Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
CAGL0A03828g8.774ON47647625850.0
NDAI0E006308.774ON49050113540.0
KAFR0D014908.774ON44347113131e-179
NCAS0B007808.774ON47247613121e-178
ZYRO0F12232g8.774ON42647012701e-172
Kpol_1010.138.774ON49950712641e-171
TDEL0B033508.774ON42647012561e-170
TPHA0G012108.774ON49450412411e-167
YOR301W (RAX1)8.774ON43547612251e-166
Smik_15.4828.774ON42547012061e-163
Skud_15.4688.774ON42347211841e-160
SAKL0B05456g8.774ON43246911001e-147
KNAG0G031008.774ON46348510961e-146
TBLA0D008408.774ON57757710551e-138
KLTH0H15070g8.774ON43847010241e-135
Kwal_34.159438.774ON43246610191e-135
KLLA0F24904g8.774ON4244699901e-130
Suva_8.3528.774ON4674379881e-129
AFR532W8.774ON4224738781e-113
Ecym_14768.774ON4534808321e-106
YGR188C (BUB1)5.162ON102194760.96
Suva_10.2608.376ON462129751.1
Smik_12.2258.376ON462129751.2
CAGL0H02739g8.376ON465105741.6
Skud_12.2308.376ON462131731.9
ZYRO0C12716g3.443ON252890742.0
KLLA0D18095g8.376ON469131704.5
NDAI0A068603.130ON70697705.6
YPR075C (OPY2)3.373ON36079696.2
CAGL0E01265g8.331ON2095157697.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0A03828g
         (476 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0A03828g Chr1 (390687..392117) [1431 bp, 476 aa] {ON} simila...  1000   0.0  
NDAI0E00630 Chr5 complement(128590..130062) [1473 bp, 490 aa] {O...   526   0.0  
KAFR0D01490 Chr4 (297425..298756) [1332 bp, 443 aa] {ON} Anc_8.7...   510   e-179
NCAS0B00780 Chr2 (119384..120802) [1419 bp, 472 aa] {ON} Anc_8.7...   509   e-178
ZYRO0F12232g Chr6 (994273..995553) [1281 bp, 426 aa] {ON} simila...   493   e-172
Kpol_1010.13 s1010 complement(27385..28884) [1500 bp, 499 aa] {O...   491   e-171
TDEL0B03350 Chr2 complement(599587..600867) [1281 bp, 426 aa] {O...   488   e-170
TPHA0G01210 Chr7 complement(246099..247583) [1485 bp, 494 aa] {O...   482   e-167
YOR301W Chr15 (880965..882272) [1308 bp, 435 aa] {ON}  RAX1Prote...   476   e-166
Smik_15.482 Chr15 (830795..832072) [1278 bp, 425 aa] {ON} YOR301...   469   e-163
Skud_15.468 Chr15 (820871..822142) [1272 bp, 423 aa] {ON} YOR301...   460   e-160
SAKL0B05456g Chr2 (470064..471362) [1299 bp, 432 aa] {ON} simila...   428   e-147
KNAG0G03100 Chr7 (673022..674413) [1392 bp, 463 aa] {ON} Anc_8.7...   426   e-146
TBLA0D00840 Chr4 (221070..222803) [1734 bp, 577 aa] {ON} Anc_8.7...   410   e-138
KLTH0H15070g Chr8 (1304724..1306040) [1317 bp, 438 aa] {ON} simi...   399   e-135
Kwal_34.15943 s34 complement(128372..129670) [1299 bp, 432 aa] {...   397   e-135
KLLA0F24904g Chr6 complement(2319858..2321132) [1275 bp, 424 aa]...   385   e-130
Suva_8.352 Chr8 (621701..623104) [1404 bp, 467 aa] {ON} YOR301W ...   385   e-129
AFR532W Chr6 (1391215..1392483) [1269 bp, 422 aa] {ON} Syntenic ...   342   e-113
Ecym_1476 Chr1 (980938..982299) [1362 bp, 453 aa] {ON} similar t...   325   e-106
YGR188C Chr7 complement(872044..875109) [3066 bp, 1021 aa] {ON} ...    34   0.96 
Suva_10.260 Chr10 complement(463944..465332) [1389 bp, 462 aa] {...    33   1.1  
Smik_12.225 Chr12 complement(439006..440394) [1389 bp, 462 aa] {...    33   1.2  
CAGL0H02739g Chr8 (248511..249908) [1398 bp, 465 aa] {ON} highly...    33   1.6  
Skud_12.230 Chr12 complement(438565..439953) [1389 bp, 462 aa] {...    33   1.9  
ZYRO0C12716g Chr3 (1008641..1016227) [7587 bp, 2528 aa] {ON} sim...    33   2.0  
KLLA0D18095g Chr4 complement(1526808..1528217) [1410 bp, 469 aa]...    32   4.5  
NDAI0A06860 Chr1 complement(1560888..1563008) [2121 bp, 706 aa] ...    32   5.6  
YPR075C Chr16 complement(695737..696819) [1083 bp, 360 aa] {ON} ...    31   6.2  
CAGL0E01265g Chr5 complement(113167..119454) [6288 bp, 2095 aa] ...    31   7.1  

>CAGL0A03828g Chr1 (390687..392117) [1431 bp, 476 aa] {ON} similar
           to uniprot|Q08760 Saccharomyces cerevisiae YOR301w RAX1
          Length = 476

 Score = 1000 bits (2585), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 476/476 (100%), Positives = 476/476 (100%)

Query: 1   MPSTAIDFDQIQHQRLPTLYEVFILKTEPPVDLWSFYTYLSQFPYAINYLDFWIDLMAHI 60
           MPSTAIDFDQIQHQRLPTLYEVFILKTEPPVDLWSFYTYLSQFPYAINYLDFWIDLMAHI
Sbjct: 1   MPSTAIDFDQIQHQRLPTLYEVFILKTEPPVDLWSFYTYLSQFPYAINYLDFWIDLMAHI 60

Query: 61  RLCKDYVSTVRQSVVQGSALEEFRNLDERSNVNRHMNNDEDASVTTSILMNTLLSEGYLD 120
           RLCKDYVSTVRQSVVQGSALEEFRNLDERSNVNRHMNNDEDASVTTSILMNTLLSEGYLD
Sbjct: 61  RLCKDYVSTVRQSVVQGSALEEFRNLDERSNVNRHMNNDEDASVTTSILMNTLLSEGYLD 120

Query: 121 FENPEKVSQFLQGNTHTSPMVTRMIQDWKLHNERNSVAATSHLQSTQAGIDISRKESMQS 180
           FENPEKVSQFLQGNTHTSPMVTRMIQDWKLHNERNSVAATSHLQSTQAGIDISRKESMQS
Sbjct: 121 FENPEKVSQFLQGNTHTSPMVTRMIQDWKLHNERNSVAATSHLQSTQAGIDISRKESMQS 180

Query: 181 VSAIVDEFLKRQSQLGEKGNITTKQLYNNAQQICNTYLMSQQHSPRYLANIPDDLKNQVI 240
           VSAIVDEFLKRQSQLGEKGNITTKQLYNNAQQICNTYLMSQQHSPRYLANIPDDLKNQVI
Sbjct: 181 VSAIVDEFLKRQSQLGEKGNITTKQLYNNAQQICNTYLMSQQHSPRYLANIPDDLKNQVI 240

Query: 241 HNFKANRRHDPEVFRELKEVTYQFLETDCFPKFLKEVALHNIHDELSDWRFHPSNKNPHR 300
           HNFKANRRHDPEVFRELKEVTYQFLETDCFPKFLKEVALHNIHDELSDWRFHPSNKNPHR
Sbjct: 241 HNFKANRRHDPEVFRELKEVTYQFLETDCFPKFLKEVALHNIHDELSDWRFHPSNKNPHR 300

Query: 301 TSSPSGSKENLNGHKQLMQNHISWSPFSTYTSLSRVLFGCMWMGIGFWIGYVLIFLHYSR 360
           TSSPSGSKENLNGHKQLMQNHISWSPFSTYTSLSRVLFGCMWMGIGFWIGYVLIFLHYSR
Sbjct: 301 TSSPSGSKENLNGHKQLMQNHISWSPFSTYTSLSRVLFGCMWMGIGFWIGYVLIFLHYSR 360

Query: 361 AIRVTTVVPFGLGCYYIVCGIYQVDIIYSWFGLTQRLMYSHKKGNIEEGRQVYGATYNDD 420
           AIRVTTVVPFGLGCYYIVCGIYQVDIIYSWFGLTQRLMYSHKKGNIEEGRQVYGATYNDD
Sbjct: 361 AIRVTTVVPFGLGCYYIVCGIYQVDIIYSWFGLTQRLMYSHKKGNIEEGRQVYGATYNDD 420

Query: 421 VPLIFTLLGGKSRLIHIEHPFIKKILYKRGLWCLTLVVIFTAIFTVIFCCVPGRRL 476
           VPLIFTLLGGKSRLIHIEHPFIKKILYKRGLWCLTLVVIFTAIFTVIFCCVPGRRL
Sbjct: 421 VPLIFTLLGGKSRLIHIEHPFIKKILYKRGLWCLTLVVIFTAIFTVIFCCVPGRRL 476

>NDAI0E00630 Chr5 complement(128590..130062) [1473 bp, 490 aa] {ON}
           Anc_8.774 YOR301W
          Length = 490

 Score =  526 bits (1354), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 266/501 (53%), Positives = 344/501 (68%), Gaps = 43/501 (8%)

Query: 6   IDFDQIQHQRLPTLYEVFILKTEPPVDLWSFYTYLSQFPYAINYLDFWIDLMAHIRLCKD 65
           +D+ +IQ +RLPTLYEV I KT+ PVDLWSFYT+LSQFPYAINYLDFWIDLMAH+RLCKD
Sbjct: 3   LDYKKIQTERLPTLYEVLIQKTKFPVDLWSFYTFLSQFPYAINYLDFWIDLMAHLRLCKD 62

Query: 66  YVSTVRQSV---------------VQGSALEEFRNLDERSNVNRHMNNDE---------D 101
           Y+S +R+S+               +Q ++ E  ++  E  ++  H + +          +
Sbjct: 63  YISGIRESITYNQNEARNSRIRHHLQYTSEESIQH--ETQSIQHHDDPEGGDEDDDDDDN 120

Query: 102 ASVTTSILMNTLLSEGYLDFENPEKVSQFLQGNTHTSPMVTRMIQDWKLHN-ERNSVAAT 160
            SVTTS+L+N LL EG+LDFENPE+VSQFLQGNT  SP ++++++DWK H+   N     
Sbjct: 121 ISVTTSVLLNALLDEGHLDFENPERVSQFLQGNTEYSPKLSQLLEDWKRHSIANNDSNRK 180

Query: 161 SHLQSTQAGIDISRKESMQSVSAIVDEFLKRQSQLGEKGNITTKQLYNNAQQICNTYLMS 220
             L    + +  SR+ +  ++  +VD+ L++QSQ  E+  ITTKQL NNA +IC+ YL S
Sbjct: 181 GSLNRNNSNVR-SRETNGAALPDVVDDILRKQSQQEERAKITTKQLLNNALKICSIYLQS 239

Query: 221 QQHSPRYLANIPDDLKNQVIHNFKANRRHDPEVFRELKEVTYQFLETDCFPKFLKEVALH 280
            + S RYL N+PDD++ + ++  +  RRHDP+VF ELK + +QFLE DCFPKFL  VALH
Sbjct: 240 PERSERYLTNLPDDIRLKALNLVQNERRHDPQVFEELKSIAFQFLEMDCFPKFLSTVALH 299

