Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
CAGL0A02926g5.442ON32832817110.0
YDR372C (VPS74)5.442ON34534514190.0
Skud_4.6415.442ON34634814050.0
Smik_4.6385.442ON34634614050.0
Suva_2.5445.442ON34634714030.0
KAFR0D050605.442ON32632813330.0
KNAG0B042005.442ON34434413330.0
SAKL0G02706g5.442ON33233213270.0
TDEL0D025905.442ON33033013170.0
KLTH0F15884g5.442ON32932913110.0
NCAS0F034305.442ON33233213000.0
ZYRO0F10208g5.442ON33233412851e-179
Kwal_55.213995.442ON32933012781e-178
Kpol_1016.25.442ON32832812761e-177
Ecym_45135.442ON33333212671e-176
NDAI0B057205.442ON36536712701e-176
TBLA0A064805.442ON33433412631e-175
KLLA0E02355g5.442ON32432712561e-174
TPHA0J026105.442ON32932911861e-164
ACL165C5.442ON33133011811e-163
Kpol_1062.245.442ON2762739051e-122
TBLA0A027805.442ON3872968501e-112
NCAS0H020905.442ON3452945362e-65
KAFR0C051107.39ON89160712.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0A02926g
         (328 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0A02926g Chr1 complement(304789..305775) [987 bp, 328 aa] {O...   663   0.0  
YDR372C Chr4 complement(1221112..1222149) [1038 bp, 345 aa] {ON}...   551   0.0  
Skud_4.641 Chr4 complement(1144004..1145044) [1041 bp, 346 aa] {...   545   0.0  
Smik_4.638 Chr4 complement(1141194..1142234) [1041 bp, 346 aa] {...   545   0.0  
Suva_2.544 Chr2 complement(971735..972775) [1041 bp, 346 aa] {ON...   545   0.0  
KAFR0D05060 Chr4 complement(994966..995946) [981 bp, 326 aa] {ON...   518   0.0  
KNAG0B04200 Chr2 (799881..800915) [1035 bp, 344 aa] {ON} Anc_5.4...   518   0.0  
SAKL0G02706g Chr7 complement(222134..223132) [999 bp, 332 aa] {O...   515   0.0  
TDEL0D02590 Chr4 (497351..498343) [993 bp, 330 aa] {ON} Anc_5.44...   511   0.0  
KLTH0F15884g Chr6 (1292767..1293756) [990 bp, 329 aa] {ON} highl...   509   0.0  
NCAS0F03430 Chr6 complement(690870..691868) [999 bp, 332 aa] {ON...   505   0.0  
ZYRO0F10208g Chr6 complement(824737..825735) [999 bp, 332 aa] {O...   499   e-179
Kwal_55.21399 s55 (820851..821840) [990 bp, 329 aa] {ON} YDR372C...   496   e-178
Kpol_1016.2 s1016 (4946..5932) [987 bp, 328 aa] {ON} (4946..5932...   496   e-177
Ecym_4513 Chr4 complement(1023828..1024829) [1002 bp, 333 aa] {O...   492   e-176
NDAI0B05720 Chr2 complement(1391179..1392276) [1098 bp, 365 aa] ...   493   e-176
TBLA0A06480 Chr1 (1593225..1594229) [1005 bp, 334 aa] {ON} Anc_5...   491   e-175
KLLA0E02355g Chr5 complement(217222..218196) [975 bp, 324 aa] {O...   488   e-174
TPHA0J02610 Chr10 complement(579213..580202) [990 bp, 329 aa] {O...   461   e-164
ACL165C Chr3 complement(66499..67494) [996 bp, 331 aa] {ON} Synt...   459   e-163
Kpol_1062.24 s1062 (55671..56501) [831 bp, 276 aa] {ON} (55671.....   353   e-122
TBLA0A02780 Chr1 (670848..672011) [1164 bp, 387 aa] {ON} Anc_5.4...   332   e-112
NCAS0H02090 Chr8 complement(405561..406598) [1038 bp, 345 aa] {O...   211   2e-65
KAFR0C05110 Chr3 (1013807..1016482) [2676 bp, 891 aa] {ON} Anc_7...    32   2.7  

>CAGL0A02926g Chr1 complement(304789..305775) [987 bp, 328 aa] {ON}
           highly similar to uniprot|Q06385 Saccharomyces
           cerevisiae YDR372c
          Length = 328

 Score =  663 bits (1711), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 328/328 (100%), Positives = 328/328 (100%)

Query: 1   MSTLQRRRVNKSENASNGIEDREDDGTSSGKIAYDPEESKLQNDSKQPTLTLMEEVLLMG 60
           MSTLQRRRVNKSENASNGIEDREDDGTSSGKIAYDPEESKLQNDSKQPTLTLMEEVLLMG
Sbjct: 1   MSTLQRRRVNKSENASNGIEDREDDGTSSGKIAYDPEESKLQNDSKQPTLTLMEEVLLMG 60

Query: 61  LRDREGYLSFWNDSISYALRGCILIELALRNKIRILDAPARMRFDISERLIEVIDSSKTG 120
           LRDREGYLSFWNDSISYALRGCILIELALRNKIRILDAPARMRFDISERLIEVIDSSKTG
Sbjct: 61  LRDREGYLSFWNDSISYALRGCILIELALRNKIRILDAPARMRFDISERLIEVIDSSKTG 120

Query: 121 EVLLDETLQLMVNDEPLSIANWIDLLSGETWNLLKINYQLKQVRERLAKGLVDKGVLRTE 180
           EVLLDETLQLMVNDEPLSIANWIDLLSGETWNLLKINYQLKQVRERLAKGLVDKGVLRTE
Sbjct: 121 EVLLDETLQLMVNDEPLSIANWIDLLSGETWNLLKINYQLKQVRERLAKGLVDKGVLRTE 180

Query: 181 MKNFFLFDMATHPVSDSSCKEAIKRRILSVLVSRNMEISYNSYFPESTNFKLIRTVSLIA 240
           MKNFFLFDMATHPVSDSSCKEAIKRRILSVLVSRNMEISYNSYFPESTNFKLIRTVSLIA
Sbjct: 181 MKNFFLFDMATHPVSDSSCKEAIKRRILSVLVSRNMEISYNSYFPESTNFKLIRTVSLIA 240

Query: 241 GAYGANVLENVISSLEYDKRDKAITRAEEILAQFSQYPFDLQKESKDGISVNLNKELQEE 300
           GAYGANVLENVISSLEYDKRDKAITRAEEILAQFSQYPFDLQKESKDGISVNLNKELQEE
Sbjct: 241 GAYGANVLENVISSLEYDKRDKAITRAEEILAQFSQYPFDLQKESKDGISVNLNKELQEE 300

Query: 301 LESNPGSDLKLEVIAGVFEVFSRMDMLL 328
           LESNPGSDLKLEVIAGVFEVFSRMDMLL
Sbjct: 301 LESNPGSDLKLEVIAGVFEVFSRMDMLL 328

>YDR372C Chr4 complement(1221112..1222149) [1038 bp, 345 aa] {ON}
           VPS74Protein required for Golgi localization of
           glycosyltransferases; binds the cytosolic domains of
           Golgi glycosyltransferases; binding to PtdIns4P required
           for Golgi targeting and function; tetramer formation
           required for function
          Length = 345

 Score =  551 bits (1419), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 268/345 (77%), Positives = 308/345 (89%), Gaps = 17/345 (4%)

Query: 1   MSTLQRRRVNKSENA-----------------SNGIEDREDDGTSSGKIAYDPEESKLQN 43
           MSTLQRRRVN++++                  +N   D +DD  ++ KIAYDPEESKL++
Sbjct: 1   MSTLQRRRVNRADSGDTSSIHSSANNTKGDKIANIAVDGDDDNGTNKKIAYDPEESKLRD 60

Query: 44  DSKQPTLTLMEEVLLMGLRDREGYLSFWNDSISYALRGCILIELALRNKIRILDAPARMR 103
           +   PTLTLMEEVLLMGLRDREGYLSFWNDSISYALRGCI+IELALR KIRILD  AR R
Sbjct: 61  NINIPTLTLMEEVLLMGLRDREGYLSFWNDSISYALRGCIIIELALRGKIRILDDSARKR 120

Query: 104 FDISERLIEVIDSSKTGEVLLDETLQLMVNDEPLSIANWIDLLSGETWNLLKINYQLKQV 163
           FD+SERLIEVIDSSKTGEVLLDETLQLM NDEPLSI+NWIDLLSGETWNLLKINYQLKQV
Sbjct: 121 FDLSERLIEVIDSSKTGEVLLDETLQLMKNDEPLSISNWIDLLSGETWNLLKINYQLKQV 180

