Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
CAGL0A02882g5.438ON1041045546e-75
KNAG0C048805.438ON1041034601e-60
NCAS0F034105.438ON1061044453e-58
TDEL0D026305.438ON1021034332e-56
Kwal_55.214145.438ON1191044221e-54
ZYRO0F10120g5.438ON1051024046e-52
SAKL0G02618g5.438ON1041034011e-51
Kpol_1016.35.438ON971034001e-51
KLLA0E02267g5.438ON1031033881e-49
NDAI0B057005.438ON1041033837e-49
KLTH0F15972g5.438ON1031033794e-48
Kpol_1016.3asingletonON971033437e-43
ACL169W5.438ON1031033333e-41
Ecym_45095.438ON1031033282e-40
TPHA0C00950singletonON991042622e-30
TBLA0C05870singletonON1001012041e-21
KAFR0D02490singletonON107951962e-20
KAFR0D02400singletonON114901591e-14
KAFR0D02500singletonON112911468e-13
SAKL0D07260g1.305ON57648700.30
Kwal_14.18516.104ON53545670.76
KNAG0C00570na 1ON19538622.8
YEL031W (SPF1)1.476ON121565614.1
NDAI0A020907.322ON120067605.2
Smik_5.721.476ON121565606.2
NDAI0B00595singletonON37862598.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0A02882g
         (104 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0A02882g Chr1 (302262..302576) [315 bp, 104 aa] {ON} highly ...   218   6e-75
KNAG0C04880 Chr3 complement(944928..945242) [315 bp, 104 aa] {ON...   181   1e-60
NCAS0F03410 Chr6 (687900..688220) [321 bp, 106 aa] {ON} Anc_5.438     176   3e-58
TDEL0D02630 Chr4 complement(502356..502664) [309 bp, 102 aa] {ON...   171   2e-56
Kwal_55.21414 s55 complement(825799..826158) [360 bp, 119 aa] {O...   167   1e-54
ZYRO0F10120g Chr6 (820318..820635) [318 bp, 105 aa] {ON} conserv...   160   6e-52
SAKL0G02618g Chr7 (217435..217749) [315 bp, 104 aa] {ON} conserv...   159   1e-51
Kpol_1016.3 s1016 complement(6319..6612) [294 bp, 97 aa] {ON} co...   158   1e-51
KLLA0E02267g Chr5 (212406..212717) [312 bp, 103 aa] {ON} conserv...   154   1e-49
NDAI0B05700 Chr2 (1388730..1389044) [315 bp, 104 aa] {ON} Anc_5....   152   7e-49
KLTH0F15972g Chr6 complement(1297711..1298022) [312 bp, 103 aa] ...   150   4e-48
Kpol_1016.3a s1016 complement(7088..7381) [294 bp, 97 aa] {ON} c...   136   7e-43
ACL169W Chr3 (61958..62269) [312 bp, 103 aa] {ON} NOHBY311; No h...   132   3e-41
Ecym_4509 Chr4 (1018498..1018809) [312 bp, 103 aa] {ON} similar ...   130   2e-40
TPHA0C00950 Chr3 (203282..203581) [300 bp, 99 aa] {ON}                105   2e-30
TBLA0C05870 Chr3 complement(1422912..1423214) [303 bp, 100 aa] {...    83   1e-21
KAFR0D02490 Chr4 complement(498165..498488) [324 bp, 107 aa] {ON}      80   2e-20
KAFR0D02400 Chr4 (483506..483850) [345 bp, 114 aa] {ON}                66   1e-14
KAFR0D02500 Chr4 complement(498712..499050) [339 bp, 112 aa] {ON}      61   8e-13
SAKL0D07260g Chr4 (597979..599709) [1731 bp, 576 aa] {ON} simila...    32   0.30 
Kwal_14.1851 s14 complement(494548..496155) [1608 bp, 535 aa] {O...    30   0.76 
KNAG0C00570 Chr3 complement(98150..98737) [588 bp, 195 aa] {ON}        28   2.8  
YEL031W Chr5 (90258..93905) [3648 bp, 1215 aa] {ON}  SPF1P-type ...    28   4.1  
NDAI0A02090 Chr1 complement(466744..470346) [3603 bp, 1200 aa] {...    28   5.2  
Smik_5.72 Chr5 (98889..102536) [3648 bp, 1215 aa] {ON} YEL031W (...    28   6.2  
NDAI0B00595 Chr2 (131225..132361) [1137 bp, 378 aa] {ON}               27   8.3  