Query: 281 NIHDELSDWRFHPSNKNPHRTSSPSGSKENLNGHKQLMQN--HISWSPFSTYTSLSRVLF 338
           NIHDE+SDWRFH SN   H  +            K L++N  HIS SPFSTYT LSR +F
Sbjct: 300 NIHDEISDWRFH-SNARSHNLTRVD---------KSLIKNHDHISKSPFSTYTLLSRTIF 349

Query: 339 GCMWMGIGFWIGYVLIFLHYSRAIRVTTVVPFGLGCYYIVCGIYQVDIIYSWFGLTQRLM 398
           G +W+GIGFWIGY LIFL Y R IRV T+VPF +G Y+I+CG+Y+VDIIYSWFG+TQRL+
Sbjct: 350 GLLWLGIGFWIGYTLIFLKYDRGIRVVTIVPFAIGNYFIICGMYRVDIIYSWFGVTQRLL 409

Query: 399 YSHKKGNIEEGRQVYGATYNDD---VPLIFTLLGGKSRLIHIEHPFIKKILYKRGLWCLT 455
           Y H + N +  R+V     N     V  I  LLGG+SRLI IEHPFIK IL KRGLWCL 
Sbjct: 410 YKHNEKNRDADREVQMDEKNGKNHHVSGILALLGGRSRLIRIEHPFIKNILMKRGLWCLF 469

Query: 456 LVVIFTAIFTVIFCCVPGRRL 476
           LV++ T IFTVIF CVPG R+
Sbjct: 470 LVLLSTGIFTVIFSCVPGYRI 490

>KAFR0D01490 Chr4 (297425..298756) [1332 bp, 443 aa] {ON} Anc_8.774
           YOR301W
          Length = 443

 Score =  510 bits (1313), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 254/471 (53%), Positives = 319/471 (67%), Gaps = 30/471 (6%)

Query: 6   IDFDQIQHQRLPTLYEVFILKTEPPVDLWSFYTYLSQFPYAINYLDFWIDLMAHIRLCKD 65
           +DF +IQ +RLPTLYEV I KT  PVDLWSFYTYLSQFPYAINYLDFWIDLMAH+RL KD
Sbjct: 3   LDFAKIQEERLPTLYEVLIQKTSVPVDLWSFYTYLSQFPYAINYLDFWIDLMAHLRLSKD 62

Query: 66  YVSTVRQSVVQGSALEEFRNLDERSNVNRHMNNDEDASVTTSILMNTLLSEGYLDFENPE 125
           Y++ +R S+++ S   E  N  ++S+     +N E+ SVTTS+L+N L+ EG+LDFENP+
Sbjct: 63  YINGIRGSLLEESNFNELEN--QQSSQEDQNSNSENVSVTTSVLLNALMEEGHLDFENPD 120

Query: 126 KVSQFLQGNTHTSPMVTRMIQDWKLHNERNSVAATSHLQSTQAGIDISRKESMQSVSAIV 185
           +VS+FLQG    SP +++++  WK H             S     + +      ++  ++
Sbjct: 121 RVSKFLQGKADYSPKLSQLLDGWKRH-------------SGIYDANNNLNIDNGNLPTLL 167

Query: 186 DEFLKRQSQLGEKGNITTKQLYNNAQQICNTYLMSQQHSPRYLANIPDDLKNQVIHNFKA 245
           DE LK +S+  E   ITTKQL NNA QICNTYL S + S +YL+NI ++ + +V+ +   
Sbjct: 168 DEMLKNKSKRNETSQITTKQLLNNALQICNTYLYSTEKSAKYLSNISEETRMKVLDSVVN 227

Query: 246 NRRHDPEVFRELKEVTYQFLETDCFPKFLKEVALHNIHDELSDWRFHPSNKNPHRTSSPS 305
             R+DPEVF ELK  TYQ LETDCFPKFL  VALHNIHDELSDWRFH          S  
Sbjct: 228 QNRYDPEVFEELKATTYQLLETDCFPKFLSTVALHNIHDELSDWRFH----------SEK 277

Query: 306 GSKENLNGHKQLMQNHISWSPFSTYTSLSRVLFGCMWMGIGFWIGYVLIFLHYSRAIRVT 365
           G+ +N       ++   S SPFS +T+LSR++FG +W+GIGFWIGYVLIFL YSRAIRV 
Sbjct: 278 GAIDNTT-----LRYRGSRSPFSNHTTLSRLIFGLVWLGIGFWIGYVLIFLKYSRAIRVV 332

Query: 366 TVVPFGLGCYYIVCGIYQVDIIYSWFGLTQRLMYSHKKGNIEEGRQVYGATYNDDVPLIF 425
           TVVPF +GCY I+CG+YQVDIIYSWFG+TQ L Y      I         T  + VP + 
Sbjct: 333 TVVPFAIGCYLIICGMYQVDIIYSWFGVTQVLTYKDSDSKILRSNDEEHTTTKEKVPFLI 392

Query: 426 TLLGGKSRLIHIEHPFIKKILYKRGLWCLTLVVIFTAIFTVIFCCVPGRRL 476
            LLGG  R + IEH FIKK+L +RGLWCL LVVI TAIFTVIF CVPG R+
Sbjct: 393 ALLGGGKRTVKIEHTFIKKLLQRRGLWCLLLVVISTAIFTVIFSCVPGFRI 443

>NCAS0B00780 Chr2 (119384..120802) [1419 bp, 472 aa] {ON} Anc_8.774
           YOR301W
          Length = 472

 Score =  509 bits (1312), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 248/476 (52%), Positives = 335/476 (70%), Gaps = 18/476 (3%)

Query: 7   DFDQIQHQRLPTLYEVFILKTEPPVDLWSFYTYLSQFPYAINYLDFWIDLMAHIRLCKDY 66
           DF++IQ +RLPTLYEV + KT  PVDLWSFYT+LSQFPYAINYLDFW+DLM H+RLCKDY
Sbjct: 9   DFEKIQTERLPTLYEVLVQKTRAPVDLWSFYTFLSQFPYAINYLDFWMDLMTHLRLCKDY 68

Query: 67  VSTVRQSVVQGSALEEFRNLDERSNVNR-HMNNDEDASVTTSILMNTLLSEGYLDFENPE 125
           V  +R+S+V  +  +   +L    +  +   + D+ ASV TS+L+N LL EG+ D  NP 
Sbjct: 69  VDGIRESLVVNNERQGNSSLLNNEHAQQVEADADDSASVRTSVLLNALLEEGHFDLTNPA 128

Query: 126 KVSQFLQGNTHTSPMVTRMIQDWKLHNERNSVAATSHLQSTQAGIDISRKESMQSVSAIV 185
            VSQ LQG  + SP + ++I DW  H++    +  +   +  +        +  ++S+I+
Sbjct: 129 GVSQLLQGQVNHSPKLAQLIDDWNRHSQNVDDSNRNRSSNNNS------NSNNNNLSSIL 182

Query: 186 DEFLKRQSQLGEKGNITTKQLYNNAQQICNTYLMSQQHSPRYLANIPDDLKNQVIHNFKA 245
           D+ LKRQSQL EK  +TTKQL N+A +IC+ YL+S + S RYL NIPD+++ + ++  + 
Sbjct: 183 DDILKRQSQLEEKPKVTTKQLLNSALKICSLYLLSPEQSERYLTNIPDEVRLKAVNLIQR 242

Query: 246 NRRHDPEVFRELKEVTYQFLETDCFPKFLKEVALHNIHDELSDWRFHPSNKNPHRTSS-P 304
           N RHDPEVF ELK V+YQFLE DCFPKFL  VALHNIHDE+SDWRFH  +   +R  S  
Sbjct: 243 NSRHDPEVFDELKSVSYQFLEIDCFPKFLSTVALHNIHDEISDWRFHAHSTGGNRNKSQA 302

Query: 305 SGSKENLNGHKQLMQNHISWSPFSTYTSLSRVLFGCMWMGIGFWIGYVLIFLHYSRAIRV 364
           S ++++L   +     HIS SPFSTYT+LSR++FG +W+G+GFWIGY LIFL Y R IRV
Sbjct: 303 SLTEKDLESMR-----HISKSPFSTYTTLSRIMFGLLWLGVGFWIGYTLIFLKYDRGIRV 357

Query: 365 TTVVPFGLGCYYIVCGIYQVDIIYSWFGLTQRLMYSHKKGNIEEGRQ----VYGATYNDD 420
            T+VPF +G Y++VCG+YQVDI+YSWFG+TQRL+Y  +K   E+G      V      D 
Sbjct: 358 VTIVPFCIGSYFVVCGLYQVDILYSWFGITQRLLYKDRKVT-EDGYDGNVPVDVKESKDK 416

Query: 421 VPLIFTLLGGKSRLIHIEHPFIKKILYKRGLWCLTLVVIFTAIFTVIFCCVPGRRL 476
           +P IF +LGG++RLI ++HPFI+K L++RGLWC  LV+I T +FTV+F CVPG R+
Sbjct: 417 IPFIFGILGGRNRLIEVKHPFIRKFLFQRGLWCCLLVLISTGVFTVVFSCVPGHRV 472

>ZYRO0F12232g Chr6 (994273..995553) [1281 bp, 426 aa] {ON} similar
           to uniprot|Q08760 Saccharomyces cerevisiae YOR301W RAX1
           Protein involved in bud site selection during bipolar
           budding localization requires Rax2p
          Length = 426

 Score =  493 bits (1270), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 240/470 (51%), Positives = 322/470 (68%), Gaps = 47/470 (10%)

Query: 7   DFDQIQHQRLPTLYEVFILKTEPPVDLWSFYTYLSQFPYAINYLDFWIDLMAHIRLCKDY 66
           DF  I++QRLPTLYEV + +T PPVDLWSFYT+LSQFPYAI++LDFWIDLMAH+RLC+DY
Sbjct: 4   DFTPIENQRLPTLYEVLLRQTSPPVDLWSFYTFLSQFPYAIDFLDFWIDLMAHVRLCRDY 63

Query: 67  VSTVRQSVVQGSALEEFRNLDERSNVNRHMNNDEDASVTTSILMNTLLSEGYLDFENPEK 126
           V  V++S+       E RN          +  D+  S  +++L++ LL+EGYLDF+N  +
Sbjct: 64  VRGVKESI-------EARN--------SELIADDAHSDESNVLLDALLTEGYLDFKNARR 108

Query: 127 VSQFLQGNTHTSPMVTRMIQDWKLHNERNSVAATSHLQSTQAGIDISRKESMQSVSAIVD 186
           VSQFL+GN   S  ++R++  +K            H  STQ     S +E+ + ++A+VD
Sbjct: 109 VSQFLRGNVEESMRISRLLDTFK----------QDHRLSTQ-----SDREADEFLAAMVD 153

Query: 187 EFLKRQSQLGEKGNITTKQLYNNAQQICNTYLMSQQHSPRYLANIPDDLKNQVIHNFKAN 246
           + LK++    ++  +T KQL NNA QIC  YL+S Q SPRYL N+PD+++ + +H  ++ 
Sbjct: 154 DMLKQKIHKDKQPKMTRKQLINNASQICRQYLLSPQESPRYLINVPDEIRMKALHAVQSE 213

Query: 247 RRHDPEVFRELKEVTYQFLETDCFPKFLKEVALHNIHDELSDWRFHPSNKNPHRTSSPSG 306
           RR DPE+F +L+ ++Y FLE DCFPKFL  VALHN+HD+LSDWRF         T++   
Sbjct: 214 RRFDPELFEDLRNLSYDFLEMDCFPKFLNRVALHNLHDQLSDWRFQT-------TAAIGK 266

Query: 307 SKENLNGHKQLMQNHISWSPFSTYTSLSRVLFGCMWMGIGFWIGYVLIFLHYSRAIRVTT 366
           SK ++ G +       S SP STY+ L R+  G  W+GIGFWIGYVLIFLHYSRAIRVTT
Sbjct: 267 SKGDIRGQR-------SASPLSTYSGLGRIALGLCWLGIGFWIGYVLIFLHYSRAIRVTT 319