Query: 164 RERLAKGLVDKGVLRTEMKNFFLFDMATHPVSDSSCKEAIKRRILSVLVSRNMEISYNSY 223
           RERLAKGLVDKGVLRTEMKNFFLFDMATHP++D+SCKEAIKRR+LSVLVSRNME+SYN Y
Sbjct: 181 RERLAKGLVDKGVLRTEMKNFFLFDMATHPIADASCKEAIKRRVLSVLVSRNMELSYNEY 240

Query: 224 FPESTNFKLIRTVSLIAGAYGANVLENVISSLEYDKRDKAITRAEEILAQFSQYPFDLQK 283
           FPE+T+FK+IRT++LI G+YGANVLENV+++LEY+KRDKAI+RAEEI+AQFSQYPFDL+K
Sbjct: 241 FPETTSFKIIRTLALICGSYGANVLENVLTTLEYEKRDKAISRAEEIMAQFSQYPFDLEK 300

Query: 284 ESKDGISVNLNKELQEELESNPGSDLKLEVIAGVFEVFSRMDMLL 328
           E++ G+SVNLNKE++EE+E+NPG DL+LEVIAGVFEVFSRMDMLL
Sbjct: 301 ETELGVSVNLNKEVKEEIENNPGHDLQLEVIAGVFEVFSRMDMLL 345

>Skud_4.641 Chr4 complement(1144004..1145044) [1041 bp, 346 aa] {ON}
           YDR372C (REAL)
          Length = 346

 Score =  545 bits (1405), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 267/348 (76%), Positives = 308/348 (88%), Gaps = 22/348 (6%)

Query: 1   MSTLQRRRVNKSEN--------------------ASNGIEDREDDGTSSGKIAYDPEESK 40
           MSTLQRRRVN++++                    A+ GI+D  DD  ++ KIAYDPEESK
Sbjct: 1   MSTLQRRRVNRADSGDTSSMQSMSNNDNSKGDKIANIGIDD--DDSGANKKIAYDPEESK 58

Query: 41  LQNDSKQPTLTLMEEVLLMGLRDREGYLSFWNDSISYALRGCILIELALRNKIRILDAPA 100
           L+++ K PTLTLMEEVLLMGLRDREGYLSFWNDSISYALRGCILIELALR KIRILD  A
Sbjct: 59  LRDNIKIPTLTLMEEVLLMGLRDREGYLSFWNDSISYALRGCILIELALRGKIRILDDSA 118

Query: 101 RMRFDISERLIEVIDSSKTGEVLLDETLQLMVNDEPLSIANWIDLLSGETWNLLKINYQL 160
           R RFD+SERL+EV+D SKTGEVLLDETLQLM NDEPL+I+NWIDLLSGETWNLLKINYQL
Sbjct: 119 RKRFDLSERLVEVVDGSKTGEVLLDETLQLMKNDEPLTISNWIDLLSGETWNLLKINYQL 178

Query: 161 KQVRERLAKGLVDKGVLRTEMKNFFLFDMATHPVSDSSCKEAIKRRILSVLVSRNMEISY 220
           KQVRERLAKGLVDKGVLRTEMKNFFLFDMATHP++D+SCKEAIKRR+LSVLVSRNME+SY
Sbjct: 179 KQVRERLAKGLVDKGVLRTEMKNFFLFDMATHPIADASCKEAIKRRVLSVLVSRNMELSY 238

Query: 221 NSYFPESTNFKLIRTVSLIAGAYGANVLENVISSLEYDKRDKAITRAEEILAQFSQYPFD 280
           N YFPE+T+FK+IRT++LI G+YGANVLENV+++LEY+KRDKAI RAEEI+AQFSQYPFD
Sbjct: 239 NEYFPETTSFKIIRTLALICGSYGANVLENVLTTLEYEKRDKAINRAEEIMAQFSQYPFD 298

Query: 281 LQKESKDGISVNLNKELQEELESNPGSDLKLEVIAGVFEVFSRMDMLL 328
           L+KE++ G+SVNLNKE++EE+E+N G DL+LEVIAGVFEVFSRMDMLL
Sbjct: 299 LEKETELGVSVNLNKEVKEEIENNTGHDLQLEVIAGVFEVFSRMDMLL 346

>Smik_4.638 Chr4 complement(1141194..1142234) [1041 bp, 346 aa] {ON}
           YDR372C (REAL)
          Length = 346

 Score =  545 bits (1405), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 266/346 (76%), Positives = 309/346 (89%), Gaps = 18/346 (5%)

Query: 1   MSTLQRRRVNKSEN--------ASNGIEDR----------EDDGTSSGKIAYDPEESKLQ 42
           MSTLQRRRVN++++        ++N I  +          +DD  ++ KIAYDPEESKL+
Sbjct: 1   MSTLQRRRVNRADSGDTSSMQPSANNINAKGDKIASVAVDDDDNGTNKKIAYDPEESKLR 60

Query: 43  NDSKQPTLTLMEEVLLMGLRDREGYLSFWNDSISYALRGCILIELALRNKIRILDAPARM 102
           ++   PTLTLMEEVLLMGLRDREGYLSFWNDSISYALRGCI+IELALR KIRILD  AR 
Sbjct: 61  DNINIPTLTLMEEVLLMGLRDREGYLSFWNDSISYALRGCIIIELALRGKIRILDDSARK 120

Query: 103 RFDISERLIEVIDSSKTGEVLLDETLQLMVNDEPLSIANWIDLLSGETWNLLKINYQLKQ 162
           RFD+SERLIEVID SKTGEVLLDETLQLM NDEPL+I+NWIDLLSGETWNLLKINYQLKQ
Sbjct: 121 RFDLSERLIEVIDGSKTGEVLLDETLQLMKNDEPLTISNWIDLLSGETWNLLKINYQLKQ 180

Query: 163 VRERLAKGLVDKGVLRTEMKNFFLFDMATHPVSDSSCKEAIKRRILSVLVSRNMEISYNS 222
           VRERLAKGLVDKGVLRTEMKNFFLFDMATHP++D+SCKEAIKRR+LSVLVSRNME+SYN 
Sbjct: 181 VRERLAKGLVDKGVLRTEMKNFFLFDMATHPIADASCKEAIKRRVLSVLVSRNMELSYNE 240

Query: 223 YFPESTNFKLIRTVSLIAGAYGANVLENVISSLEYDKRDKAITRAEEILAQFSQYPFDLQ 282
           YFPE+T+FK+IRT++LI G+YGANVLENV+++LEY+KRDKAI+RAEEI+AQFSQ+PFDL+
Sbjct: 241 YFPETTSFKIIRTLALICGSYGANVLENVLTTLEYEKRDKAISRAEEIMAQFSQFPFDLE 300

Query: 283 KESKDGISVNLNKELQEELESNPGSDLKLEVIAGVFEVFSRMDMLL 328
           KE++ GISVNLNKE++EE+ESNPG +L+LEVIAGVFEVFSRMDMLL
Sbjct: 301 KETELGISVNLNKEVKEEMESNPGHNLQLEVIAGVFEVFSRMDMLL 346

>Suva_2.544 Chr2 complement(971735..972775) [1041 bp, 346 aa] {ON}
           YDR372C (REAL)
          Length = 346

 Score =  545 bits (1403), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 266/347 (76%), Positives = 307/347 (88%), Gaps = 20/347 (5%)

Query: 1   MSTLQRRRVNKSENA-------------------SNGIEDREDDGTSSGKIAYDPEESKL 41
           MSTLQRRRVN++++                    SNG  D +D+G +  KIAYDPEESKL
Sbjct: 1   MSTLQRRRVNRADSGDTSSMQSTSNNHNSSGDKTSNGPVDGDDNGINK-KIAYDPEESKL 59

Query: 42  QNDSKQPTLTLMEEVLLMGLRDREGYLSFWNDSISYALRGCILIELALRNKIRILDAPAR 101
           +++ K PTLTLMEEVLLMGLRDREGYLSFWNDSISYALRGCILIELALR KIRILD  AR
Sbjct: 60  RDNIKIPTLTLMEEVLLMGLRDREGYLSFWNDSISYALRGCILIELALRGKIRILDDSAR 119

Query: 102 MRFDISERLIEVIDSSKTGEVLLDETLQLMVNDEPLSIANWIDLLSGETWNLLKINYQLK 161
            RFD+SERL+EVID SKTGEVLLDETLQLM NDEPL+I+NWIDLLSGETWNLLKINYQLK
Sbjct: 120 KRFDLSERLVEVIDGSKTGEVLLDETLQLMKNDEPLTISNWIDLLSGETWNLLKINYQLK 179