>CAGL0A02882g Chr1 (302262..302576) [315 bp, 104 aa] {ON} highly
           similar to KLLA0E02266g Kluyveromyces lactis
          Length = 104

 Score =  218 bits (554), Expect = 6e-75,   Method: Compositional matrix adjust.
 Identities = 104/104 (100%), Positives = 104/104 (100%)

Query: 1   MVEWCVIVYDKPGSDRSTCRPQHLAGIPPLVEAGKLVCAGAIYNEPAQAGGERTFAGSHL 60
           MVEWCVIVYDKPGSDRSTCRPQHLAGIPPLVEAGKLVCAGAIYNEPAQAGGERTFAGSHL
Sbjct: 1   MVEWCVIVYDKPGSDRSTCRPQHLAGIPPLVEAGKLVCAGAIYNEPAQAGGERTFAGSHL 60

Query: 61  QIVADTKEEALELVHNDVFAKNGIWDLENIIIYQFGCAVRQPKA 104
           QIVADTKEEALELVHNDVFAKNGIWDLENIIIYQFGCAVRQPKA
Sbjct: 61  QIVADTKEEALELVHNDVFAKNGIWDLENIIIYQFGCAVRQPKA 104

>KNAG0C04880 Chr3 complement(944928..945242) [315 bp, 104 aa] {ON}
           Anc_5.438
          Length = 104

 Score =  181 bits (460), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 83/103 (80%), Positives = 91/103 (88%)

Query: 1   MVEWCVIVYDKPGSDRSTCRPQHLAGIPPLVEAGKLVCAGAIYNEPAQAGGERTFAGSHL 60
           MVEWC +VYDKPGSDRS  RP+HLA IP LV+ GKLVCAGAIYNEP   GG+RTFAGSHL
Sbjct: 1   MVEWCAVVYDKPGSDRSQFRPEHLANIPKLVQQGKLVCAGAIYNEPTTPGGDRTFAGSHL 60

Query: 61  QIVADTKEEALELVHNDVFAKNGIWDLENIIIYQFGCAVRQPK 103
           QIVADTKEEALE++H DVFAK GIWDL NII+YQFGCAVR+PK
Sbjct: 61  QIVADTKEEALEVIHGDVFAKEGIWDLSNIILYQFGCAVREPK 103

>NCAS0F03410 Chr6 (687900..688220) [321 bp, 106 aa] {ON} Anc_5.438
          Length = 106

 Score =  176 bits (445), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 82/104 (78%), Positives = 89/104 (85%)

Query: 1   MVEWCVIVYDKPGSDRSTCRPQHLAGIPPLVEAGKLVCAGAIYNEPAQAGGERTFAGSHL 60
           MVEWCVIVYDKPGSDRS  RPQHLA IP LVE GKLVCAGAIYNEP   G   TFAGSHL
Sbjct: 1   MVEWCVIVYDKPGSDRSAFRPQHLAAIPALVEQGKLVCAGAIYNEPKSEGEAPTFAGSHL 60

Query: 61  QIVADTKEEALELVHNDVFAKNGIWDLENIIIYQFGCAVRQPKA 104
           QI+ADTKEEAL +V ND+FAK GIWD +NIIIY+FGCAVR+PK+
Sbjct: 61  QIIADTKEEALAIVMNDIFAKEGIWDTDNIIIYRFGCAVREPKS 104

>TDEL0D02630 Chr4 complement(502356..502664) [309 bp, 102 aa] {ON}
           Anc_5.438
          Length = 102

 Score =  171 bits (433), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 83/103 (80%), Positives = 88/103 (85%), Gaps = 2/103 (1%)