Query: 367 VVPFGLGCYYIVCGIYQVDIIYSWFGLTQRLMYSHKKGNIEEGRQVYGATYNDDVPLIFT 426
           +VPFG+GCY+ VCGIYQVDI+YSWFG+TQRLMY  K   +   R+         VP IF 
Sbjct: 320 IVPFGIGCYFSVCGIYQVDILYSWFGVTQRLMYEKK---LPSDREEDVPKSRTRVPTIFA 376

Query: 427 LLGGKSRLIHIEHPFIKKILYKRGLWCLTLVVIFTAIFTVIFCCVPGRRL 476
           LLGG+SRL+ + HPFIKK+L +RG+WC  LVV+ TA+ TV+F CVPG+R+
Sbjct: 377 LLGGRSRLMPVHHPFIKKLLLRRGMWCFLLVVVSTAVLTVLFSCVPGKRI 426

>Kpol_1010.13 s1010 complement(27385..28884) [1500 bp, 499 aa] {ON}
           complement(27385..28884) [1500 nt, 500 aa]
          Length = 499

 Score =  491 bits (1264), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 247/507 (48%), Positives = 334/507 (65%), Gaps = 42/507 (8%)

Query: 3   STAIDFDQIQHQRLPTLYEVFILKTEPPVDLWSFYTYLSQFPYAINYLDFWIDLMAHIRL 62
           +   DFD+IQ +RLPTLYEV I KT+ PVDLWSFYT+LSQFP+A+NYL+FWIDLM+HIRL
Sbjct: 2   AQVTDFDRIQQERLPTLYEVLIQKTDSPVDLWSFYTFLSQFPHALNYLEFWIDLMSHIRL 61

Query: 63  CKDYVSTVRQSVV----------QGSALEEF-RNLDERSN----VNRHMNNDED-ASVTT 106
           CKDY+  +R+SV+          Q    E   RN+ E  N     N+  N D+D  SVT+
Sbjct: 62  CKDYIRGIRESVLIPNEELKSRRQSEVYENVERNVIETENDIEQPNKENNGDQDNISVTS 121

Query: 107 SILMNTLLSEGYLDFENPEKVSQFLQGNTHTSPMVTRMIQDWKLHNERNSVAATSHLQST 166
           SIL++ L+ EGYLDF+NP+KV++FLQG+   SP +++++ DWK H        + ++  +
Sbjct: 122 SILIDALMDEGYLDFQNPQKVNRFLQGDLEYSPQLSQLLDDWKRH--------SGYIDHS 173

Query: 167 QAGIDISRKESMQSVSAIVDEFLKRQSQL-GEKGNITTKQLYNNAQQICNTYLMSQQHSP 225
                 S  +  + VSA VD  L+  +++  E+  +T K L  NAQ IC+ YL+S + S 
Sbjct: 174 NDDSYASSGKDNKIVSA-VDGLLQNYTKMHQERPQVTAKLLLQNAQTICSLYLISPEKSE 232

Query: 226 RYLANIPDDLKNQVIHNFKANRRHDPEVFRELKEVTYQFLETDCFPKFLKEVALHNIHDE 285
           +YL N+P+ ++N+ +   +   RHDPEVF  ++ + YQFLE DCF KFL  VALHNIHD+
Sbjct: 233 KYLINVPEHIRNETLQLVEIGGRHDPEVFESMRSLAYQFLEIDCFSKFLNRVALHNIHDQ 292

Query: 286 LSDWRFHPSNKNPHRTSSPSGS--KENLNGHKQLMQN--------------HISWSPFST 329
           +SDW++HP   + H  ++      K+NL      + N              H S SPFS 
Sbjct: 293 ISDWKYHPVKPHSHNDNNTEKKQPKKNLKIFGMNLSNASDDESVNEVEYSRHQSRSPFSN 352

Query: 330 YTSLSRVLFGCMWMGIGFWIGYVLIFLHYSRAIRVTTVVPFGLGCYYIVCGIYQVDIIYS 389
           YT++SR+ FG  WMGIGFWIGYVLIFL+Y+R IRV T+VPF +G Y+IVCGIYQVD++YS
Sbjct: 353 YTTISRICFGTFWMGIGFWIGYVLIFLNYNRGIRVVTIVPFAIGSYFIVCGIYQVDVVYS 412

Query: 390 WFGLTQRLMYSHKKGNIEEGRQVYGATYNDDVPLIFTLLGGKSRLIHIEHPFIKKILYKR 449
           WFG+TQ LM+ HK  + E G  +     N  VP I  +LGGKSRLI I+H FI+ +L+KR
Sbjct: 413 WFGVTQELMFRHKSSDEENGHPMNLDKNNKGVPGILKVLGGKSRLIRIDHQFIRNLLFKR 472

Query: 450 GLWCLTLVVIFTAIFTVIFCCVPGRRL 476
           GLWC  ++ I TAIFTVIF CVPGRR+
Sbjct: 473 GLWCCAIITISTAIFTVIFSCVPGRRV 499

>TDEL0B03350 Chr2 complement(599587..600867) [1281 bp, 426 aa] {ON}
           Anc_8.774 YOR301W
          Length = 426

 Score =  488 bits (1256), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 248/470 (52%), Positives = 319/470 (67%), Gaps = 51/470 (10%)

Query: 7   DFDQIQHQRLPTLYEVFILKTEPPVDLWSFYTYLSQFPYAINYLDFWIDLMAHIRLCKDY 66
           D++QIQ +RLPTLYEV I  T+ PVD W FYTYLSQFPYAI+YLDFWIDLMAHIRLCKDY
Sbjct: 8   DYEQIQRERLPTLYEVLIQVTKAPVDSWEFYTYLSQFPYAIDYLDFWIDLMAHIRLCKDY 67

Query: 67  VSTVRQSVVQGSALEEFRNLDERSNVNRHMNNDEDASVTTSILMNTLLSEGYLDFENPEK 126
           V  VR+SV     +   RN DE  N+      D++ SV++S+L++ LL+EGYLDF+N ++
Sbjct: 68  VKGVRESVEFNETIAS-RNRDE-VNIE-----DDNESVSSSVLLDALLNEGYLDFQNTKR 120

Query: 127 VSQFLQGNTHTSPMVTRMIQDWKLHNERNSVAATSHLQSTQAGIDISRKESMQSVSAIVD 186
           VSQFLQG+T+ SP V+R++  WK                 Q+GI   +   +   + +VD
Sbjct: 121 VSQFLQGDTNDSPRVSRLVDGWK----------------RQSGIADGQNHPL---ALMVD 161

Query: 187 EFLKRQSQLGEKGNITTKQLYNNAQQICNTYLMSQQHSPRYLANIPDDLKNQVIHNFKAN 246
           E L+++++  ++  IT KQL NNA QICN YL+      +YL N+P+ +KNQV+++ +  
Sbjct: 162 EMLRKETRKLKQPKITRKQLVNNALQICNIYLLKSAEDNKYLINVPERVKNQVLYDVQQE 221

Query: 247 RRHDPEVFRELKEVTYQFLETDCFPKFLKEVALHNIHDELSDWRFHPSNKNPHRTSSPSG 306
           +RHDP VF  LK V YQFLE DCFPKFL  VALHNIHD++S+WR+           SP  
Sbjct: 222 QRHDPAVFEPLKTVAYQFLEIDCFPKFLSTVALHNIHDQISNWRYQ----------SPG- 270

Query: 307 SKENLNGHKQLMQNHISWSPFSTYTSLSRVLFGCMWMGIGFWIGYVLIFLHYSRAIRVTT 366
                      ++ H S SPFS YT LSRVL G +W+GIGFWIGY LIFLHYSRAIRV T
Sbjct: 271 -----------LRRHRSKSPFSNYTVLSRVLIGLIWLGIGFWIGYTLIFLHYSRAIRVVT 319

Query: 367 VVPFGLGCYYIVCGIYQVDIIYSWFGLTQRLMYSHKKGNIEEGRQVYGATYNDDVPLIFT 426
           +VPF LG Y IVCG+YQVDI+Y++FGLTQ LMY  K G+  + +  +  +   ++P IF 
Sbjct: 320 IVPFALGSYSIVCGLYQVDILYAFFGLTQALMYQEKDGSQTDRKHSHDYS---EIPTIFK 376

Query: 427 LLGGKSRLIHIEHPFIKKILYKRGLWCLTLVVIFTAIFTVIFCCVPGRRL 476
           LLGG+SRLI I+H FIKK+L+KR LWC  L  + TAI TVIF CVPG RL
Sbjct: 377 LLGGRSRLIKIQHDFIKKLLWKRALWCGFLTTLATAILTVIFSCVPGYRL 426

>TPHA0G01210 Chr7 complement(246099..247583) [1485 bp, 494 aa] {ON}
           Anc_8.774 YOR301W
          Length = 494

 Score =  482 bits (1241), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 245/504 (48%), Positives = 341/504 (67%), Gaps = 43/504 (8%)

Query: 5   AIDFDQIQHQRLPTLYEVFILKTEPPVDLWSFYTYLSQFPYAINYLDFWIDLMAHIRLCK 64
           AIDF+++Q +RLPTLYEV ILKTE PVDLWSFYT+LSQFP+AINYL+FWIDLMAHIRLCK
Sbjct: 2   AIDFEKLQEERLPTLYEVLILKTEKPVDLWSFYTFLSQFPHAINYLEFWIDLMAHIRLCK 61

Query: 65  DYVSTVRQSVV----QGSALEEFRNL---------DERSNVNRH------MNNDEDASVT 105
           DY+  +R SV+    +    +E+ NL          E S+ +R+       + D+ ASVT
Sbjct: 62  DYLENIRSSVIEVVDESRVSDEYGNLTTAGDHRKHKEESSSDRYGPGGNDGDADDSASVT 121

Query: 106 TSILMNTLLSEGYLDFENPEKVSQFLQGNTHTSPMVTRMIQDWKLHNERNSVAATSHLQS 165
           +S+L+N L++EGYLDF++P++V++FLQG+   SP +++++ +W+ H   + +    +   
Sbjct: 122 SSLLINALMNEGYLDFQDPDQVNRFLQGDIEYSPQLSQLLAEWRRH---SGIPGKRNDDV 178

Query: 166 TQAGIDISRKESMQSVS------AIVDEFLKR----QSQLGE--KGNITTKQLYNNAQQI 213
            ++ ID +  E    V       + +D+ LK     Q+  GE  K  ITTKQL++NA QI
Sbjct: 179 NESEIDENTGEKKNQVGYENKILSAIDDLLKNHVSGQNNAGETIKPQITTKQLHHNAAQI 238

Query: 214 CNTYLMSQQHSPRYLANIPDDLKNQVIHNFKANRRHDPEVFRELKEVTYQFLETDCFPKF 273
           C  YL+S + S +YL NIP+ ++   +   + ++R+DP+VF ELK ++YQFLE DCF KF
Sbjct: 239 CTLYLLSPERSDKYLINIPEHVREDTLKAIQNDKRYDPDVFEELKNISYQFLEIDCFTKF 298

Query: 274 LKEVALHNIHDELSDWRFHPSNKNPHRTSSPSGSKENLNGHKQLMQNHISWSPFSTYTSL 333
           L  VALHN+HD++SDWRFH S      ++    ++E     KQL   H S S FS+YT+L
Sbjct: 299 LGRVALHNLHDQISDWRFHNS------STRFLPNEETHEKKKQL--RHHSRSLFSSYTTL 350