Query: 162 QVRERLAKGLVDKGVLRTEMKNFFLFDMATHPVSDSSCKEAIKRRILSVLVSRNMEISYN 221
           QVRERLAKGLVDKGVLRTEMKNFFLFDMATHP++D+SCKEAIKRR+LSVLVSRNME+SYN
Sbjct: 180 QVRERLAKGLVDKGVLRTEMKNFFLFDMATHPIADASCKEAIKRRVLSVLVSRNMELSYN 239

Query: 222 SYFPESTNFKLIRTVSLIAGAYGANVLENVISSLEYDKRDKAITRAEEILAQFSQYPFDL 281
            YFPE+T+FK+IRT++LI G+YGANVLENV+++LEY+KRDKAI+RAEEI++ FSQYPFDL
Sbjct: 240 EYFPETTSFKIIRTLALICGSYGANVLENVLTTLEYEKRDKAISRAEEIMSHFSQYPFDL 299

Query: 282 QKESKDGISVNLNKELQEELESNPGSDLKLEVIAGVFEVFSRMDMLL 328
           +K++  G+SVNLNKE++EE+E+NPG DL+LEVIAGVFEVFSRMDMLL
Sbjct: 300 EKDTDLGVSVNLNKEVKEEIENNPGHDLQLEVIAGVFEVFSRMDMLL 346

>KAFR0D05060 Chr4 complement(994966..995946) [981 bp, 326 aa] {ON}
           Anc_5.442 YDR372C
          Length = 326

 Score =  518 bits (1333), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 253/328 (77%), Positives = 291/328 (88%), Gaps = 2/328 (0%)

Query: 1   MSTLQRRRVNKSENASNGIEDREDDGTSSGKIAYDPEESKLQNDSKQPTLTLMEEVLLMG 60
           MSTLQRRR N+S++ ++  E+  +  +   K+AYDPEE+KL+++   P LTLMEEVLLMG
Sbjct: 1   MSTLQRRRKNRSDSNADDSENVSE--SQDRKVAYDPEEAKLRDNVSIPKLTLMEEVLLMG 58

Query: 61  LRDREGYLSFWNDSISYALRGCILIELALRNKIRILDAPARMRFDISERLIEVIDSSKTG 120
           LRDREGYLSFWND+ISYALRGCILIELALRNKIRILD  AR RFD+SERL+EVID SKTG
Sbjct: 59  LRDREGYLSFWNDNISYALRGCILIELALRNKIRILDDSARKRFDVSERLVEVIDGSKTG 118

Query: 121 EVLLDETLQLMVNDEPLSIANWIDLLSGETWNLLKINYQLKQVRERLAKGLVDKGVLRTE 180
           EVLLDE LQLM NDEPL+IANWIDLLSGETWNLLKINYQLKQVRERLAKGLVDKGVLRTE
Sbjct: 119 EVLLDEALQLMKNDEPLTIANWIDLLSGETWNLLKINYQLKQVRERLAKGLVDKGVLRTE 178

Query: 181 MKNFFLFDMATHPVSDSSCKEAIKRRILSVLVSRNMEISYNSYFPESTNFKLIRTVSLIA 240
           MKNFFLFDMATHPV+D+SCKEAIKRRILS LVSRNME++YNSYF E+T+FK IR V+L+ 
Sbjct: 179 MKNFFLFDMATHPVTDTSCKEAIKRRILSALVSRNMELNYNSYFAETTSFKYIRIVALVC 238

Query: 241 GAYGANVLENVISSLEYDKRDKAITRAEEILAQFSQYPFDLQKESKDGISVNLNKELQEE 300
            +YGANVLENV+SSL+Y+KRD+AI+RAEEILAQF+QYPFDL K ++ GISVNLNKE++ E
Sbjct: 239 CSYGANVLENVLSSLDYEKRDRAISRAEEILAQFAQYPFDLSKNTELGISVNLNKEVENE 298

Query: 301 LESNPGSDLKLEVIAGVFEVFSRMDMLL 328
           +  NP   L+LEVIAGV EVFSRMDMLL
Sbjct: 299 VNENPQFTLQLEVIAGVIEVFSRMDMLL 326

>KNAG0B04200 Chr2 (799881..800915) [1035 bp, 344 aa] {ON} Anc_5.442
           YDR372C
          Length = 344

 Score =  518 bits (1333), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 252/344 (73%), Positives = 292/344 (84%), Gaps = 16/344 (4%)

Query: 1   MSTLQRRRVNKSEN----------------ASNGIEDREDDGTSSGKIAYDPEESKLQND 44
           MSTLQRRRVN+S++                ASN  E+ E+    + K+AYDPEE+KL+++
Sbjct: 1   MSTLQRRRVNRSDSNEGETVSGGKTAAAPSASNDAEEYEETSGPTRKVAYDPEEAKLRDN 60

Query: 45  SKQPTLTLMEEVLLMGLRDREGYLSFWNDSISYALRGCILIELALRNKIRILDAPARMRF 104
              P LTLMEEVLLMGLRDREGYLSFWND+ISYALRGCI+IELALR KIRILD  AR RF
Sbjct: 61  YTVPKLTLMEEVLLMGLRDREGYLSFWNDNISYALRGCIMIELALRKKIRILDDSARKRF 120

Query: 105 DISERLIEVIDSSKTGEVLLDETLQLMVNDEPLSIANWIDLLSGETWNLLKINYQLKQVR 164
           DISERL+EV+D SKTGEVLLDETLQLM NDEPL+IANWIDLLSGETWNL+KINYQLKQVR
Sbjct: 121 DISERLVEVVDGSKTGEVLLDETLQLMKNDEPLTIANWIDLLSGETWNLMKINYQLKQVR 180

Query: 165 ERLAKGLVDKGVLRTEMKNFFLFDMATHPVSDSSCKEAIKRRILSVLVSRNMEISYNSYF 224
           ERLAKGLVDKGVLRTEMKNFFLFDMATHPV+DSSCKEAIKRRILS +VSRNME+S+NSYF
Sbjct: 181 ERLAKGLVDKGVLRTEMKNFFLFDMATHPVTDSSCKEAIKRRILSTVVSRNMELSFNSYF 240

Query: 225 PESTNFKLIRTVSLIAGAYGANVLENVISSLEYDKRDKAITRAEEILAQFSQYPFDLQKE 284
           PEST+FK IRTV+L+   YGA+VLENV+SSL+Y++RD+A++RAEE+L +F QYPFDL+K+
Sbjct: 241 PESTSFKYIRTVALVCSTYGASVLENVLSSLDYEQRDRAVSRAEELLEKFGQYPFDLEKQ 300

Query: 285 SKDGISVNLNKELQEELESNPGSDLKLEVIAGVFEVFSRMDMLL 328
              GIS NLNKE Q E++ +P S L LEV+AGV EVFSRMDMLL
Sbjct: 301 GDSGISCNLNKEAQREVDESPNSALYLEVVAGVIEVFSRMDMLL 344

>SAKL0G02706g Chr7 complement(222134..223132) [999 bp, 332 aa] {ON}
           highly similar to uniprot|Q06385 Saccharomyces
           cerevisiae YDR372C VPS74
          Length = 332

 Score =  515 bits (1327), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 250/332 (75%), Positives = 289/332 (87%), Gaps = 4/332 (1%)

Query: 1   MSTLQRRRVNK--SENASNGI--EDREDDGTSSGKIAYDPEESKLQNDSKQPTLTLMEEV 56
           MS LQRRRVN+  S+ A   I   D  D+     K+AYDPEE+KL+ ++  P LTLMEEV
Sbjct: 1   MSGLQRRRVNRTNSDYAEQPITSSDSNDENAKDRKVAYDPEEAKLKENTTVPKLTLMEEV 60

Query: 57  LLMGLRDREGYLSFWNDSISYALRGCILIELALRNKIRILDAPARMRFDISERLIEVIDS 116
           LLMGL+D+EGYLSFWND+ISYALRGCILIELALR+KIR+LD PAR RFD+S+RLIEVID 
Sbjct: 61  LLMGLKDKEGYLSFWNDNISYALRGCILIELALRDKIRVLDDPARKRFDVSDRLIEVIDG 120

Query: 117 SKTGEVLLDETLQLMVNDEPLSIANWIDLLSGETWNLLKINYQLKQVRERLAKGLVDKGV 176
           SKTGEVLLDE L L+ NDEPL IANWIDLLSGETWNLLKINYQLKQVRERLAKGLVDKGV
Sbjct: 121 SKTGEVLLDEALNLIKNDEPLPIANWIDLLSGETWNLLKINYQLKQVRERLAKGLVDKGV 180