Query: 1   MVEWCVIVYDKPGSDRSTCRPQHLAGIPPLVEAGKLVCAGAIYNEPAQAGGERTFAGSHL 60
           MVEW VIVYDK   DRS  RP HLAGIPPLVE GKLVCAGAIYNEP   GGERTFAGSHL
Sbjct: 1   MVEWVVIVYDK--GDRSAFRPAHLAGIPPLVEQGKLVCAGAIYNEPTTPGGERTFAGSHL 58

Query: 61  QIVADTKEEALELVHNDVFAKNGIWDLENIIIYQFGCAVRQPK 103
           QIVADTKEEALE+V  D+FAK G+WDL+NIIIYQFGCAVR+ K
Sbjct: 59  QIVADTKEEALEVVKGDIFAKEGVWDLDNIIIYQFGCAVRKEK 101

>Kwal_55.21414 s55 complement(825799..826158) [360 bp, 119 aa] {ON}
           [contig 130] FULL
          Length = 119

 Score =  167 bits (422), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 82/104 (78%), Positives = 85/104 (81%)

Query: 1   MVEWCVIVYDKPGSDRSTCRPQHLAGIPPLVEAGKLVCAGAIYNEPAQAGGERTFAGSHL 60
           MVEWCVIVYDK GSDRS  RP HL GIP LVE GKLVCAGAIY + +  G    FAGSHL
Sbjct: 16  MVEWCVIVYDKKGSDRSLFRPAHLQGIPKLVEEGKLVCAGAIYQDVSPEGKLSNFAGSHL 75

Query: 61  QIVADTKEEALELVHNDVFAKNGIWDLENIIIYQFGCAVRQPKA 104
           QIVADTKEEALE+V  DVFAK GIWDLENIIIY FGCAVRQPKA
Sbjct: 76  QIVADTKEEALEIVKGDVFAKEGIWDLENIIIYPFGCAVRQPKA 119

>ZYRO0F10120g Chr6 (820318..820635) [318 bp, 105 aa] {ON} conserved
           hypothetical protein
          Length = 105

 Score =  160 bits (404), Expect = 6e-52,   Method: Compositional matrix adjust.
 Identities = 73/102 (71%), Positives = 87/102 (85%), Gaps = 2/102 (1%)

Query: 1   MVEWCVIVYDKPGSDRSTCRPQHLAGIPPLVEAGKLVCAGAIYNEPAQAGGERTFAGSHL 60
           MVEW VI +DK  +DRS  R +HLAGIPP VE+GKLVCAGAIYNEP   G  RTFAGSHL
Sbjct: 1   MVEWVVIAFDK--ADRSAYRSEHLAGIPPQVESGKLVCAGAIYNEPKAPGEPRTFAGSHL 58

Query: 61  QIVADTKEEALELVHNDVFAKNGIWDLENIIIYQFGCAVRQP 102
           Q+VADTKEEA+E+V +D+FAK G+WDL+N+I+YQFGCA+RQP
Sbjct: 59  QVVADTKEEAIEIVKSDIFAKEGVWDLDNLIVYQFGCAIRQP 100

>SAKL0G02618g Chr7 (217435..217749) [315 bp, 104 aa] {ON} conserved
           hypothetical protein
          Length = 104

 Score =  159 bits (401), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 76/103 (73%), Positives = 84/103 (81%)

Query: 1   MVEWCVIVYDKPGSDRSTCRPQHLAGIPPLVEAGKLVCAGAIYNEPAQAGGERTFAGSHL 60
           MVEWCV+VYDKP +DRS  RP HLAGIPPLVE GKLVCAGAI+NE  Q G    FAGS L
Sbjct: 1   MVEWCVVVYDKPNADRSQFRPAHLAGIPPLVEQGKLVCAGAIFNEIPQEGKPLNFAGSQL 60

Query: 61  QIVADTKEEALELVHNDVFAKNGIWDLENIIIYQFGCAVRQPK 103
            IVAD+KEEAL +V NDVFAK GIWDLENI+I+ FGCAVR+ K
Sbjct: 61  TIVADSKEEALGVVKNDVFAKEGIWDLENILIFPFGCAVRKEK 103