Query: 334 SRVLFGCMWMGIGFWIGYVLIFLHYSRAIRVTTVVPFGLGCYYIVCGIYQVDIIYSWFGL 393
           SRV+ G  +MGIGFWIGY LIFL+Y+R IRV T+VPF +G Y+IVCGIYQ+DI Y+ FG+
Sbjct: 351 SRVMLGLFFMGIGFWIGYALIFLNYARGIRVVTIVPFIIGSYFIVCGIYQIDIAYACFGI 410

Query: 394 TQRLMYSHKKGNIEEGRQVYGATYND-DVPLIFTLLGGKSRLIHIEHPFIKKILYKRGLW 452
           TQ LMY HK+   EE          D ++  +F +LGG++RLI I+HPFI+ ++YKRGLW
Sbjct: 411 TQELMYKHKRSPDEETNHSDNLEAKDGEISGLFKILGGQTRLIKIKHPFIRNLIYKRGLW 470

Query: 453 CLTLVVIFTAIFTVIFCCVPGRRL 476
           CL  V+I T +FTVIF CVP RR+
Sbjct: 471 CLLWVLISTGVFTVIFACVPSRRV 494

>YOR301W Chr15 (880965..882272) [1308 bp, 435 aa] {ON}  RAX1Protein
           involved in bud site selection during bipolar budding;
           localization requires Rax2p; has similarity to members
           of the insulin-related peptide superfamily
          Length = 435

 Score =  476 bits (1225), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 240/476 (50%), Positives = 314/476 (65%), Gaps = 51/476 (10%)

Query: 3   STAIDFDQIQHQRLPTLYEVFILKTEPPVDLWSFYTYLSQFPYAINYLDFWIDLMAHIRL 62
           S+  +F+ IQ +RLPTLYEV I +T  PVDLW+FYT+LSQFPYAINYLDFW+DLM H RL
Sbjct: 9   SSMQNFEMIQRERLPTLYEVLIQRTSQPVDLWTFYTFLSQFPYAINYLDFWVDLMTHTRL 68

Query: 63  CKDYVSTVRQSVVQGSALEEFRNLDERSNVNRHMNNDEDASVTTSILMNTLLSEGYLDFE 122
           CK+Y+  VR+S++               N  +    +   S  T  L+N L+ EG+LD E
Sbjct: 69  CKNYIELVRKSLI---------------NFPQEQQQNGSTSTATFDLLNALIEEGHLDPE 113

Query: 123 NPEKVSQFLQGNTHTSPMVTRMIQDWKLHNERNSVAATSHLQSTQAGIDISRKESM--QS 180
            P+K+ +    +   SP +  ++ DWK                 Q+GI    +E++  + 
Sbjct: 114 APDKLLENSGPDVPFSPKLNELLGDWK----------------HQSGIG---QEALRNED 154

Query: 181 VSAIVDEFLKRQSQLGEKGNITTKQLYNNAQQICNTYLMSQQHSPRYLANIPDDLKNQVI 240
           V+ IVDE +KR+SQ   K  ITTKQL ++A  +CNTYL+S + S RYL+NIP + +N++I
Sbjct: 155 VALIVDEIMKRRSQQDGKPQITTKQLLHSAVGLCNTYLVSPEQSERYLSNIPMETRNRII 214

Query: 241 HNFKANRRHDPEVFRELKEVTYQFLETDCFPKFLKEVALHNIHDELSDWRFHPSNKNPHR 300
            + +  R++D E+F +LK +TYQFLE DCFPKFL  VALHNIHDE+SDWRFH       +
Sbjct: 215 ESVQIERKYDIEIFDDLKNLTYQFLEMDCFPKFLSRVALHNIHDEISDWRFHSVGVTNEK 274

Query: 301 TSSPSGSKENLNGHKQLMQNHISWSPFSTYTSLSRVLFGCMWMGIGFWIGYVLIFLHYSR 360
           ++   G            Q HIS SPFS +TS+SR+ FG +W+GIGFWIGYVLIFL YSR
Sbjct: 275 SNRSRG------------QTHISRSPFSNHTSISRIGFGLLWLGIGFWIGYVLIFLAYSR 322

Query: 361 AIRVTTVVPFGLGCYYIVCGIYQVDIIYSWFGLTQRLMYSHKKGNIEEGRQVYGATYNDD 420
           AIRV TVVPF LGCY IVCG+YQVDI+YSWFG+TQRL++ HK    +EG     ++  D 
Sbjct: 323 AIRVVTVVPFTLGCYCIVCGMYQVDIVYSWFGVTQRLLHRHKNAGNDEGD---ASSDTDH 379

Query: 421 VPLIFTLLGGKSRLIHIEHPFIKKILYKRGLWCLTLVVIFTAIFTVIFCCVPGRRL 476
           VP+I  + GG+ RL  IEHPF +++L KRGLWCL LVV  TA FTVIF CVPGRR+
Sbjct: 380 VPMILAVFGGRRRLTRIEHPFTRQLLRKRGLWCLLLVVGATAAFTVIFSCVPGRRV 435

>Smik_15.482 Chr15 (830795..832072) [1278 bp, 425 aa] {ON} YOR301W
           (REAL)
          Length = 425

 Score =  469 bits (1206), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 236/470 (50%), Positives = 307/470 (65%), Gaps = 50/470 (10%)

Query: 7   DFDQIQHQRLPTLYEVFILKTEPPVDLWSFYTYLSQFPYAINYLDFWIDLMAHIRLCKDY 66
           DF++IQ +RLPTLYEV I +T  PVDLW+FYT+LSQFPYAINYLDFW+DLMAH RLCK Y
Sbjct: 6   DFEKIQRERLPTLYEVLIQRTSQPVDLWTFYTFLSQFPYAINYLDFWVDLMAHTRLCKSY 65

Query: 67  VSTVRQSVVQGSALEEFRNLDERSNVNRHMNNDEDASVTTSILMNTLLSEGYLDFENPEK 126
           V  V +S++                       +  AS TT  L+N L+ EG+LD E P +
Sbjct: 66  VELVTKSLIN------------------FPKENGGASTTTLDLLNALIEEGHLDLEAPGR 107

Query: 127 VSQFLQGNTHTSPMVTRMIQDWKLHNERNSVAATSHLQSTQAGIDISRKESMQSVSAIVD 186
           + +    +   SP + +++ DWK    R S  +   L+                ++ IVD
Sbjct: 108 LLKSDGQDMPFSPKLNQLLGDWK----RQSGMSQDSLRR-------------DDIALIVD 150

Query: 187 EFLKRQSQLGEKGNITTKQLYNNAQQICNTYLMSQQHSPRYLANIPDDLKNQVIHNFKAN 246
           E LKR+SQ      ITTKQL+++A  +CNTYL+S + S RYL+NIP + +N++I + +  
Sbjct: 151 EILKRRSQQDGIPQITTKQLFHSAVGLCNTYLVSPEQSERYLSNIPTETRNRIIEDIQVQ 210

Query: 247 RRHDPEVFRELKEVTYQFLETDCFPKFLKEVALHNIHDELSDWRFHPSNKNPHRTSSPSG 306
           +++D EVF ++K +TYQFLE DCFPKFL  VALHNIHDE+SDWRFH  N           
Sbjct: 211 QKYDIEVFDDIKNLTYQFLEMDCFPKFLSRVALHNIHDEISDWRFHSVNAT--------- 261

Query: 307 SKENLNGHKQLMQNHISWSPFSTYTSLSRVLFGCMWMGIGFWIGYVLIFLHYSRAIRVTT 366
              N  G +   Q HIS SPFS +TS+SR+ FG +W+GIGFWIGYVLIFL Y RAIRV T
Sbjct: 262 ---NEKGKRFRGQAHISRSPFSNHTSISRIGFGLLWLGIGFWIGYVLIFLAYGRAIRVVT 318

Query: 367 VVPFGLGCYYIVCGIYQVDIIYSWFGLTQRLMYSHKKGNIEEGRQVYGATYNDDVPLIFT 426
           VVPF LGCY IVCG+YQVDI+YSWFG+TQRL++ HK  + ++     G+   D VP++  
Sbjct: 319 VVPFALGCYCIVCGMYQVDIVYSWFGVTQRLLHRHKNSSSDQDGVSAGS---DHVPVLLA 375

Query: 427 LLGGKSRLIHIEHPFIKKILYKRGLWCLTLVVIFTAIFTVIFCCVPGRRL 476
           + GGK RL  ++HPF +++L KRGLWCL LVV  TA FTVIF CVPGRR+
Sbjct: 376 VFGGKRRLTRVKHPFTRQLLRKRGLWCLLLVVGATAAFTVIFSCVPGRRV 425

>Skud_15.468 Chr15 (820871..822142) [1272 bp, 423 aa] {ON} YOR301W
           (REAL)
          Length = 423

 Score =  460 bits (1184), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 242/472 (51%), Positives = 303/472 (64%), Gaps = 56/472 (11%)

Query: 7   DFDQIQHQRLPTLYEVFILKTEPPVDLWSFYTYLSQFPYAINYLDFWIDLMAHIRLCKDY 66
           DF+++Q  RLPTLYEV I +T  PVDLW+FYT+LSQFPYAINYLDFWIDLMAH RLC+ Y
Sbjct: 6   DFEELQRVRLPTLYEVLIQRTSQPVDLWTFYTFLSQFPYAINYLDFWIDLMAHTRLCQSY 65

Query: 67  VSTVRQSVVQGSALEEFRNLDERSNVNRHMNNDEDASVTTSILMNTLLSEGYLDFENPEK 126
           V  VR+S+V               N  +    +  ASV T  L++ L+ EG+LD E PEK
Sbjct: 66  VELVRKSLV---------------NYPQEQQENGGASVKTHDLLSALVEEGHLDPETPEK 110

Query: 127 VSQFLQGNTHTSPMVTRMIQDWKLHNERNSVAATSHLQSTQAGI--DISRKESMQSVSAI 184
           + Q    +   SP + ++++ WK                 Q+GI  D  R E M   + I
Sbjct: 111 LLQNSGPDLPFSPKLNQLLEGWK----------------RQSGISEDSLRNEDM---TLI 151

Query: 185 VDEFLKRQSQLGEKGNITTKQLYNNAQQICNTYLMSQQHSPRYLANIPDDLKNQVIHNFK 244
           VDE LKR+SQ      ITTKQL ++A  +C TYL S +   RYL+NIP + +N+++ + +
Sbjct: 152 VDEILKRRSQQDGVPQITTKQLLHSAMGLCTTYLASSEQRERYLSNIPTETRNRIVKDVQ 211

Query: 245 ANRRHDPEVFRELKEVTYQFLETDCFPKFLKEVALHNIHDELSDWRFHPSNKNPHRTSSP 304
             RR+D EVF ++K + YQFLE DCFPKFL  VALHNIHDE+SDWRFH       +    
Sbjct: 212 VKRRYDIEVFDDVKNLAYQFLEMDCFPKFLSRVALHNIHDEISDWRFHSVGATNEKNKRV 271

Query: 305 SGSKENLNGHKQLMQNHISWSPFSTYTSLSRVLFGCMWMGIGFWIGYVLIFLHYSRAIRV 364
            G            Q HIS SPFS +TS+SR+ FG +W+GIGFWIGYVLIFL YSRAIRV
Sbjct: 272 RG------------QTHISRSPFSNHTSISRIGFGLLWLGIGFWIGYVLIFLAYSRAIRV 319

Query: 365 TTVVPFGLGCYYIVCGIYQVDIIYSWFGLTQRLMYSHKKGNIEEGRQVYGATYNDDVPLI 424
            TVVPF LGCY IVCG+YQVDI+YSWFG+TQRL++ HK G+  E      +   D VP I
Sbjct: 320 VTVVPFALGCYCIVCGMYQVDIVYSWFGVTQRLLHRHKDGSDNEDD---SSEDFDHVPAI 376