Query: 177 LRTEMKNFFLFDMATHPVSDSSCKEAIKRRILSVLVSRNMEISYNSYFPESTNFKLIRTV 236
           LRTEMKNFFLFDMATHP++D+SCKEAIKRR+LSVLVSRNME++YN YF E+  FK+IRT+
Sbjct: 181 LRTEMKNFFLFDMATHPITDTSCKEAIKRRVLSVLVSRNMELNYNEYFSENITFKIIRTL 240

Query: 237 SLIAGAYGANVLENVISSLEYDKRDKAITRAEEILAQFSQYPFDLQKESKDGISVNLNKE 296
           SLI GAYGANVLENV++SL+YDKRD+A +RA+EILAQFS++PF L K ++ GISVNLNKE
Sbjct: 241 SLICGAYGANVLENVLASLDYDKRDRAFSRADEILAQFSEFPFALDKATESGISVNLNKE 300

Query: 297 LQEELESNPGSDLKLEVIAGVFEVFSRMDMLL 328
           +Q E+  NPG DL+LEV+AGVFEVFSRMD LL
Sbjct: 301 VQAEIAQNPGKDLQLEVVAGVFEVFSRMDTLL 332

>TDEL0D02590 Chr4 (497351..498343) [993 bp, 330 aa] {ON} Anc_5.442
           YDR372C
          Length = 330

 Score =  511 bits (1317), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 243/330 (73%), Positives = 295/330 (89%), Gaps = 2/330 (0%)

Query: 1   MSTLQRRRVNKSENAS-NGIEDRE-DDGTSSGKIAYDPEESKLQNDSKQPTLTLMEEVLL 58
           MS LQRRRVN+ ++   + ++  E ++ T+S ++AYDPEE+K+  + K P LTLMEEVLL
Sbjct: 1   MSNLQRRRVNRVDSGDESSLQASEFNETTTSKRVAYDPEEAKITENVKNPKLTLMEEVLL 60

Query: 59  MGLRDREGYLSFWNDSISYALRGCILIELALRNKIRILDAPARMRFDISERLIEVIDSSK 118
           +GLRD+EGYLSFWND+ISYALRGCI+IELALR KIRI+D  AR RFD+SERLIEV+D+SK
Sbjct: 61  LGLRDKEGYLSFWNDNISYALRGCIIIELALRGKIRIIDDSARKRFDVSERLIEVVDASK 120

Query: 119 TGEVLLDETLQLMVNDEPLSIANWIDLLSGETWNLLKINYQLKQVRERLAKGLVDKGVLR 178
           TGEVLLDETLQLM  DEPL+IANWIDLLSGETWNLLKINYQLKQVRERLAKGLVDKGVLR
Sbjct: 121 TGEVLLDETLQLMKYDEPLTIANWIDLLSGETWNLLKINYQLKQVRERLAKGLVDKGVLR 180

Query: 179 TEMKNFFLFDMATHPVSDSSCKEAIKRRILSVLVSRNMEISYNSYFPESTNFKLIRTVSL 238
           TEMKNFFLFDMATHPV+D+SCKEA+KRR+LSVLVSRNME+SYN YFP++T+FKLIRT++L
Sbjct: 181 TEMKNFFLFDMATHPVTDTSCKEALKRRVLSVLVSRNMELSYNEYFPDTTSFKLIRTIAL 240

Query: 239 IAGAYGANVLENVISSLEYDKRDKAITRAEEILAQFSQYPFDLQKESKDGISVNLNKELQ 298
           I G+Y ANVLENV++SL+Y+KRD+A++RA+EIL Q++QYPFDL K ++ G+S+NLNKE++
Sbjct: 241 ICGSYRANVLENVLTSLDYEKRDRALSRADEILEQYTQYPFDLDKATESGLSINLNKEVK 300

Query: 299 EELESNPGSDLKLEVIAGVFEVFSRMDMLL 328
           EEL  N    L+LEV+AGVFEVFSRMDMLL
Sbjct: 301 EELSQNKDCPLQLEVVAGVFEVFSRMDMLL 330

>KLTH0F15884g Chr6 (1292767..1293756) [990 bp, 329 aa] {ON} highly
           similar to uniprot|Q06385 Saccharomyces cerevisiae
           YDR372C VPS74
          Length = 329

 Score =  509 bits (1311), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 245/329 (74%), Positives = 289/329 (87%), Gaps = 1/329 (0%)

Query: 1   MSTLQRRRVNKSENASNGIEDREDDGTSSGK-IAYDPEESKLQNDSKQPTLTLMEEVLLM 59
           MS LQRRRVNKSE+ S+      D+    GK +AYDPEE+KL++D+  P L LMEEVLLM
Sbjct: 1   MSGLQRRRVNKSESISSQDPVVNDETDGEGKRVAYDPEEAKLRDDTTTPKLNLMEEVLLM 60

Query: 60  GLRDREGYLSFWNDSISYALRGCILIELALRNKIRILDAPARMRFDISERLIEVIDSSKT 119
           GL+D+EGYLSFWND+ISYALRGCILIELALR KI++L+ PAR RFD+SERL+EVI+++KT
Sbjct: 61  GLKDKEGYLSFWNDNISYALRGCILIELALRGKIQVLNDPARKRFDVSERLVEVINATKT 120

Query: 120 GEVLLDETLQLMVNDEPLSIANWIDLLSGETWNLLKINYQLKQVRERLAKGLVDKGVLRT 179
           GEVLLDE L LM NDEPL+IANWIDLLSGETWN +KI+YQLKQVRERLAKGLVDKGVLRT
Sbjct: 121 GEVLLDEALNLMKNDEPLTIANWIDLLSGETWNFMKISYQLKQVRERLAKGLVDKGVLRT 180

Query: 180 EMKNFFLFDMATHPVSDSSCKEAIKRRILSVLVSRNMEISYNSYFPESTNFKLIRTVSLI 239
           EMKNFFLFDM THP++D+SCKEAIKRRILSVLVSRNM+++YN YFP S  FKLIRT+SLI
Sbjct: 181 EMKNFFLFDMPTHPITDTSCKEAIKRRILSVLVSRNMQLNYNEYFPSSVRFKLIRTLSLI 240

Query: 240 AGAYGANVLENVISSLEYDKRDKAITRAEEILAQFSQYPFDLQKESKDGISVNLNKELQE 299
            GAYGANVLENV+SSL+Y+KRD+A +RA+EILAQFSQ+PF L K+++ GISVNLNKE+QE
Sbjct: 241 CGAYGANVLENVLSSLDYEKRDRAFSRADEILAQFSQFPFALDKQTETGISVNLNKEVQE 300

Query: 300 ELESNPGSDLKLEVIAGVFEVFSRMDMLL 328
           E+ SN  + L+LE +AGVFEVFSRMD LL
Sbjct: 301 EVVSNQDASLQLECVAGVFEVFSRMDTLL 329

>NCAS0F03430 Chr6 complement(690870..691868) [999 bp, 332 aa] {ON}
           Anc_5.442 YDR372C
          Length = 332

 Score =  505 bits (1300), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 245/332 (73%), Positives = 291/332 (87%), Gaps = 4/332 (1%)

Query: 1   MSTLQRRRVNK--SENASNGI-EDREDDGTSSGKIAYDPEESKLQNDSKQ-PTLTLMEEV 56
           MSTLQRRRVNK  S+N +  +  + E D  +  K+AYDPEE++++N   Q P LTLMEEV
Sbjct: 1   MSTLQRRRVNKDDSDNETGSVTPNVERDSDNDNKVAYDPEEARMRNVGGQVPVLTLMEEV 60

Query: 57  LLMGLRDREGYLSFWNDSISYALRGCILIELALRNKIRILDAPARMRFDISERLIEVIDS 116
           LLMGLRD+EGYLSFWND+ISYALRGCILIELALR KI+ILD  AR RF++SERL++VID 
Sbjct: 61  LLMGLRDKEGYLSFWNDNISYALRGCILIELALRGKIQILDDSARKRFELSERLVQVIDG 120

Query: 117 SKTGEVLLDETLQLMVNDEPLSIANWIDLLSGETWNLLKINYQLKQVRERLAKGLVDKGV 176
           +KTGEVLLDETLQLM NDEPLSIA+WIDLLSGETWN++KINYQLKQVRERLAKGLVDKGV
Sbjct: 121 TKTGEVLLDETLQLMKNDEPLSIASWIDLLSGETWNIMKINYQLKQVRERLAKGLVDKGV 180