>Kpol_1016.3 s1016 complement(6319..6612) [294 bp, 97 aa] {ON}
           complement(6319..6612) [294 nt, 98 aa]
          Length = 97

 Score =  158 bits (400), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 77/103 (74%), Positives = 86/103 (83%), Gaps = 6/103 (5%)

Query: 1   MVEWCVIVYDKPGSDRSTCRPQHLAGIPPLVEAGKLVCAGAIYNEPAQAGGERTFAGSHL 60
           MVEWCVI+ DK GSDRS  RPQHLAGIPPLVE GKL CAGAIYN+      + +FAGSHL
Sbjct: 1   MVEWCVIINDKKGSDRSELRPQHLAGIPPLVEQGKLKCAGAIYND------DGSFAGSHL 54

Query: 61  QIVADTKEEALELVHNDVFAKNGIWDLENIIIYQFGCAVRQPK 103
           QIVADTKE+ALE+V  DVFA  GIWDL++IIIY+FGCAVRQPK
Sbjct: 55  QIVADTKEQALEVVKGDVFATGGIWDLDSIIIYKFGCAVRQPK 97

>KLLA0E02267g Chr5 (212406..212717) [312 bp, 103 aa] {ON} conserved
           hypothetical protein
          Length = 103

 Score =  154 bits (388), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 74/103 (71%), Positives = 84/103 (81%), Gaps = 1/103 (0%)

Query: 1   MVEWCVIVYDKPGSDRSTCRPQHLAGIPPLVEAGKLVCAGAIYNEPAQAGGERTFAGSHL 60
           MVEW VIVYDKPGSDRS CRPQHLAGIPPLVEAGK+V AGAIY +    G    FAGSHL
Sbjct: 1   MVEWVVIVYDKPGSDRSACRPQHLAGIPPLVEAGKIVHAGAIYKDVVD-GKPANFAGSHL 59

Query: 61  QIVADTKEEALELVHNDVFAKNGIWDLENIIIYQFGCAVRQPK 103
            IVAD+K+E +EL+ NDVFAKN IWD++N +IY FGCAVR+ K
Sbjct: 60  TIVADSKDEVVELLKNDVFAKNDIWDVDNALIYPFGCAVRKEK 102

>NDAI0B05700 Chr2 (1388730..1389044) [315 bp, 104 aa] {ON} Anc_5.438
          Length = 104

 Score =  152 bits (383), Expect = 7e-49,   Method: Compositional matrix adjust.
 Identities = 70/103 (67%), Positives = 80/103 (77%)

Query: 1   MVEWCVIVYDKPGSDRSTCRPQHLAGIPPLVEAGKLVCAGAIYNEPAQAGGERTFAGSHL 60
           MVEWCVI+ DK GSDRS    QH AGIP LVE GK+VC GAIYNEP + GG  T AGSHL
Sbjct: 1   MVEWCVIINDKKGSDRSAFNSQHFAGIPALVEQGKVVCGGAIYNEPTEEGGNPTVAGSHL 60

Query: 61  QIVADTKEEALELVHNDVFAKNGIWDLENIIIYQFGCAVRQPK 103
           Q+VADTKEE +ELV  D+FAK GIWD++N IIY+F  A+R PK
Sbjct: 61  QVVADTKEEVMELVKKDIFAKEGIWDVDNAIIYRFDAALRLPK 103

>KLTH0F15972g Chr6 complement(1297711..1298022) [312 bp, 103 aa]
           {ON} conserved hypothetical protein
          Length = 103

 Score =  150 bits (379), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 72/103 (69%), Positives = 80/103 (77%)

Query: 1   MVEWCVIVYDKPGSDRSTCRPQHLAGIPPLVEAGKLVCAGAIYNEPAQAGGERTFAGSHL 60
           MVEWCVIV+DK GSDRS CRP HL G+    E G LVCAGAIY+E    G    FAGSHL
Sbjct: 1   MVEWCVIVFDKKGSDRSACRPAHLEGVAQQYEKGTLVCAGAIYHEVGPDGKPTNFAGSHL 60