Query: 425 FTLLGGKSRLIHIEHPFIKKILYKRGLWCLTLVVIFTAIFTVIFCCVPGRRL 476
                 KSRL  ++HPFI+++L KRGLWCL LVV  TA FTVIF CVPGRR+
Sbjct: 377 L-----KSRLTCVQHPFIRQLLRKRGLWCLLLVVGATAAFTVIFSCVPGRRV 423

>SAKL0B05456g Chr2 (470064..471362) [1299 bp, 432 aa] {ON} similar
           to uniprot|Q08760 Saccharomyces cerevisiae YOR301W RAX1
           Protein involved in bud site selection during bipolar
           budding localization requires Rax2p
          Length = 432

 Score =  428 bits (1100), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 222/469 (47%), Positives = 307/469 (65%), Gaps = 45/469 (9%)

Query: 10  QIQHQRLPTLYEVFILKTEPPVDLWSFYTYLSQFPYAINYLDFWIDLMAHIRLCKDYVST 69
           ++Q  RLPTLYEV   +T  PVDLWSFYTYLSQFP+AINYLDFWID+MAH+RLCKDYV  
Sbjct: 7   KLQSDRLPTLYEVLNQQTTTPVDLWSFYTYLSQFPHAINYLDFWIDIMAHLRLCKDYVKG 66

Query: 70  VRQSVVQGSALEEFRNLDERSNVNRHMNNDEDASVTTSILMNTLLSEGYLDFENPEKVSQ 129
           +R+SV+     EE          +  ++++  +SV+TS+L+  L+++G LDF++ ++VSQ
Sbjct: 67  IRESVL---VWEEANRPPRIPKHDSGVSDNYRSSVSTSLLLEALMNDGVLDFQDSKRVSQ 123

Query: 130 FLQGNTHTSPMVTRMIQDWKLHNERNSVAATSHLQSTQAGIDISRKESMQSVSAIVDEFL 189
           FLQG T  SP +++++++WK                       S  E    ++ ++D+FL
Sbjct: 124 FLQGQTD-SPRLSQLMENWKRQ---------------------SALEDNDRLTEVLDDFL 161

Query: 190 KRQSQLGEKGNITTKQLYNNAQQICNTYLMSQQHSPRYLANIPDDLKNQVIHNFKANRRH 249
           K++ +  ++  ITTKQL NNA QI N YL S Q SP++L N+P+ ++   IH  +  +RH
Sbjct: 162 KQEMKESQQPRITTKQLLNNALQIVNMYLSSPQQSPKFLVNVPEKIRLDAIHTVQVQQRH 221

Query: 250 DPEVFRELKEVTYQFLETDCFPKFLKEVALHNIHDELSDWRFHPSNKNPHRTSSPSGSKE 309
           DP+VF  LK V +QFLE DCFPKFL  VALHN+HD+++D             SSP G   
Sbjct: 222 DPDVFESLKSVAFQFLEMDCFPKFLGCVALHNLHDDMTD------------HSSPLG--- 266

Query: 310 NLNGHKQLMQNHISWSPFSTYTSLSRVLFGCMWMGIGFWIGYVLIFLHYSRAIRVTTVVP 369
              G     Q H   S FSTYT LSRV  G + +GIGFWIGYVLIFL YSR IRV T+VP
Sbjct: 267 ---GKTATTQRHRKSSLFSTYTILSRVFLGLLLLGIGFWIGYVLIFLDYSRGIRVVTIVP 323

Query: 370 FGLGCYYIVCGIYQVDIIYSWFGLTQRLMYSHKKGNIEEGRQVYGATYND--DVPLIFTL 427
           F LG YY+VCGIYQ+D++Y+ FG+TQ L+ +  K ++E G Q   +  ++   +P+IF +
Sbjct: 324 FFLGFYYVVCGIYQLDVVYALFGVTQNLVTNKDKRDLELGYQRNSSKSSNVRRLPVIFRV 383

Query: 428 LGGKSRLIHIEHPFIKKILYKRGLWCLTLVVIFTAIFTVIFCCVPGRRL 476
           LGG+ RL+ + HPF+ +IL +R +WC  L+++ TAIFTVIF CVPG RL
Sbjct: 384 LGGRGRLVKVRHPFVDRILKRRSVWCWFLILLGTAIFTVIFSCVPGHRL 432

>KNAG0G03100 Chr7 (673022..674413) [1392 bp, 463 aa] {ON} Anc_8.774
           YOR301W
          Length = 463

 Score =  426 bits (1096), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 238/485 (49%), Positives = 310/485 (63%), Gaps = 40/485 (8%)

Query: 7   DFDQIQHQRLPTLYEVFILKTEPPVDLWSFYTYLSQFPYAINYLDFWIDLMAHIRLCKDY 66
           +F QIQ +RLPTLYEV I K+  P+DLWSFYTYLSQFP+AINYLDFWIDLMAHIRLCKD+
Sbjct: 4   NFAQIQKERLPTLYEVLIQKSGAPLDLWSFYTYLSQFPFAINYLDFWIDLMAHIRLCKDF 63

Query: 67  VSTVRQSVVQGSALEEFRNLDERSNVNRHMNNDEDASVTTSILMNTLLSEGYLDFENPEK 126
           +  VR+S+  G A E  RN +++         D+ ASVTTS+LM T++ E  LD   P+ 
Sbjct: 64  IKGVRRSI--GEAAE--RNEEQQGG----GGADDTASVTTSVLMQTIMEEAQLDLNRPDD 115

Query: 127 VSQF-------------LQGNTHTSPMVTRMIQDWKLHNERNSVAATSHLQSTQAGIDIS 173
           V  F             L+ ++  S  V++M+ +W   N R S   T H       +DIS
Sbjct: 116 VYSFFRNSHQQDGLGDNLRASSRYSARVSQMLDEW---NGRTSHRYTGH------SVDIS 166

Query: 174 RKESMQSVSAIVDEFLKRQSQLGEKGN--ITTKQLYNNAQQICNTYLMSQQHSPRYLANI 231
                 +++ ++DEFL   S+    G   ITTKQL +NA  +C TYL+S++ S RYL NI
Sbjct: 167 NG----NLTTLMDEFLNEHSKTRGDGGAYITTKQLLHNATHMCRTYLISREESERYLTNI 222

Query: 232 PDDLKNQVIHNFKANRRHDPEVFRELKEVTYQFLETDCFPKFLKEVALHNIHDELSDWRF 291
           P +++  ++      +++DP +F +LK +TYQFLE DCFPKFL +VALHN+HDE+S+WRF
Sbjct: 223 PTEIREYILVGVLDAKKYDPGIFDDLKTLTYQFLEIDCFPKFLSQVALHNLHDEISNWRF 282

Query: 292 HPSNKNPHRTSSPSGSKENLNGHKQLMQNHISWSPFSTYTSLSRVLFGCMWMGIGFWIGY 351
              NK      S  G     +  K  +    + +PFS YT+LSR+LFG +W+GIGFWIGY
Sbjct: 283 ---NKLDSTKYSGGGGALTGDPEKDAVGYRGAHTPFSNYTTLSRILFGLLWLGIGFWIGY 339

Query: 352 VLIFLHYSRAIRVTTVVPFGLGCYYIVCGIYQVDIIYSWFGLTQRLMYSHKKGNIEEGRQ 411
            LIFL YSRAIRV TVVPF LGCYY +CG+YQVDIIYS FG+TQRL+        E+   
Sbjct: 340 TLIFLKYSRAIRVVTVVPFALGCYYCICGLYQVDIIYSIFGVTQRLLQRETAAAGEDPPT 399

Query: 412 VYGATYNDDVPLIFTLLGGKSRLIHIEHPFIKKILYKRGLWCLTLVVIFTAIFTVIFCCV 471
              AT    VP +  L GG+ RL+ IEH F +++L +RGLWCL LV   TA FTVIF CV
Sbjct: 400 HTDAT-TAKVPSLLVLFGGRGRLLKIEHEFTRRLLLRRGLWCLLLVTFSTAAFTVIFSCV 458

Query: 472 PGRRL 476
           PG R+
Sbjct: 459 PGYRV 463

>TBLA0D00840 Chr4 (221070..222803) [1734 bp, 577 aa] {ON} Anc_8.774
           YOR301W
          Length = 577

 Score =  410 bits (1055), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 228/577 (39%), Positives = 330/577 (57%), Gaps = 106/577 (18%)

Query: 5   AIDFDQIQHQRLPTLYEVFILKTEPPVDLWSFYTYLSQFPYAINYLDFWIDLMAHIRLCK 64
           +ID+ QIQH+RLPTLYEV I K+  P DLWSFYTYLSQFPYAINYL+FWIDLM H RLC+
Sbjct: 2   SIDYKQIQHERLPTLYEVLIQKSSAPADLWSFYTYLSQFPYAINYLEFWIDLMNHNRLCR 61

Query: 65  DYVSTVRQSVVQGSA-------------LEEFRNLD------------------------ 87
             ++ ++ S++Q +              ++++ N D                        
Sbjct: 62  HLINEIKNSLIQNNKNNPHLNEEDLQKIIDKYSNNDILPPSMPLPQAVSTPPADFDTIDE 121

Query: 88  -ERSNV--------NRHMNNDEDASVTTSILMNTLLSEGYLDFENPEKVSQFLQGNTHTS 138
            ER ++        +  ++ND D S+T+SIL+N L++EGYL+ ++  ++S+F QGN   S
Sbjct: 122 VERESLSNMPIPEQDEDIDNDND-SITSSILLNVLMNEGYLNPDDHYRMSKFFQGNIGGS 180

Query: 139 P--MVTRMIQDWKLHNERNSVAATSHLQSTQAGIDISRKESM-------QSVSAIVDEFL 189
               +++++Q+W+ HN+ ++   T    + +     +   S        +  +A+VDE L
Sbjct: 181 NDYRMSQLMQNWQRHNDNSNSNNTRQTNTGETNNAGNNSNSNSYTNNTTERFAAMVDELL 240

Query: 190 KR-------------QSQLGEK------------GNITTKQLYNNAQQICNTYLMSQQHS 224
           +              Q  + E+              +TT+ L  NA+ ICN YL+S + S
Sbjct: 241 QNNRIPMPSPILPNTQENIQEQEDQANASSSSFLNGLTTRDLIKNARNICNLYLISPEKS 300

Query: 225 PRYLANIPDDLKNQVIHNFKANRRHDPEVFRELKEVTYQFLETDCFPKFLKEVALHNIHD 284
            +YL NIP+ +K  +I   K   R DP +F +L+ +TY FLE DCFPKFL ++ALHNIHD
Sbjct: 301 KKYLINIPETIKFDIIKKIKFENRFDPLIFDDLQNLTYNFLEVDCFPKFLSKIALHNIHD 360

Query: 285 ELSDWRFHPS------NKNPHRTSSPSGSKENLNGHKQL-------------MQNHISWS 325
           ++SDWRFH S      N+  +R  S + +  + +  K               + NHIS S
Sbjct: 361 QISDWRFHSSFKLTSQNRKSNRGLSENDNSSSTDNEKNYQSDNDDNDSMIYNIDNHISRS 420

Query: 326 PFSTYTSLSRVLFGCMWMGIGFWIGYVLIFLHYSRAIRVTTVVPFGLGCYYIVCGIYQVD 385
           PFS YT +SR+  G +W+GIGFWIGY LIFL+YSR IRVTT+ PF  GCYYI+CG+YQ+D
Sbjct: 421 PFSNYTIISRLFVGFIWLGIGFWIGYTLIFLNYSRGIRVTTLPPFLFGCYYIICGLYQLD 480