Query: 177 LRTEMKNFFLFDMATHPVSDSSCKEAIKRRILSVLVSRNMEISYNSYFPESTNFKLIRTV 236
           LRTEMKNFFLFDMATHPV+DSSCKEAIKRR+LS+LVSRNME+SYN+YFPE+T FK+IRT+
Sbjct: 181 LRTEMKNFFLFDMATHPVTDSSCKEAIKRRVLSILVSRNMELSYNNYFPETTRFKIIRTI 240

Query: 237 SLIAGAYGANVLENVISSLEYDKRDKAITRAEEILAQFSQYPFDLQKESKDGISVNLNKE 296
           +LI GAYGANVLEN++ SL+++  D AI RA+E++AQFS++PFDL+  +  GISVNLN+E
Sbjct: 241 ALICGAYGANVLENLLGSLDFEMSDNAIARADELIAQFSKFPFDLETPTALGISVNLNRE 300

Query: 297 LQEELESNPGSDLKLEVIAGVFEVFSRMDMLL 328
           +Q+EL   PG DL+LEVIAGV EVFSRMD LL
Sbjct: 301 VQQELADTPGYDLQLEVIAGVIEVFSRMDTLL 332

>ZYRO0F10208g Chr6 complement(824737..825735) [999 bp, 332 aa] {ON}
           highly similar to uniprot|Q06385 Saccharomyces
           cerevisiae YDR372C VPS74
          Length = 332

 Score =  499 bits (1285), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 246/334 (73%), Positives = 288/334 (86%), Gaps = 8/334 (2%)

Query: 1   MSTLQRRRVNKSENA------SNGIEDREDDGTSSGKIAYDPEESKLQNDSKQPTLTLME 54
           MS LQRRRVN+ +++      + G+E +ED  +SS K+AYDPEE KL ++ + P LTLME
Sbjct: 1   MSGLQRRRVNRVDSSGSNNEPTRGLEAQED--SSSKKVAYDPEEVKLTDNVEVPKLTLME 58

Query: 55  EVLLMGLRDREGYLSFWNDSISYALRGCILIELALRNKIRILDAPARMRFDISERLIEVI 114
           EVLL+GLRD+EGYLSFWND+ISYALRGCI+IELALR KIR++D  AR RFD+SERLIEV 
Sbjct: 59  EVLLLGLRDKEGYLSFWNDNISYALRGCIVIELALRGKIRVVDDSARKRFDVSERLIEVT 118

Query: 115 DSSKTGEVLLDETLQLMVNDEPLSIANWIDLLSGETWNLLKINYQLKQVRERLAKGLVDK 174
           DSSKTGEVLLDE LQLM  DEPLSI NWIDLLSGETWN LKINYQLKQVRERLAKGLVDK
Sbjct: 119 DSSKTGEVLLDEALQLMKCDEPLSITNWIDLLSGETWNPLKINYQLKQVRERLAKGLVDK 178

Query: 175 GVLRTEMKNFFLFDMATHPVSDSSCKEAIKRRILSVLVSRNMEISYNSYFPESTNFKLIR 234
           GVLRTEMKNFFLFDMATHPV+D+SCKEAIKRRILSVLV RN+E++YN YF E  +FKLIR
Sbjct: 179 GVLRTEMKNFFLFDMATHPVTDTSCKEAIKRRILSVLVPRNLELNYNDYFSERVSFKLIR 238

Query: 235 TVSLIAGAYGANVLENVISSLEYDKRDKAITRAEEILAQFSQYPFDLQKESKDGISVNLN 294
           T++LI GAY ANVLENV++SL Y+KRD AI RA+EIL QFS+YPFDL  +++ GIS+NLN
Sbjct: 239 TIALICGAYRANVLENVLTSLGYEKRDNAIGRADEILKQFSEYPFDLDTQTESGISINLN 298

Query: 295 KELQEELESNPGSDLKLEVIAGVFEVFSRMDMLL 328
           KE+ +EL+ +P S L+LEV+AGVFEVFSRMDMLL
Sbjct: 299 KEVGQELQQHPESTLQLEVLAGVFEVFSRMDMLL 332

>Kwal_55.21399 s55 (820851..821840) [990 bp, 329 aa] {ON} YDR372C
           (VPS74) -  [contig 130] FULL
          Length = 329

 Score =  496 bits (1278), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 238/330 (72%), Positives = 290/330 (87%), Gaps = 3/330 (0%)

Query: 1   MSTLQRRRVNKSENA--SNGIEDREDDGTSSGKIAYDPEESKLQNDSKQPTLTLMEEVLL 58
           MS LQRRRVNKSE+   S  +   E +G S  ++AYDPEE+ L++++  P L LMEEVLL
Sbjct: 1   MSGLQRRRVNKSESNYDSEPVISEEAEGESK-RVAYDPEEAMLKDNATIPKLNLMEEVLL 59

Query: 59  MGLRDREGYLSFWNDSISYALRGCILIELALRNKIRILDAPARMRFDISERLIEVIDSSK 118
           MGL+D+EGYLSFWND+ISYALRGCILIELALR KI++++  AR RFD+SERL+EVI+++K
Sbjct: 60  MGLKDKEGYLSFWNDNISYALRGCILIELALRGKIQVVNDSARKRFDVSERLVEVINATK 119

Query: 119 TGEVLLDETLQLMVNDEPLSIANWIDLLSGETWNLLKINYQLKQVRERLAKGLVDKGVLR 178
           TGEVLLDE L LM NDEPL+IANWIDLLSGETWN +KI+YQLKQVRERLAKGLVDKGVLR
Sbjct: 120 TGEVLLDEALNLMKNDEPLTIANWIDLLSGETWNFMKISYQLKQVRERLAKGLVDKGVLR 179

Query: 179 TEMKNFFLFDMATHPVSDSSCKEAIKRRILSVLVSRNMEISYNSYFPESTNFKLIRTVSL 238
           TEMKNFFLFDM THP++D+SCKEAIKRRILSVLVSRNM+++YN YFP S +FKL+RT+SL
Sbjct: 180 TEMKNFFLFDMPTHPITDTSCKEAIKRRILSVLVSRNMQLNYNEYFPASVSFKLLRTLSL 239

Query: 239 IAGAYGANVLENVISSLEYDKRDKAITRAEEILAQFSQYPFDLQKESKDGISVNLNKELQ 298
           I GAYGANVLENV+ SL+Y+KRD+A +RA+EILAQFSQ+PF L K+++ GISVN+NKE+Q
Sbjct: 240 ICGAYGANVLENVLCSLDYEKRDRAFSRADEILAQFSQFPFALDKQTETGISVNINKEMQ 299

Query: 299 EELESNPGSDLKLEVIAGVFEVFSRMDMLL 328
           EE+++N  + L+LEV+AGVFEVFSRMD LL
Sbjct: 300 EEIDANSDALLRLEVVAGVFEVFSRMDTLL 329

>Kpol_1016.2 s1016 (4946..5932) [987 bp, 328 aa] {ON} (4946..5932)
           [987 nt, 329 aa]
          Length = 328

 Score =  496 bits (1276), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 232/328 (70%), Positives = 284/328 (86%)

Query: 1   MSTLQRRRVNKSENASNGIEDREDDGTSSGKIAYDPEESKLQNDSKQPTLTLMEEVLLMG 60
           MS+LQRRR+N+  + +    + +++ + S KIAYDPEE+KL++D   PTLTLMEEV+L+G
Sbjct: 1   MSSLQRRRLNRINSDTAESSNDDEERSKSTKIAYDPEEAKLKDDVTVPTLTLMEEVVLLG 60

Query: 61  LRDREGYLSFWNDSISYALRGCILIELALRNKIRILDAPARMRFDISERLIEVIDSSKTG 120
           L D++GYLSFWND+ISY LRGCI+IELALRNKIRILD PAR RFD+SERL+EV+D SKTG
Sbjct: 61  LGDKDGYLSFWNDNISYTLRGCIIIELALRNKIRILDDPARKRFDLSERLVEVVDGSKTG 120

Query: 121 EVLLDETLQLMVNDEPLSIANWIDLLSGETWNLLKINYQLKQVRERLAKGLVDKGVLRTE 180
           EVLLDE LQLM NDEPLSIANWIDLLSGETWN  KINYQLKQVRER++KGLVDKGVLRTE
Sbjct: 121 EVLLDEALQLMKNDEPLSIANWIDLLSGETWNFFKINYQLKQVRERISKGLVDKGVLRTE 180

Query: 181 MKNFFLFDMATHPVSDSSCKEAIKRRILSVLVSRNMEISYNSYFPESTNFKLIRTVSLIA 240
           MKNFFLFDMATHPV+D+SCKEAIKRRILS LVSR ME++YN YFPE+T +K+IRT++LI 
Sbjct: 181 MKNFFLFDMATHPVTDTSCKEAIKRRILSALVSRTMELNYNEYFPETTQYKVIRTIALIC 240