Query: 61  QIVADTKEEALELVHNDVFAKNGIWDLENIIIYQFGCAVRQPK 103
           QI A+TKE+AL++V ND+FAK GIWDLENIIIY FGCAVRQ K
Sbjct: 61  QISANTKEDALQVVKNDIFAKEGIWDLENIIIYPFGCAVRQGK 103

>Kpol_1016.3a s1016 complement(7088..7381) [294 bp, 97 aa] {ON}
           complement(7088..7381) [294 nt, 98 aa]
          Length = 97

 Score =  136 bits (343), Expect = 7e-43,   Method: Compositional matrix adjust.
 Identities = 65/103 (63%), Positives = 77/103 (74%), Gaps = 6/103 (5%)

Query: 1   MVEWCVIVYDKPGSDRSTCRPQHLAGIPPLVEAGKLVCAGAIYNEPAQAGGERTFAGSHL 60
           M EWC+I+ DK GS+RS    QH AGI PLVE G L C GAIYN+      + + AGSHL
Sbjct: 1   MSEWCIIINDKKGSNRSELLSQHFAGISPLVEQGILTCGGAIYND------DGSVAGSHL 54

Query: 61  QIVADTKEEALELVHNDVFAKNGIWDLENIIIYQFGCAVRQPK 103
           QIVADTKE+ALE+V  DVFA  GIWDL++I+IY+F CAVRQPK
Sbjct: 55  QIVADTKEQALEVVKGDVFATGGIWDLDSIVIYKFACAVRQPK 97

>ACL169W Chr3 (61958..62269) [312 bp, 103 aa] {ON} NOHBY311; No
           homolog in Saccharomyces cerevisiae
          Length = 103

 Score =  132 bits (333), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 63/103 (61%), Positives = 78/103 (75%), Gaps = 1/103 (0%)

Query: 1   MVEWCVIVYDKPGSDRSTCRPQHLAGIPPLVEAGKLVCAGAIYNEPAQAGGERTFAGSHL 60
           MVEWC I+YDKPG DRS  R +HLA IP LVE GKLV AGAIY E    G    FAGS L
Sbjct: 1   MVEWCAIIYDKPGVDRSVHRQEHLAEIPKLVEQGKLVQAGAIYKEVVD-GRPSQFAGSQL 59

Query: 61  QIVADTKEEALELVHNDVFAKNGIWDLENIIIYQFGCAVRQPK 103
            +VAD++EEAL ++ +D FAK+G+WD+EN+++Y FGCAVR+ K
Sbjct: 60  TLVADSREEALAIIRDDPFAKHGVWDVENVVLYPFGCAVRKEK 102

>Ecym_4509 Chr4 (1018498..1018809) [312 bp, 103 aa] {ON} similar to
           Ashbya gossypii ACL169W
          Length = 103

 Score =  130 bits (328), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 62/103 (60%), Positives = 77/103 (74%), Gaps = 1/103 (0%)

Query: 1   MVEWCVIVYDKPGSDRSTCRPQHLAGIPPLVEAGKLVCAGAIYNEPAQAGGERTFAGSHL 60
           MVEWCV VYDKPGSDRS  R  HL  IP LV+ GK+V AGAIY +    G    FAGSHL
Sbjct: 1   MVEWCVTVYDKPGSDRSPYRSMHLERIPELVQEGKIVVAGAIYKDLVD-GKPGGFAGSHL 59

Query: 61  QIVADTKEEALELVHNDVFAKNGIWDLENIIIYQFGCAVRQPK 103
            +VADT+EE +EL+  D++AK G+WD++NI+I+ FGCAVR+ K
Sbjct: 60  ILVADTREEVVELLKGDIYAKEGVWDMDNILIFPFGCAVRKEK 102

>TPHA0C00950 Chr3 (203282..203581) [300 bp, 99 aa] {ON} 
          Length = 99

 Score =  105 bits (262), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 50/104 (48%), Positives = 72/104 (69%), Gaps = 8/104 (7%)