Query: 386 IIYSWFGLTQRLMYSHKKGNIEEGRQVYGATYND------DVPLIFTLLGGKSRLIHIEH 439
           I YS FG+TQ LM+  K+  +   +++   T  +       +P  F L GGK RLI I+H
Sbjct: 481 IFYSLFGVTQDLMFQPKRNLLHANKKIDKTTKKNLKHLKRGIPFFFNLFGGKKRLIKIDH 540

Query: 440 PFIKKILYKRGLWCLTLVVIFTAIFTVIFCCVPGRRL 476
           P+I+ +L+KRG+WC  LV + TA  TVIF  VPG R+
Sbjct: 541 PYIRNLLFKRGIWCAILVALSTAGLTVIFSVVPGWRV 577

>KLTH0H15070g Chr8 (1304724..1306040) [1317 bp, 438 aa] {ON} similar
           to uniprot|Q08760 Saccharomyces cerevisiae YOR301W RAX1
           Protein involved in bud site selection during bipolar
           budding localization requires Rax2p
          Length = 438

 Score =  399 bits (1024), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 214/470 (45%), Positives = 300/470 (63%), Gaps = 49/470 (10%)

Query: 14  QRLPTLYEVFILKTEPPVDLWSFYTYLSQFPYAINYLDFWIDLMAHIRLCKDYVSTVRQS 73
           QRLPTLYEV   +T  PVDLWSFYT+LSQ+PYAIN+LDFWID MAH+RLCKDYV  VR+S
Sbjct: 11  QRLPTLYEVLNRQTCAPVDLWSFYTFLSQYPYAINFLDFWIDAMAHLRLCKDYVKGVRES 70

Query: 74  VVQGSALEEFRNLDERSNVNRHMNNDED--ASVTTSILMNTLLSEGYLDFENPEKVSQFL 131
            V      E+ +  ERS  NR   +  D   S+++S+L+  L+++G+LD+E+ ++VS+FL
Sbjct: 71  FV------EWEDSQERSGANRDSRDSHDNRDSLSSSLLLEALMNDGFLDYEDSKRVSRFL 124

Query: 132 QGNTHTSPMVTRMIQDWKLHNERNSVAATSHLQSTQAGIDISRKESMQSVSAIVDEFLKR 191
           QG T  SP +T+++ +W+   E +S A                      ++ +VDEFLK 
Sbjct: 125 QGQTD-SPRLTKLLDNWQKQTEHDSDAPFK-----------------SPLTGLVDEFLKT 166

Query: 192 QSQLGEKGNITTKQLYNNAQQICNTYLMSQQHSPRYLANIPDDLKNQVIHNFKANRRHDP 251
           Q+Q  +K  IT+K+L NNA+ I +TYL++ + S RYL N+PD ++   +H     +RHDP
Sbjct: 167 QAQDFQKARITSKELLNNARNIVHTYLLAPEESSRYLINLPDHMRQNAVHMVLEEKRHDP 226

Query: 252 EVFRELKEVTYQFLETDCFPKFLKEVALHNIHDELSDWRFHPSNKNPHRTSSPSGSKENL 311
           +VF +LK +++QFLE DCFPKFL  VALHN+HD+++      S+      SS  G + +L
Sbjct: 227 DVFEQLKAISFQFLEMDCFPKFLSCVALHNLHDDITSSSL--SDPLAILGSSAPGRRRSL 284

Query: 312 NGHKQLMQNHISWSPFSTYTSLSRVLFGCMWMGIGFWIGYVLIFLHYSRAIRVTTVVPFG 371
                          F+ YT+LSRV+ G +++ +G W+GY L+FL+YSR IRVTT+VPF 
Sbjct: 285 ---------------FARYTTLSRVVLGMIFLWMGLWLGYTLVFLNYSRGIRVTTIVPFF 329

Query: 372 LGCYYIVCGIYQVDIIYSWFGLTQRL----MYSHKKGNIEEGRQ-VYGATYNDDVPLIFT 426
           LG Y+I CGIY++DI+Y+  G+TQ L    + S K   I   R  V+  T     P +F 
Sbjct: 330 LGFYFIWCGIYKIDILYALCGVTQTLVSNELVSSKDLEIGLNRNAVHNKTRQSTSP-VFR 388

Query: 427 LLGGKSRLIHIEHPFIKKILYKRGLWCLTLVVIFTAIFTVIFCCVPGRRL 476
           + GG SRL+ I+ PF+  +L +R LWCL LV+  TAIFTVIF CVPG RL
Sbjct: 389 VFGGSSRLVSIQQPFVNSMLRRRALWCLVLVLAGTAIFTVIFSCVPGHRL 438

>Kwal_34.15943 s34 complement(128372..129670) [1299 bp, 432 aa] {ON}
           YOR301W (RAX1) - Similar to B-chains of the
           insulin-related hormone superfamily. [contig 272] FULL
          Length = 432

 Score =  397 bits (1019), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 211/466 (45%), Positives = 293/466 (62%), Gaps = 48/466 (10%)

Query: 15  RLPTLYEVFILKTEPPVDLWSFYTYLSQFPYAINYLDFWIDLMAHIRLCKDYVSTVRQSV 74
           RLPTL+EV   ++  PVDLWSFY +LSQ+PYAIN+LDFWID+MAH+RLCKDYV  +R+SV
Sbjct: 11  RLPTLFEVLNRQSAAPVDLWSFYIFLSQYPYAINFLDFWIDVMAHLRLCKDYVKGIRESV 70

Query: 75  VQGSALEEFRNLDERSNVNRHMNNDEDASVTTSILMNTLLSEGYLDFENPEKVSQFLQGN 134
           +      E+ +  ERS  NR   +   +S+    LMN    +GYLD+E+ ++VS+FLQG+
Sbjct: 71  I------EWEDSLERSGANRDSRDSLSSSLLLEALMN----DGYLDYEDSKRVSRFLQGH 120

Query: 135 THTSPMVTRMIQDWKLHNERNSVAATSHLQSTQAGIDISRKESMQSVSAIVDEFLKRQSQ 194
           T  SP +TR++ +W+ H +++S  A                     ++ +VD+FLK Q+ 
Sbjct: 121 T-DSPRLTRLLDNWQKHADQDSAGAPFK----------------SPLTGLVDDFLKTQAH 163

Query: 195 LGEKGNITTKQLYNNAQQICNTYLMSQQHSPRYLANIPDDLKNQVIHNFKANRRHDPEVF 254
              K  IT+K+L NNAQ I NTYL+S + S RYL N+PD ++   +   +  +RHDPE+F
Sbjct: 164 DFHKARITSKELLNNAQNIVNTYLLSPETSVRYLINLPDHMRENTLRMVRDEKRHDPELF 223

Query: 255 RELKEVTYQFLETDCFPKFLKEVALHNIHDELSDWRFHPSNKNPHRTSSPSGSKENLNGH 314
            +LK + +QFLE DCFPKFL  VALHN+HD++              T+ P  + +     
Sbjct: 224 EQLKSLAFQFLEMDCFPKFLTSVALHNLHDDI--------------TTPPLTAPQTPAHE 269

Query: 315 KQLMQNHISWSPFSTYTSLSRVLFGCMWMGIGFWIGYVLIFLHYSRAIRVTTVVPFGLGC 374
               + H   SPF+ +T+LSRV  G +++ +G W+GY LIFL YSR IRVTT+VPF LG 
Sbjct: 270 PSFTRRH---SPFAHHTTLSRVALGMLFLWMGLWLGYTLIFLDYSRGIRVTTIVPFFLGF 326

Query: 375 YYIVCGIYQVDIIYSWFGLTQRLM----YSHKKGNIEEGRQVYGATYNDDVPLIFTLLGG 430
           Y+I CGIY++DI+Y+  G+TQ L+     S K   I   R       + + P +F +LGG
Sbjct: 327 YFICCGIYRIDILYALAGVTQTLVSNEQVSLKDLEIGLNRNSVNHRMSHNAPFVFRILGG 386

Query: 431 KSRLIHIEHPFIKKILYKRGLWCLTLVVIFTAIFTVIFCCVPGRRL 476
             RL+ I+HPFI K+L KRG WCL LV+  T +FTVIF CVPGRRL
Sbjct: 387 TGRLVRIKHPFINKLLKKRGYWCLLLVLTLTGVFTVIFSCVPGRRL 432

>KLLA0F24904g Chr6 complement(2319858..2321132) [1275 bp, 424 aa]
           {ON} similar to uniprot|Q08760 Saccharomyces cerevisiae
           YOR301W RAX1 Protein involved in bud site selection
           during bipolar budding localization requires Rax2p
          Length = 424

 Score =  385 bits (990), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 206/469 (43%), Positives = 283/469 (60%), Gaps = 56/469 (11%)

Query: 12  QHQRLPTLYEVFILKTEPPVDLWSFYTYLSQFPYAINYLDFWIDLMAHIRLCKDYVSTVR 71
           Q  RLPTLYEV   +T  P+DLWSFYTYLSQ+P+AI YLDFW D+MA++RLCKDYV  +R
Sbjct: 8   QRARLPTLYEVLNQQTAAPLDLWSFYTYLSQYPHAIVYLDFWTDVMAYLRLCKDYVKGIR 67

Query: 72  QSVVQGSALEEFRNLDERSNVNRHMNNDEDASVTTSILMNTLLSEGYLDFENPEKVSQFL 131
           +SV+  + LE    L E +       +D+  SV++++L+  L+++GYLD+ + ++VSQFL
Sbjct: 68  ESVLDVNKLETPTVLQEGNG------DDKRESVSSAMLLEALMNDGYLDYNDSQRVSQFL 121

Query: 132 QGNTHTSPMVTRMIQDWKLHNERNSVAATSHLQSTQAGIDISRKESMQSVSAIVDEFLKR 191
           +G T  SP +++++QDWK              Q     ID S           VD  +K 
Sbjct: 122 KGETD-SPRLSQLLQDWK--------------QVNNDQIDFS---------DFVDGLVKS 157

Query: 192 QSQLGEKGNITTKQLYNNAQQICNTYLMSQQHSPRYLANIPDDLKNQVIHNFKANRRHDP 251
                 K  +TTKQL ++AQ I +TYL+SQ+ S R+L  IP  L+N  I      +RHDP
Sbjct: 158 NVTKDHKPKLTTKQLISSAQDIVSTYLLSQEQSDRFLFEIPAYLRNDTIRLIMEEKRHDP 217

Query: 252 EVFRELKEVTYQFLETDCFPKFLKEVALHNIHDELSDWRFHPSNKNPHRTSSPSGSKENL 311
           EVF  +KE+ YQFLE DCFP+FL  VALHN+HDE+   R       P +  S        
Sbjct: 218 EVFEPIKEIVYQFLEVDCFPRFLGCVALHNLHDEIVLQR-------PKKNKS-------- 262

Query: 312 NGHKQLMQNHISWSPFSTYTSLSRVLFGCMWMGIGFWIGYVLIFLHYSRAIRVTTVVPFG 371
                   N  S SPFS +++ SR+  G  W  +G WIGY LIF++YS+ IRV  +VPF 
Sbjct: 263 -------YNSRSNSPFSQWSTASRLTIGLAWWLVGLWIGYTLIFMNYSKGIRVVCIVPFF 315

Query: 372 LGCYYIVCGIYQVDIIYSWFGLTQRLMYSHKKGNIE----EGRQVYGATYNDDVPLIFTL 427
           LG YYI+CGIY VDIIY++ G+TQ L+   K  ++E       +      +++VP   T+
Sbjct: 316 LGSYYIICGIYLVDIIYAFSGVTQTLVSKRKLDDLELRSMNNHRSNSLHSSNEVPWWLTI 375

Query: 428 LGGKSRLIHIEHPFIKKILYKRGLWCLTLVVIFTAIFTVIFCCVPGRRL 476
            GG+SRL  ++HPF+  I+ +R LWCL LV+I TAI T IF  VPGRR+
Sbjct: 376 FGGRSRLCKVKHPFVNSIMIRRALWCLLLVLIMTAILTAIFAAVPGRRI 424