Query: 241 GAYGANVLENVISSLEYDKRDKAITRAEEILAQFSQYPFDLQKESKDGISVNLNKELQEE 300
            +Y ANVLENV+SSLEY+KRD AI R+E IL++F+QYPF L K S   +S+NL+K +++E
Sbjct: 241 SSYAANVLENVLSSLEYEKRDNAIARSESILSEFAQYPFKLDKASDIKVSINLSKLVEDE 300

Query: 301 LESNPGSDLKLEVIAGVFEVFSRMDMLL 328
           +  NPGS L+LE +AGVF+VFS+MDM+L
Sbjct: 301 IAQNPGSALQLEAVAGVFDVFSKMDMIL 328

>Ecym_4513 Chr4 complement(1023828..1024829) [1002 bp, 333 aa] {ON}
           similar to Ashbya gossypii ACL165C
          Length = 333

 Score =  492 bits (1267), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 235/332 (70%), Positives = 282/332 (84%), Gaps = 6/332 (1%)

Query: 3   TLQRRRVNKSENASNGIE------DREDDGTSSGKIAYDPEESKLQNDSKQPTLTLMEEV 56
           +LQRRRVNK+E     +E        ++D   S K+AYDPE+ KL+ ++K+PTLTLMEEV
Sbjct: 2   SLQRRRVNKAEVGGTSVELTQRKHGEDEDDKGSHKVAYDPEDQKLRENTKEPTLTLMEEV 61

Query: 57  LLMGLRDREGYLSFWNDSISYALRGCILIELALRNKIRILDAPARMRFDISERLIEVIDS 116
           LLMGL+D+EGYLSFWNDSISY+LRGCILIELALR KIR+++  AR RFD+SERL+EVI++
Sbjct: 62  LLMGLKDKEGYLSFWNDSISYSLRGCILIELALRGKIRVVEDAARKRFDLSERLVEVIET 121

Query: 117 SKTGEVLLDETLQLMVNDEPLSIANWIDLLSGETWNLLKINYQLKQVRERLAKGLVDKGV 176
           SKTGE LLDETL LM ++EPLSI NWIDLLSGETWNLLKI+YQLKQVRERLAKGLVDKGV
Sbjct: 122 SKTGEALLDETLSLMKSNEPLSIVNWIDLLSGETWNLLKISYQLKQVRERLAKGLVDKGV 181

Query: 177 LRTEMKNFFLFDMATHPVSDSSCKEAIKRRILSVLVSRNMEISYNSYFPESTNFKLIRTV 236
           LRTEMKNFFLFDMATHPV+DSSCKE+IKRR+LSVLV RN+ + Y  YFPES  FK +RT+
Sbjct: 182 LRTEMKNFFLFDMATHPVADSSCKESIKRRMLSVLVPRNVSLDYTEYFPESVAFKYLRTI 241

Query: 237 SLIAGAYGANVLENVISSLEYDKRDKAITRAEEILAQFSQYPFDLQKESKDGISVNLNKE 296
           +LI GAYGANVLENV+SSL+Y+KR++  +RAEEIL QFSQYPF L K+ + GISVNL  +
Sbjct: 242 ALICGAYGANVLENVLSSLDYEKRERGFSRAEEILTQFSQYPFALDKDVETGISVNLYNQ 301

Query: 297 LQEELESNPGSDLKLEVIAGVFEVFSRMDMLL 328
           ++EE+  NPG+ L+LEV+AGVFEVFSRMD  L
Sbjct: 302 VKEEIGKNPGTGLQLEVVAGVFEVFSRMDNFL 333

>NDAI0B05720 Chr2 complement(1391179..1392276) [1098 bp, 365 aa]
           {ON} Anc_5.442 YDR372C
          Length = 365

 Score =  493 bits (1270), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 253/367 (68%), Positives = 291/367 (79%), Gaps = 41/367 (11%)

Query: 1   MSTLQRRRVNKSENASN-GIEDREDDGT---------------------SSGKIAYDPEE 38
           MSTLQRRR  + ++ SN G+ D + D                        S KIAYDPEE
Sbjct: 1   MSTLQRRR--RPQDGSNKGMVDVDSDNNDSSRILGSNNSNNNVSNSNTFGSSKIAYDPEE 58

Query: 39  SKL-----------------QNDSKQPTLTLMEEVLLMGLRDREGYLSFWNDSISYALRG 81
           +KL                  N++  PTLTLMEEVLLMGLRD+EGYLSFWND+ISYALRG
Sbjct: 59  AKLLNNNNINNNNSGSNSRGGNNAVTPTLTLMEEVLLMGLRDKEGYLSFWNDNISYALRG 118

Query: 82  CILIELALRNKIRILDAPARMRFDISERLIEVIDSSKTGEVLLDETLQLMVNDEPLSIAN 141
           CILIELALR KIRILD  AR RFD+SERLIEV D SKTGEVLLDETLQLM NDEPL+IAN
Sbjct: 119 CILIELALRGKIRILDDSARKRFDLSERLIEVKDGSKTGEVLLDETLQLMKNDEPLTIAN 178

Query: 142 WIDLLSGETWNLLKINYQLKQVRERLAKGLVDKGVLRTEMKNFFLFDMATHPVSDSSCKE 201
           WIDLLSGETWN++KINYQLKQVRERLAKGLVDKGVLRTEMKNFFLFDMATHPV+DSSCKE
Sbjct: 179 WIDLLSGETWNIMKINYQLKQVRERLAKGLVDKGVLRTEMKNFFLFDMATHPVTDSSCKE 238

Query: 202 AIKRRILSVLVSRNMEISYNSYFPESTNFKLIRTVSLIAGAYGANVLENVISSLEYDKRD 261
           AIKRR+LSVLVSRNME +YN YFP++T FK+IRT++LI GAYGANVLENV+SSL+Y+K D
Sbjct: 239 AIKRRVLSVLVSRNMEFNYNEYFPQNTFFKIIRTIALICGAYGANVLENVLSSLDYEKSD 298

Query: 262 KAITRAEEILAQFSQYPFDLQKESKDGISVNLNKELQEELESNPGSDLKLEVIAGVFEVF 321
            AI RA+E++AQFS++PFDL+K +   +SVNLN+ +Q+EL+ NPG DL+LEVIAGV EVF
Sbjct: 299 NAIARADELIAQFSKFPFDLEKTTNTNVSVNLNRLVQQELDENPGYDLQLEVIAGVIEVF 358

Query: 322 SRMDMLL 328
           SRMD LL
Sbjct: 359 SRMDTLL 365

>TBLA0A06480 Chr1 (1593225..1594229) [1005 bp, 334 aa] {ON}
           Anc_5.442 YDR372C
          Length = 334

 Score =  491 bits (1263), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 234/334 (70%), Positives = 288/334 (86%), Gaps = 6/334 (1%)

Query: 1   MSTLQRRRVNKSENA--SNGIEDREDDGTS----SGKIAYDPEESKLQNDSKQPTLTLME 54
           MSTLQRRR     ++  S+G +  +++ T+    S ++AYDPEE K++N+   P LTLME
Sbjct: 1   MSTLQRRRKQARSDSVGSSGTDSNDNEPTNRQAESRRVAYDPEEDKIRNNMSVPQLTLME 60

Query: 55  EVLLMGLRDREGYLSFWNDSISYALRGCILIELALRNKIRILDAPARMRFDISERLIEVI 114
           EV+L+GLRD+EGYLSFWND+ISYALRGCI+IELALR KIRILD PAR RF++SERL+EV+
Sbjct: 61  EVVLLGLRDKEGYLSFWNDNISYALRGCIIIELALRGKIRILDDPARKRFELSERLVEVV 120

Query: 115 DSSKTGEVLLDETLQLMVNDEPLSIANWIDLLSGETWNLLKINYQLKQVRERLAKGLVDK 174
           DSSKTGEVLLDE LQ+M NDEPL+I+NW+DLLSGETWN+ KINYQLKQVRER++KGLVDK
Sbjct: 121 DSSKTGEVLLDEALQIMRNDEPLAISNWVDLLSGETWNVFKINYQLKQVRERISKGLVDK 180

Query: 175 GVLRTEMKNFFLFDMATHPVSDSSCKEAIKRRILSVLVSRNMEISYNSYFPESTNFKLIR 234
           GVLRTEMKNFFLFDMATHPV+DSSCKEAIKRRILS+LV+R  E +YN YFPE+T+FK IR
Sbjct: 181 GVLRTEMKNFFLFDMATHPVTDSSCKEAIKRRILSILVNRTAEFTYNDYFPETTSFKYIR 240

