces cerevisiae YDR153C ENT5
           Protein containing an N-terminal epsin-like domain
           involved in clathrin recruitment and traffic between the
           Golgi and endosomes associates with the clathrin adaptor
           Gga2p clathrin adaptor complex AP-1 and clathrin
          Length = 399

 Score = 33.5 bits (75), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 39/131 (29%), Positives = 53/131 (40%), Gaps = 30/131 (22%)

Query: 6   VRSAKNMVKGYSSTQVMVRDATANDSTSPSVGVLEDLADKTYDTVEFFEIMDMLDKRLND 65
            R A+N++  Y   QV +R AT  DS  P+   L  +    Y  V    + +   KRL D
Sbjct: 20  ARFAQNVIVQYEPYQVDIRRATNTDSWGPTPKHLFKVMRNKYQ-VPLHLMTEYTLKRLVD 78

Query: 66  K-------------------GKYWRHVAKSLTVLDYL---VRFGSE-----NCVLWCKEN 98
                               G  WR V K L VL+YL   V  GSE     +C+L  K  
Sbjct: 79  HIASRPKNFYEKARKQYVNYGSEWRVVLKCLVVLEYLLLNVDNGSELDQVTSCLLTHKHI 138

Query: 99  LYIIKTLREFR 109
           L   + + +FR
Sbjct: 139 L--TRDVMQFR 147

>TPHA0C00740 Chr3 (144476..145633) [1158 bp, 385 aa] {ON} Anc_8.335
           YDR153C
          Length = 385

 Score = 33.5 bits (75), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 27/97 (27%), Positives = 41/97 (42%), Gaps = 20/97 (20%)

Query: 7   RSAKNMVKGYSSTQVMVRDATANDSTSPSVGVLEDLADKTYDTVEFFEIMDMLDKRLNDK 66
           R  +NM+  Y   Q+ VR A+  D+  P+   L+ +    Y +V  + I +   KRL D 
Sbjct: 21  RFMQNMIVQYEPYQIDVRRASNTDAWGPTSKHLQKVLRHKY-SVPLYLITEYTLKRLIDH 79

Query: 67  -------------------GKYWRHVAKSLTVLDYLV 84
                              G  WR V K L +LD+L+
Sbjct: 80  IATNSKNVYEKARKEYVNFGSEWRVVFKCLVILDFLL 116

>TBLA0A04040 Chr1 complement(1004703..1005950) [1248 bp, 415 aa]
           {ON} Anc_8.335 YDR153C
          Length = 415

 Score = 33.5 bits (75), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 32/121 (26%), Positives = 49/121 (40%), Gaps = 28/121 (23%)

Query: 6   VRSAKNMVKGYSSTQVMVRDATANDSTSPSVGVLEDLADKTYDTVEFFEIMDMLDKRLND 65
            R A+N++  Y   Q+ +R AT  D+  P+   L  +    Y  V  + + + + KR+ D
Sbjct: 20  ARFAQNVIVQYEPYQIDIRRATNTDAWGPTSKHLAKVLRNRYQ-VPLYLMTEYILKRIVD 78

Query: 66  K-------------------GKYWRHVAKSLTVLDYL---VRFGSE-----NCVLWCKEN 98
                               G  WR V K L V+D+L   V  G E     +C+L  K  
Sbjct: 79  HIAVRPKNFYEKARKDYVNYGAEWRVVLKCLVVIDFLFLNVEEGEELNQVKSCMLTHKHI 138

Query: 99  L 99
           L
Sbjct: 139 L 139

>Kwal_27.11263 s27 complement(717032..717859) [828 bp, 275 aa] {OFF}
           YDR153C - Hypothetical ORF [contig 29] FULL
          Length = 275

 Score = 32.3 bits (72), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 29/97 (29%), Positives = 39/97 (40%), Gaps = 20/97 (20%)

Query: 7   RSAKNMVKGYSSTQVMVRDATANDSTSPSVGVLEDLADKTYDTVEFFEIMDMLDKRLNDK 66
           R A+N++  Y   QV +R AT  DS  P+   L  +    Y  V    + +   KRL D 
Sbjct: 21  RFAQNVIVQYEPYQVDIRRATNTDSWGPTPKHLFKVMRNKYQ-VPLHLMTEYTLKRLVDH 79

Query: 67  -------------------GKYWRHVAKSLTVLDYLV 84
                              G  WR V K L VL+YL+
Sbjct: 80  IASRPKNLYEKARKQYVNYGNEWRVVLKCLVVLEYLL 116

>NCAS0E03820 Chr5 (750631..751917) [1287 bp, 428 aa] {ON} Anc_5.84
           YGR241C
          Length = 428

 Score = 32.3 bits (72), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 25/100 (25%), Positives = 43/100 (43%), Gaps = 6/100 (6%)

Query: 22  MVRDATANDSTSPSVGVLEDLADKTYDTVEFFEIMDMLDKRLNDKGKYWRHVAKSLTVLD 81
           +V+ AT      P    ++ +   T + +EF +I+  L  R+N+    W  V K+L V+ 
Sbjct: 7   LVKGATKVKMAPPKQKYVDPILLGTANPMEFEQIVSQLTARINN-CNIWSVVYKTLIVVH 65

Query: 82  YLVRFGSENCVLWCKENLYIIKTLREFRHEDEVSGSDEGQ 121
            ++  G +   L      Y  K L  F  E  ++ S   Q
Sbjct: 66  LMISIGEQGVTL-----RYFAKNLEFFNLERILNSSKWSQ 100

>NDAI0A02830 Chr1 (636619..638040) [1422 bp, 473 aa] {ON} Anc_5.84
          YGR241C
          Length = 473

 Score = 31.2 bits (69), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 19/77 (24%), Positives = 37/77 (48%), Gaps = 1/77 (1%)

Query: 17 SSTQVMVRDATANDSTSPSVGVLEDLADKTYDTVEFFEIMDMLDKRLNDKGKYWRHVAKS 76
          +S + +V+ AT      P    ++ +   T + +EF +I+  L  R+N+    W  + K+
Sbjct: 2  TSYKKLVKGATKIKMAPPKQKYVDPILLGTSNNIEFQQIVSELTSRINN-CNIWSVIYKT 60

Query: 77 LTVLDYLVRFGSENCVL 93
          L V+  ++  G  N  L
Sbjct: 61 LIVVHLMISIGEPNVTL 77

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.313    0.132    0.379 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 29,912,457
Number of extensions: 1068324
Number of successful extensions: 2648
Number of sequences better than 10.0: 92
Number of HSP's gapped: 2662
Number of HSP's successfully gapped: 134
Length of query: 510
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 396
Effective length of database: 40,409,475
Effective search space: 16002152100
Effective search space used: 16002152100
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 68 (30.8 bits)