>Suva_8.352 Chr8 (621701..623104) [1404 bp, 467 aa] {ON} YOR301W
           (REAL)
          Length = 467

 Score =  385 bits (988), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 209/437 (47%), Positives = 276/437 (63%), Gaps = 58/437 (13%)

Query: 7   DFDQIQHQRLPTLYEVFILKTEPPVDLWSFYTYLSQFPYAINYLDFWIDLMAHIRLCKDY 66
           DF++IQ++RLPTLYEV I +T  PVDLW+FYT+LSQFPYAINYLDFW+DLMAH RLC+ Y
Sbjct: 6   DFEKIQYERLPTLYEVLIQRTSRPVDLWTFYTFLSQFPYAINYLDFWVDLMAHTRLCQSY 65

Query: 67  VSTVRQSVVQGSALEEFRNLDERSNVNRHMNNDEDASVTTSILMNTLLSEGYLDFENPEK 126
           V  VR+S+               +N  +      D S TT  L++ L+ EG+L+ ++PE 
Sbjct: 66  VKMVRKSL---------------ANFPQEHQQKGDGSATTFNLLDALIEEGHLNLQSPEN 110

Query: 127 VSQFLQGNTHTSPMVTRMIQDWKLHNERNSVAATSHLQSTQAGI--DISRKESMQSVSAI 184
           + Q    +   SP +  M+ +WK H                +GI  D  + E M   + I
Sbjct: 111 LLQNEPSDVPFSPKLNEMLGNWKHH----------------SGISQDALQNEDM---ALI 151

Query: 185 VDEFLKRQSQLGEKGNITTKQLYNNAQQICNTYLMSQQHSPRYLANIPDDLKNQVIHNFK 244
           +DE LKR+SQ      ITTKQL ++A  +C TYL+S + S RYL+NIP + + +++ + +
Sbjct: 152 LDEILKRRSQQDGVPQITTKQLLHSAMGLCTTYLVSPEQSERYLSNIPAETRTRILEDIQ 211

Query: 245 ANRRHDPEVFRELKEVTYQFLETDCFPKFLKEVALHNIHDELSDWRFHPSNKNPHRTSSP 304
            +R++D  +F ++K +TYQFLE DCFPKFL  VALHNIHDE+SDWRFH  N         
Sbjct: 212 VDRKYDVAIFDDVKALTYQFLEMDCFPKFLSRVALHNIHDEISDWRFHSKNS-------- 263

Query: 305 SGSKENLNGHKQLMQNHISWSPFSTYTSLSRVLFGCMWMGIGFWIGYVLIFLHYSRAIRV 364
                     +   Q HIS SPFS +TS+SR+  G +W+GIGFWIGYVLIFL Y RAIRV
Sbjct: 264 ----------RSRGQTHISRSPFSNHTSISRIGLGLLWLGIGFWIGYVLIFLAYGRAIRV 313

Query: 365 TTVVPFGLGCYYIVCGIYQVDIIYSWFGLTQRLMYSHKKGNIEEGRQVYGATYNDDVPLI 424
            TVVPF LGCY +VCG+YQVDI+YSWFG+TQRL++ HK  N         AT  D VP +
Sbjct: 314 VTVVPFALGCYCVVCGMYQVDIVYSWFGVTQRLLHRHKNSND----DAGAATDADHVPGV 369

Query: 425 FTLLGGKSRLIHIEHPF 441
             + GGKSRL  ++HPF
Sbjct: 370 LAVFGGKSRLTSVQHPF 386

>AFR532W Chr6 (1391215..1392483) [1269 bp, 422 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR301W (RAX1)
          Length = 422

 Score =  342 bits (878), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 186/473 (39%), Positives = 273/473 (57%), Gaps = 63/473 (13%)

Query: 10  QIQHQRLPTLYEVFILKTEPPVDLWSFYTYLSQFPYAINYLDFWIDLMAHIRLCKDYVST 69
           ++Q +RLPTL+EV   +T  PVD WSFYT+L Q+P A+NY+DFW+D+MAH+RLCKDYV  
Sbjct: 7   RLQSERLPTLFEVLNNQTAAPVDSWSFYTFLFQYPGALNYMDFWVDVMAHLRLCKDYVKG 66

Query: 70  VRQSVVQGSALEEFRNLDERSNVNRHMNNDEDASVTTSILMNTLLSEGYLDFENPEKVSQ 129
           +R+S++    L E      RS      + ++  S+++S+L++ LL++GYLD+ +  ++SQ
Sbjct: 67  IRESMM----LLEVEEQQGRSRGRPAGSTEKRQSLSSSVLLDALLNDGYLDYHDNRRISQ 122

Query: 130 FLQGNTHTSPMVTRMIQDWKLHNERNSVAATSHLQSTQAGIDISRKESMQS--VSAIVDE 187
           FL+G+  +                    A  S L   + G     K   +   +S ++DE
Sbjct: 123 FLKGDGES--------------------ARLSQLFEGRGGDSSGEKAPTEEPHLSLMLDE 162

Query: 188 FLKRQSQLGEKGNITTKQLYNNAQQICNTYLMSQQ--HSPRYLANIPDDLKNQVIHNFKA 245
           FL RQ +  ++  +TTKQL  +A  I + YL+S+    S R L  +P+ ++ +VI+  K 
Sbjct: 163 FLVRQMKESQRPKLTTKQLVASANTIVDRYLVSKDSMRSERLLTTVPEHMRLEVINLVKG 222

Query: 246 NRRHDPEVFRELKEVTYQFLETDCFPKFLKEVALHNIHDELSDWRFHPSNKNPHRTSSPS 305
            +R+DP+VF  LK +++QFLE  CFPKFL  VALHN+H ++S                  
Sbjct: 223 EQRYDPDVFEPLKIISFQFLEIYCFPKFLSSVALHNLHYDIS------------------ 264

Query: 306 GSKENLNGHKQLMQNHISWSPFSTYTSLSRVLFGCMWMGIGFWIGYVLIFLHYSRAIRVT 365
                       +    S SP+S  T+L+RV  G  +  +GFW+GY LIFL Y R +R  
Sbjct: 265 ------------LSQKASRSPYSQCTTLARVATGFFFWAVGFWVGYSLIFLDYPRRVRTV 312

Query: 366 TVVPFGLGCYYIVCGIYQVDIIYSWFGLTQRLMYSHKKGNIEEG--RQVYGATYNDDVPL 423
           T+VPF +G YYIVCG+Y +DIIY+  G+TQ L+   +    E G  ++   AT    VP 
Sbjct: 313 TLVPFLIGSYYIVCGVYHLDIIYAVCGVTQTLISPRRYEEPELGLDQKQNSAT---KVPF 369

Query: 424 IFTLLGGKSRLIHIEHPFIKKILYKRGLWCLTLVVIFTAIFTVIFCCVPGRRL 476
            FT LGG+ RL  + HPF+  I+ KR LWCL LV++ TA+ TVIF  VP  RL
Sbjct: 370 FFTFLGGRKRLTKVRHPFVLNIMRKRALWCLFLVIVTTAVLTVIFTAVPSVRL 422

>Ecym_1476 Chr1 (980938..982299) [1362 bp, 453 aa] {ON} similar to
           Ashbya gossypii AFR532W
          Length = 453

 Score =  325 bits (832), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 181/480 (37%), Positives = 277/480 (57%), Gaps = 46/480 (9%)

Query: 10  QIQHQRLPTLYEVFILKTEPPVDLWSFYTYLSQFPYAINYLDFWIDLMAHIRLCKDYVST 69
           + Q +RLPTLYEV   +T  PVD WSFYT+L Q+P A+NY+DFW+D+MAH+RLCKDYV  
Sbjct: 7   RFQSERLPTLYEVLTNQTAAPVDSWSFYTFLFQYPGALNYMDFWVDVMAHLRLCKDYVRG 66

Query: 70  VRQSV----VQGSALEEFRNLDERSNVNRHMNNDEDASVTTSIL-------MNTLLSEGY 118
           +R+S+    V+    ++       S V+   ++    +   + +       ++ LL++GY
Sbjct: 67  IRESMLLLEVEEQQQQQKHRQKRHSQVSAAGSDAAADNNNNNRMSVSSSLLLDALLNDGY 126

Query: 119 LDFENPEKVSQFLQGNTHTSPMVTRMIQDWKLHNERNSVAATSHLQSTQAGIDISRKESM 178
           LD+ + +++SQFL+G    S   ++++++   H               + G         
Sbjct: 127 LDYHDNKRISQFLKGEAD-SDRFSQLLENLP-HGAEGGEGNNKGYDGEEPGHGDYATAED 184

Query: 179 QSVSAIVDEFLKRQSQLGEKGNITTKQLYNNAQQICNTYLMSQQH--SPRYLANIPDDLK 236
             +S ++DE+L RQ +  ++  +TTKQL  +A  I + YL+++ +  S R L ++P+ ++
Sbjct: 185 AHLSVMLDEYLVRQMKESQRPKLTTKQLIASANAIVDRYLVAKDNMRSERLLTSVPEHMR 244

Query: 237 NQVIHNFKANRRHDPEVFRELKEVTYQFLETDCFPKFLKEVALHNIHDELSDWRFHPSNK 296
            +VI+  K  +R+DP+VF  LK +++QFLE  CFPKFL  VALHN+H ++S         
Sbjct: 245 LEVINMVKGEQRYDPDVFEPLKIISFQFLEIYCFPKFLSSVALHNLHYDVS--------- 295

Query: 297 NPHRTSSPSGSKENLNGHKQLMQNHISWSPFSTYTSLSRVLFGCMWMGIGFWIGYVLIFL 356
                                +      SP+S  T+LSRV  G  + GIGFW+GY LIFL
Sbjct: 296 ---------------------LTQKTRTSPYSQCTTLSRVATGFFFWGIGFWVGYTLIFL 334

Query: 357 HYSRAIRVTTVVPFGLGCYYIVCGIYQVDIIYSWFGLTQRLMYSHKKGNIEEGRQVYGAT 416
            Y+R +R  T++PF +GCYYIVCGIY +DIIY+  G+TQ L+   +    E G +    T
Sbjct: 335 DYNRKVRTVTLLPFFVGCYYIVCGIYHLDIIYAICGVTQTLVSPRRFAEPELGLK-KSKT 393

Query: 417 YNDDVPLIFTLLGGKSRLIHIEHPFIKKILYKRGLWCLTLVVIFTAIFTVIFCCVPGRRL 476
            +  VPL+F+LLGG++RL  + HPF+  I+ KR LWCL LV++ TA+ T IF  VP  RL
Sbjct: 394 NSAKVPLLFSLLGGRNRLTKVRHPFVLNIMRKRALWCLFLVLVTTAVLTTIFTAVPSTRL 453

>YGR188C Chr7 complement(872044..875109) [3066 bp, 1021 aa] {ON}
           BUB1Protein kinase involved in the cell cycle checkpoint
           into anaphase; forms complex with Mad1p and Bub3p
           crucial to preventing cell cycle progression into
           anaphase in the presence of spindle damage;
           CDC28-mediated phosphorylation at Bub1p-T566 is
           important for its degradation in anaphase and adaptation
           of the checkpoint to prolonged mitotic arrest, but not
           to its kinase activity or chromosome segregation
           function; associates with centromere DNA via Skp1p
          Length = 1021

 Score = 33.9 bits (76), Expect = 0.96,   Method: Compositional matrix adjust.
 Identities = 29/94 (30%), Positives = 42/94 (44%), Gaps = 4/94 (4%)