Query: 235 TVSLIAGAYGANVLENVISSLEYDKRDKAITRAEEILAQFSQYPFDLQKESKDGISVNLN 294
           T+SLI  AYGANVLENV++SLEY KRD  + RAEE+L QFSQYPFDL+K+++ G S+NLN
Sbjct: 241 TISLICSAYGANVLENVLNSLEYQKRDNGLNRAEELLEQFSQYPFDLEKQTEFGTSINLN 300

Query: 295 KELQEELESNPGSDLKLEVIAGVFEVFSRMDMLL 328
             ++EE+E++P + L LEV+AGVFEVFS+MD+LL
Sbjct: 301 ALVKEEIEADPKNALFLEVVAGVFEVFSKMDLLL 334

>KLLA0E02355g Chr5 complement(217222..218196) [975 bp, 324 aa] {ON}
           highly similar to uniprot|Q06385 Saccharomyces
           cerevisiae YDR372C VPS74
          Length = 324

 Score =  488 bits (1256), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 233/327 (71%), Positives = 280/327 (85%), Gaps = 5/327 (1%)

Query: 3   TLQRRRVNKSENASNGIE-DREDDGTSSGKIAYDPEESKLQNDSKQPTLTLMEEVLLMGL 61
           +LQRRRVNK +   +  + D E D     KI YD +E+KL++++  P LTLMEEVLLMGL
Sbjct: 2   SLQRRRVNKGDTTESIPQIDNEHDH----KIVYDEQEAKLRDNTSVPKLTLMEEVLLMGL 57

Query: 62  RDREGYLSFWNDSISYALRGCILIELALRNKIRILDAPARMRFDISERLIEVIDSSKTGE 121
           +D++GYLSFWND+ISYALRGCILIELALR KIR +D PAR R+D+SERLIEVID SKTGE
Sbjct: 58  KDKQGYLSFWNDNISYALRGCILIELALRGKIRCVDDPARKRYDVSERLIEVIDGSKTGE 117

Query: 122 VLLDETLQLMVNDEPLSIANWIDLLSGETWNLLKINYQLKQVRERLAKGLVDKGVLRTEM 181
           VLLDE+L LM ND P SI  WIDLLSGETWNLLKINYQLKQVRERLAKGLVDKGVLRTEM
Sbjct: 118 VLLDESLSLMKNDPPTSIVGWIDLLSGETWNLLKINYQLKQVRERLAKGLVDKGVLRTEM 177

Query: 182 KNFFLFDMATHPVSDSSCKEAIKRRILSVLVSRNMEISYNSYFPESTNFKLIRTVSLIAG 241
           KNFFLFDMATHP++D++CKE+IKRRILS+LVSRN E++YN+YFP+  +FK IRT+SLI G
Sbjct: 178 KNFFLFDMATHPITDTTCKESIKRRILSILVSRNAELTYNTYFPQDVSFKYIRTLSLICG 237

Query: 242 AYGANVLENVISSLEYDKRDKAITRAEEILAQFSQYPFDLQKESKDGISVNLNKELQEEL 301
           AYGANVLENV+++L+Y+ RD    RA+EILAQFS++PF L K++  G+SVNLNKE+ +EL
Sbjct: 238 AYGANVLENVLATLDYEVRDTGFARADEILAQFSEFPFPLDKQTSTGVSVNLNKEISQEL 297

Query: 302 ESNPGSDLKLEVIAGVFEVFSRMDMLL 328
            ++PGSDL+LEV+AGVFEVFSRMD LL
Sbjct: 298 NNHPGSDLQLEVVAGVFEVFSRMDTLL 324

>TPHA0J02610 Chr10 complement(579213..580202) [990 bp, 329 aa] {ON}
           Anc_5.442 YDR372C
          Length = 329

 Score =  461 bits (1186), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 220/329 (66%), Positives = 271/329 (82%), Gaps = 1/329 (0%)

Query: 1   MSTLQRRRVNKSENASNGIEDREDDGTSS-GKIAYDPEESKLQNDSKQPTLTLMEEVLLM 59
           MS +QRRR+N+  N         D   S+  K+A+DPEE+K+++D   P LTLMEEV+L+
Sbjct: 1   MSGVQRRRINRISNEDESDHSDNDQSRSNVSKVAFDPEEAKIKDDVSVPKLTLMEEVVLL 60

Query: 60  GLRDREGYLSFWNDSISYALRGCILIELALRNKIRILDAPARMRFDISERLIEVIDSSKT 119
           GL D EGYLSFWND+ISY LRGCILIELALR KIRI+D  AR  FD+SERLIEVID+SKT
Sbjct: 61  GLGDSEGYLSFWNDNISYVLRGCILIELALRGKIRIIDDSARKSFDLSERLIEVIDASKT 120

Query: 120 GEVLLDETLQLMVNDEPLSIANWIDLLSGETWNLLKINYQLKQVRERLAKGLVDKGVLRT 179
           GEVLLDETLQLM NDEP SI +WIDLLSGETWN  K+NYQLKQVRERL+KGLVDKGVLRT
Sbjct: 121 GEVLLDETLQLMKNDEPQSIVSWIDLLSGETWNFFKVNYQLKQVRERLSKGLVDKGVLRT 180

Query: 180 EMKNFFLFDMATHPVSDSSCKEAIKRRILSVLVSRNMEISYNSYFPESTNFKLIRTVSLI 239
           EMKNFFLFDMATHPV+DSSCKE++KRRI+S LV R + + YN YFPEST FK+IRTVSLI
Sbjct: 181 EMKNFFLFDMATHPVADSSCKESLKRRIMSTLVDRTLSLQYNEYFPESTTFKVIRTVSLI 240

Query: 240 AGAYGANVLENVISSLEYDKRDKAITRAEEILAQFSQYPFDLQKESKDGISVNLNKELQE 299
             AY ANVLENV+++LEY+KRDKA++RAE +L  F  YPF L  E  + IS+NLN+ +++
Sbjct: 241 ITAYSANVLENVLNTLEYEKRDKALSRAENLLNNFGNYPFKLVNEPDNRISINLNQLVED 300

Query: 300 ELESNPGSDLKLEVIAGVFEVFSRMDMLL 328
           E+++NP + L+LEV+AGVF+VF++MD+++
Sbjct: 301 EIKANPKTALQLEVLAGVFDVFAKMDVII 329

>ACL165C Chr3 complement(66499..67494) [996 bp, 331 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR372C
          Length = 331

 Score =  459 bits (1181), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 222/330 (67%), Positives = 271/330 (82%), Gaps = 4/330 (1%)

Query: 3   TLQRRRVNKS---ENASNGIEDREDDGTS-SGKIAYDPEESKLQNDSKQPTLTLMEEVLL 58
           +LQRRRVNK+   E       +R D+    + K+AYDPEE KL+ ++++PTLTLMEEVLL
Sbjct: 2   SLQRRRVNKTAGNETVGGASLNRSDEEEGMTHKVAYDPEEQKLRENTREPTLTLMEEVLL 61

Query: 59  MGLRDREGYLSFWNDSISYALRGCILIELALRNKIRILDAPARMRFDISERLIEVIDSSK 118
           MGL+D+EGYLSF N++ISYALRGCILIELALR +I+++D   R RFD SERLIEV+D SK
Sbjct: 62  MGLKDKEGYLSFLNENISYALRGCILIELALRGRIQVVDDAMRRRFDPSERLIEVVDGSK 121

Query: 119 TGEVLLDETLQLMVNDEPLSIANWIDLLSGETWNLLKINYQLKQVRERLAKGLVDKGVLR 178
           TGE LLDE L LM   EPL+I NW+DLLSGETWN LKINYQL+QVRERLAKGLVDKGVLR
Sbjct: 122 TGEALLDEALTLMKGSEPLTIVNWMDLLSGETWNFLKINYQLRQVRERLAKGLVDKGVLR 181

Query: 179 TEMKNFFLFDMATHPVSDSSCKEAIKRRILSVLVSRNMEISYNSYFPESTNFKLIRTVSL 238
           TEMKNFFLFDM THPV+D+SCKE+IKRRILSVLV RN+E+ Y   FPE+  FK +RT++L
Sbjct: 182 TEMKNFFLFDMPTHPVADTSCKESIKRRILSVLVPRNVELQYTELFPETVAFKYLRTIAL 241

Query: 239 IAGAYGANVLENVISSLEYDKRDKAITRAEEILAQFSQYPFDLQKESKDGISVNLNKELQ 298
           I  A+GANVLE V+S+L+Y+KRD+  +RAEE+L QFSQYPF L K+ + GISVNLN+ +Q
Sbjct: 242 ICSAHGANVLEKVLSTLDYEKRDRGFSRAEELLVQFSQYPFALDKDIETGISVNLNRLVQ 301