Query: 54  IDLMAHIRLCKDYVSTVRQSVVQGSALEEFRNLDERSNVNRHMNNDEDASVTTSILMNTL 113
           +D++   R  +D  S+    V + + +E F++ D  S    H N       TTSIL    
Sbjct: 371 LDVLVERR--QDLPSSQPPVVPKSTRIEVFKDDDNPSQSTHHKNTQVQVQTTTSILPLKP 428

Query: 114 LSEGYLDFENPEKVSQFLQGNTHTSPMVTRMIQD 147
           + +G L  E P K S  L  N   SP VT   +D
Sbjct: 429 VVDGNLAHETPVKPS--LTSNASRSPTVTAFSKD 460

>Suva_10.260 Chr10 complement(463944..465332) [1389 bp, 462 aa] {ON}
           YLR163C (REAL)
          Length = 462

 Score = 33.5 bits (75), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 36/129 (27%), Positives = 58/129 (44%), Gaps = 8/129 (6%)

Query: 133 GNTHTSPMVTRMIQDWKLHNERNSVAATSHLQSTQAGIDISRKESMQSVSAIVDEFLKRQ 192
           G    SP+     Q+  L N   S + TS+  S   G+ I    +  +V  IVDE LK  
Sbjct: 302 GTNSPSPLAVSASQNGPLANSYMSFS-TSYADSGLWGMYIVTDSNEHNVKLIVDEILKEW 360

Query: 193 SQLGEKGNITTKQLYNNAQQICNTYLMSQQHSPRYLANIPDDLKNQVIHNFKANRRHDPE 252
            ++ + GNI+  ++     Q+    L+S   S      I +D+  QV+   K  R    E
Sbjct: 361 KRI-KSGNISDIEVNRAKAQLKAALLLSLDGS----TAIVEDIGRQVVTTGK--RLLPEE 413

Query: 253 VFRELKEVT 261
           VF ++ ++T
Sbjct: 414 VFEQVDKIT 422

>Smik_12.225 Chr12 complement(439006..440394) [1389 bp, 462 aa] {ON}
           YLR163C (REAL)
          Length = 462

 Score = 33.5 bits (75), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 36/129 (27%), Positives = 54/129 (41%), Gaps = 8/129 (6%)

Query: 133 GNTHTSPMVTRMIQDWKLHNERNSVAATSHLQSTQAGIDISRKESMQSVSAIVDEFLKRQ 192
           G    SP+     Q   L N   S + TS+  S   G+ I    +   V  IVDE LK  
Sbjct: 302 GTNSPSPLAVAASQSGPLANSYMSFS-TSYADSGLWGMYIVTDSNEHDVKLIVDEILKEW 360

Query: 193 SQLGEKGNITTKQLYNNAQQICNTYLMSQQHSPRYLANIPDDLKNQVIHNFKANRRHDPE 252
            ++ + G IT  ++     Q+    L+S   S      I +D+  QV+   K  R    E
Sbjct: 361 KRI-KSGKITDTEVNRAKAQLKAALLLSLDGS----TAIVEDIGRQVVTTGK--RLSPEE 413

Query: 253 VFRELKEVT 261
           VF ++  +T
Sbjct: 414 VFEQVDRIT 422

>CAGL0H02739g Chr8 (248511..249908) [1398 bp, 465 aa] {ON} highly
           similar to uniprot|P10507 Saccharomyces cerevisiae
           YLR163c MAS1
          Length = 465

 Score = 33.1 bits (74), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 28/105 (26%), Positives = 51/105 (48%), Gaps = 7/105 (6%)

Query: 159 ATSHLQSTQAGIDISRKESMQSVSAIVDEFLKRQSQLGEKGNITTKQLYNNAQQICNTYL 218
           +TS+  S   G+ I    +  +V AI+DE LK   ++ + GNIT  ++  +  Q+    L
Sbjct: 330 STSYADSGLWGMYIVTDSNEHNVQAIIDEVLKEWRRI-KAGNITDDEVNRSKAQLKAALL 388

Query: 219 MSQQHSPRYLANIPDDLKNQVIHNFKANRRHDPEVFRELKEVTYQ 263
           +S   +   L    +D+  Q++   K  R    EVF ++  +T +
Sbjct: 389 LSLDDTTAIL----EDIGRQIVTTGK--RLSPEEVFEKVDNITKE 427

>Skud_12.230 Chr12 complement(438565..439953) [1389 bp, 462 aa] {ON}
           YLR163C (REAL)
          Length = 462

 Score = 32.7 bits (73), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 35/131 (26%), Positives = 58/131 (44%), Gaps = 8/131 (6%)

Query: 133 GNTHTSPMVTRMIQDWKLHNERNSVAATSHLQSTQAGIDISRKESMQSVSAIVDEFLKRQ 192
           G    SP+     Q+  L N   S + TS+  S   G+ I    +  +V  IVDE LK  
Sbjct: 302 GTNSPSPLAAAASQNGPLANSYMSFS-TSYADSGLWGMYIVTDSNEHNVKLIVDEILKEW 360

Query: 193 SQLGEKGNITTKQLYNNAQQICNTYLMSQQHSPRYLANIPDDLKNQVIHNFKANRRHDPE 252
            ++ + G I+  ++     Q+    L+S   S      I +D+  QV+   K  R    E
Sbjct: 361 KRI-KSGKISDVEVNRAKAQLKAALLLSLDGS----TAIVEDIGRQVVTTGK--RLSPEE 413

Query: 253 VFRELKEVTYQ 263
           VF ++ ++T +
Sbjct: 414 VFEQVDKITKE 424

>ZYRO0C12716g Chr3 (1008641..1016227) [7587 bp, 2528 aa] {ON} similar
            to uniprot|Q06116 Saccharomyces cerevisiae YPR117W
            Hypothetical ORF
          Length = 2528

 Score = 33.1 bits (74), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 39/90 (43%), Gaps = 7/90 (7%)

Query: 151  HNERNSVAATSHLQSTQAGIDISR-KESMQSVSAIVDEFLKRQSQLGEKGNITTKQLYNN 209
             N    +      +STQ  + I R KE  Q ++AI     K +   GE GN+   Q Y+ 
Sbjct: 1625 ENSHKCLMGKDDSESTQKRLVIDRHKEIEQEINAITS---KLEEMTGESGNL---QTYHT 1678

Query: 210  AQQICNTYLMSQQHSPRYLANIPDDLKNQV 239
              Q  +  L   +H    + NI DDL+N  
Sbjct: 1679 QYQYLSQKLHKAKHRLFIIENILDDLRNSA 1708

>KLLA0D18095g Chr4 complement(1526808..1528217) [1410 bp, 469 aa]
           {ON} highly similar to uniprot|P10507 Saccharomyces
           cerevisiae YLR163C MAS1 Smaller subunit of the
           mitochondrial processing protease essential processing
           enzyme that cleaves the N-terminal targeting sequences
           from mitochondrially imported proteins
          Length = 469

 Score = 31.6 bits (70), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 32/131 (24%), Positives = 56/131 (42%), Gaps = 8/131 (6%)

Query: 133 GNTHTSPMVTRMIQDWKLHNERNSVAATSHLQSTQAGIDISRKESMQSVSAIVDEFLKRQ 192
           G    SP+     ++  L N   S + TS+  S   G+ I        +  I+DE LK  
Sbjct: 309 GTNSPSPLAVAASENGTLTNSYMSFS-TSYADSGLWGMYIVADSQQHDIKLIIDEILKEW 367

Query: 193 SQLGEKGNITTKQLYNNAQQICNTYLMSQQHSPRYLANIPDDLKNQVIHNFKANRRHDPE 252
            ++   G I+  ++     ++  + L+S   S      I +D+  QV+   K  R    E
Sbjct: 368 KRI-RSGRISDDEVNRAKARLKASLLLSLDGS----TAIAEDIGRQVVTTGK--RLSPEE 420

Query: 253 VFRELKEVTYQ 263
           VF ++ ++T Q
Sbjct: 421 VFEQVNKITKQ 431

>NDAI0A06860 Chr1 complement(1560888..1563008) [2121 bp, 706 aa]
           {ON} Anc_3.130 YOL076W
          Length = 706

 Score = 31.6 bits (70), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 27/97 (27%), Positives = 46/97 (47%), Gaps = 12/97 (12%)

Query: 167 QAGIDISRKESMQSVSAIVDEFL--KRQSQLGE-------KGNITTKQLYNNAQQICNTY 217
           +AG ++ R  +   +  I+D F+   R S+LG           IT   L++  +++ N  
Sbjct: 186 KAGKELGR--TKIELFEIIDSFVGDSRNSRLGRLEGDLIFNDEITEASLFHYTEKLHNKP 243

Query: 218 LMSQQHSPRYLANIPDDLKNQVIHNFKANRRHDPEVF 254
             +   S  Y   IPD+L  +V+ NF ++  HD  VF
Sbjct: 244 CFAVDIS-YYKTKIPDELLKKVMSNFDSDLIHDANVF 279

>YPR075C Chr16 complement(695737..696819) [1083 bp, 360 aa] {ON}
           OPY2Integral membrane protein that functions in the
           signaling branch of the high-osmolarity glycerol (HOG)
           pathway; interacts with Ste50p; overproduction blocks
           cell cycle arrest in the presence of mating pheromone
          Length = 360

 Score = 31.2 bits (69), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 37/79 (46%), Gaps = 17/79 (21%)

Query: 80  LEEFRNLDERSNVNR----HMNNDEDASVTTSILMNTLLSEGYLDFENPEKVSQFLQGNT 135
           +EE    D+ S++ +    H NNDED     S +         LD E PE + +  QG+ 
Sbjct: 295 IEEQTEADDLSHMAKSEASHGNNDEDDDEEGSFI---------LDLEIPESIRESTQGSR 345

Query: 136 HTSPMVTRMIQDWKLHNER 154
             SP   +    +++H+ER
Sbjct: 346 TESPFEDK----FEIHDER 360

>CAGL0E01265g Chr5 complement(113167..119454) [6288 bp, 2095 aa] {ON}
            some similarities with uniprot|Q03767 Saccharomyces
            cerevisiae YDR150w NUM1 nuclear migration protein
          Length = 2095

 Score = 31.2 bits (69), Expect = 7.1,   Method: Composition-based stats.
 Identities = 27/157 (17%), Positives = 63/157 (40%), Gaps = 15/157 (9%)

Query: 129  QFLQGNTHTSPMVTRMIQDWKLHNERNSVAATSHLQSTQAGIDISRKESMQSVSAIVDEF 188
            +FLQ   H+   V    + W+   ++        L+S     ++    S +     +++F
Sbjct: 1219 EFLQSKIHSMNYVIVRQEKWESVKQKAENPTEEELKSYAHNYNLKVFTSDE-----LNDF 1273

Query: 189  LKRQSQLGEKGNITTKQLYNNAQQICNTYLMSQQHSPRYL---------ANIPDDLKNQV 239
            +  Q +L E+ N +       ++Q     +  Q+  P  +           +P D    +
Sbjct: 1274 IA-QIKLQERNNTSPSSKVKASKQYFEQLIKEQKQQPGKIKEHAQALGFVTLPTDEYENL 1332

Query: 240  IHNFKANRRHDPEVFRELKEVTYQFLETDCFPKFLKE 276
            I N K +     E++R  +E+    ++ + + KF+++
Sbjct: 1333 IKNQKDSALKKEEIYRAAREMNMTVIDKESYSKFIQQ 1369

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.323    0.137    0.426 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 52,574,319
Number of extensions: 2350605
Number of successful extensions: 8479
Number of sequences better than 10.0: 55
Number of HSP's gapped: 8718
Number of HSP's successfully gapped: 58
Length of query: 476
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 363
Effective length of database: 40,524,141
Effective search space: 14710263183
Effective search space used: 14710263183
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.5 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 68 (30.8 bits)