Query: 299 EELESNPGSDLKLEVIAGVFEVFSRMDMLL 328
           EEL+ NPG+ L LEV+AGV +V+SRMD LL
Sbjct: 302 EELDRNPGTALNLEVVAGVLKVYSRMDDLL 331

>Kpol_1062.24 s1062 (55671..56501) [831 bp, 276 aa] {ON}
           (55671..56501) [831 nt, 277 aa]
          Length = 276

 Score =  353 bits (905), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 166/273 (60%), Positives = 211/273 (77%)

Query: 53  MEEVLLMGLRDREGYLSFWNDSISYALRGCILIELALRNKIRILDAPARMRFDISERLIE 112
           MEEV+L+G+RD+EGYLSFWN+++S+ LRGCILIELA R  I+++D P+R RFD+S+RLIE
Sbjct: 1   MEEVVLLGMRDKEGYLSFWNENLSFVLRGCILIELAFRGNIQVIDDPSRKRFDLSDRLIE 60

Query: 113 VIDSSKTGEVLLDETLQLMVNDEPLSIANWIDLLSGETWNLLKINYQLKQVRERLAKGLV 172
           V++  KTGE LLDETLQ+M ++E  SI+ WIDLLSGETWN+ KIN QLKQVRER++KGLV
Sbjct: 61  VVNPKKTGEFLLDETLQMMKSEESQSISTWIDLLSGETWNIFKINLQLKQVRERISKGLV 120

Query: 173 DKGVLRTEMKNFFLFDMATHPVSDSSCKEAIKRRILSVLVSRNMEISYNSYFPESTNFKL 232
           DKG+LRTEMKNFFLFDMATHPV D  CKE IK+RILSVL+ +   I  + YFPE+   + 
Sbjct: 121 DKGILRTEMKNFFLFDMATHPVEDLKCKEMIKKRILSVLLPQTAVILADEYFPETVQLRC 180

Query: 233 IRTVSLIAGAYGANVLENVISSLEYDKRDKAITRAEEILAQFSQYPFDLQKESKDGISVN 292
           +RT++LI  AY  +VLENV S L+Y K+D    R  EIL Q S YPF+   +S   I+ N
Sbjct: 181 LRTIALILSAYAGSVLENVASDLDYQKKDDLFVRTSEILDQSSVYPFEFDNKSSTNIATN 240

Query: 293 LNKELQEELESNPGSDLKLEVIAGVFEVFSRMD 325
           LN+ ++ EL  +   +LKLE IAGVFEVF +MD
Sbjct: 241 LNQLVENELSKDKNLNLKLETIAGVFEVFLKMD 273

>TBLA0A02780 Chr1 (670848..672011) [1164 bp, 387 aa] {ON} Anc_5.442
           YDR372C
          Length = 387

 Score =  332 bits (850), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 156/296 (52%), Positives = 213/296 (71%), Gaps = 1/296 (0%)

Query: 34  YDPEESKLQNDSKQPTLTLMEEVLLMGLRDREGYLSFWNDSISYALRGCILIELALRNKI 93
           +DPEES   N+   P L LMEE++L+GL+D++GYLSFWND+ISY LRGCILIELALR KI
Sbjct: 92  FDPEESISNNEIILPPLNLMEEIVLLGLKDKQGYLSFWNDNISYVLRGCILIELALRKKI 151

Query: 94  RILDAPARMRFDISERLIEVI-DSSKTGEVLLDETLQLMVNDEPLSIANWIDLLSGETWN 152
           +++D P R  +D+S R+IEV+   +KTG  LLDE L +M  + P SI NWIDLLSGETWN
Sbjct: 152 KVIDDPVRNMYDVSARIIEVVMPITKTGNHLLDEALNMMAKERPESIMNWIDLLSGETWN 211

Query: 153 LLKINYQLKQVRERLAKGLVDKGVLRTEMKNFFLFDMATHPVSDSSCKEAIKRRILSVLV 212
           + K N QLK VRER++KGLVDKG+L+    NF  FDM+THP+ D   KE++K+RI S+LV
Sbjct: 212 VFKNNLQLKNVRERVSKGLVDKGILKNNTSNFLFFDMSTHPLVDIGSKESVKQRIFSILV 271

Query: 213 SRNMEISYNSYFPESTNFKLIRTVSLIAGAYGANVLENVISSLEYDKRDKAITRAEEILA 272
            ++  + YN+YFPE+  FK+IR++ LI  AYGA+VL++ + ++ YD  D A  +AE++  
Sbjct: 272 PKHSYLLYNNYFPENVTFKIIRSLCLICCAYGADVLDDTLLTMNYDDSDNAFKKAEKLFE 331

Query: 273 QFSQYPFDLQKESKDGISVNLNKELQEELESNPGSDLKLEVIAGVFEVFSRMDMLL 328
             S +P +L +    G+ V++ K+LQ EL  + G  L LEV+AGV +V  RMD LL
Sbjct: 332 TISDFPINLDQREGSGVPVDIIKDLQSELLQHSGESLYLEVVAGVLQVILRMDSLL 387

>NCAS0H02090 Chr8 complement(405561..406598) [1038 bp, 345 aa] {ON}
           Anc_5.442 YDR372C
          Length = 345

 Score =  211 bits (536), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 111/294 (37%), Positives = 187/294 (63%), Gaps = 9/294 (3%)

Query: 38  ESKLQNDSKQPTLTLMEEVLLMGLRDREGYLSFWNDSISYALRGCILIELALRNKIRILD 97
           +S++  +   P LTLM+E+ L+ L+D+EGY+S W+  +SY LR C++IELALR KI+ + 
Sbjct: 53  DSEVFKEPGTPELTLMDELFLLALKDKEGYVSDWDGKLSYVLRCCVIIELALRGKIQAV- 111

Query: 98  APARMRFDIS--ERLIEVIDSSKTGEVLLDETLQLMVNDEP-LSIANWIDLLSGETWNLL 154
           A  + + D++  E  IEVID S TG+ LLD+TL LM  ++   S+++WI LLSGE+ N L
Sbjct: 112 AEGKKKKDLAPHECKIEVIDGSITGDPLLDQTLGLMKKEKKNYSVSHWIKLLSGESMNFL 171

Query: 155 KINYQLKQVRERLAKGLVDKGVLRTEMKNFFLFDMATHPVSDSSCKEAIKRRILSVLVSR 214
           K +YQL  VR+R+ + LV+ G+L  + K      + THP+ D  CK AI+ R+  +L + 
Sbjct: 172 KASYQLLHVRKRIERILVETGILSKQTKKLAAIGLDTHPIKDIKCKNAIRSRMQYILTAN 231

Query: 215 NMEISYNSYFPESTNFKLIRTVSLIAGAYGANVLENVISSLEYDKRDKAITRAEEILAQF 274
            +++    YFP++ +++++RT+ L   AYGA++L+      E ++      RA  +L+ F
Sbjct: 232 KVDLPSTKYFPDTVSYRVLRTIVLACAAYGADILDKGFFQTE-NETVIGKGRARVLLSLF 290

Query: 275 SQYPFDLQKESKDGISVNLNKELQEELESNPGSDLKLEVIAGVFEVFSRMDMLL 328
           S++PF+L +     +  +LN+++ +EL  +P    +LEV+AG  +V + +D +L
Sbjct: 291 SKFPFELNQ----AVQPDLNEKVSKELHEHPEEASQLEVVAGAIDVINTIDTVL 340

>KAFR0C05110 Chr3 (1013807..1016482) [2676 bp, 891 aa] {ON} Anc_7.39
           YOR353C
          Length = 891

 Score = 32.0 bits (71), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 36/60 (60%), Gaps = 7/60 (11%)

Query: 105 DISERLIEVIDSSKTGEVLLDETLQLMVNDEPLSIANWIDLLSG-ETWNLLKINYQLKQV 163
           D+++   + +D SK    +LDE LQL++N++PL +  ++  +   +TW   KIN  LK +
Sbjct: 737 DLTDTCCQAMDLSK----ILDERLQLLLNNDPLIVEKYLSTVEKLKTWE--KINAFLKSI 790

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.133    0.364 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 33,562,701
Number of extensions: 1442942
Number of successful extensions: 5861
Number of sequences better than 10.0: 46
Number of HSP's gapped: 6030
Number of HSP's successfully gapped: 46
Length of query: 328
Length of database: 53,481,399
Length adjustment: 110
Effective length of query: 218
Effective length of database: 40,868,139
Effective search space: 8909254302
Effective search space used: 8909254302
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 66 (30.0 bits)