Query: 1   MVEWCVIVYDKPGSD--RSTCRPQHLAGIPPLVEAGKLVCAGAIYNEPAQAGGERTFAGS 58
           M E+ V++ D  G++  R    P+H   IPPLV+AG +VC GA++NE      E +  GS
Sbjct: 1   MSEYVVVIKDHAGAEKLREQHGPEHFGNIPPLVDAGIVVCGGAMFNE------EGSPVGS 54

Query: 59  HLQIVADTKEEALELVHNDVFAKNGIWDLENIIIYQFGCAVRQP 102
           H+QIVAD++E+ LE++  DVFA+  +WDLE+ IIY+F CAVR+P
Sbjct: 55  HIQIVADSREQVLEMLKKDVFARENVWDLESAIIYKFDCAVRKP 98

>TBLA0C05870 Chr3 complement(1422912..1423214) [303 bp, 100 aa] {ON}
           
          Length = 100

 Score = 83.2 bits (204), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 38/101 (37%), Positives = 59/101 (58%), Gaps = 6/101 (5%)

Query: 1   MVEWCVIVYDKPGSDRSTCRPQHLAGIPPLVEAGKLVCAGAIYNEPAQAGGERTFAGSHL 60
           M EW V + D P SDR+    +H+  +P L+ AG L C GA+ ++           GSH 
Sbjct: 1   MTEWYVTIKDIPNSDRTPVLKEHMDRLPILINAGVLSCGGALLDDNGN------MIGSHF 54

Query: 61  QIVADTKEEALELVHNDVFAKNGIWDLENIIIYQFGCAVRQ 101
           ++  +TKEEA++L++ D F K G+WD+ +I I +F C  R+
Sbjct: 55  ELKVETKEEAMKLINEDPFVKGGVWDMNSIQIRKFYCVHRE 95

>KAFR0D02490 Chr4 complement(498165..498488) [324 bp, 107 aa] {ON}
          
          Length = 107

 Score = 80.1 bits (196), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 60/95 (63%), Gaps = 6/95 (6%)

Query: 1  MVEWCVIVYDKPGSDRSTCRPQHLAGIPPLVEAGKLVCAGAIYNEPAQAGGERTFAGSHL 60
          M EW V V DKP +DR+    +HLA +P L E   LV AGA+  +  +        GS  
Sbjct: 1  MPEWIVNVQDKPEADRAPYNDRHLAALPGLFEKKVLVSAGALIGDNGKE------VGSSF 54

Query: 61 QIVADTKEEALELVHNDVFAKNGIWDLENIIIYQF 95
          Q+VA++KE+A+ ++ ND+FAK G+++L++ + Y+F
Sbjct: 55 QVVAESKEDAINVIKNDIFAKEGVYNLDSFVCYRF 89

>KAFR0D02400 Chr4 (483506..483850) [345 bp, 114 aa] {ON} 
          Length = 114

 Score = 65.9 bits (159), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 33/90 (36%), Positives = 51/90 (56%), Gaps = 6/90 (6%)

Query: 1  MVEWCVIVYDKPGSDRSTCRPQHLAGIPPLVEAGKLVCAGAIYNEPAQAGGERTFAGSHL 60
          M EW V V D    DR+   P+H+  +P LV+ G +V AGA+     +        G   
Sbjct: 1  MPEWLVKVKDNKDVDRAPYYPEHMRDLPSLVDGGIIVVAGALTTPEGKE------IGGMF 54

Query: 61 QIVADTKEEALELVHNDVFAKNGIWDLENI 90
           + A TKEEA+E+V  DVFA+ GI++++++
Sbjct: 55 IVTAKTKEEAIEIVKRDVFARKGIFNMDSV 84

>KAFR0D02500 Chr4 complement(498712..499050) [339 bp, 112 aa] {ON}
          
          Length = 112

 Score = 60.8 bits (146), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 36/91 (39%), Positives = 51/91 (56%), Gaps = 8/91 (8%)

Query: 1  MVEWCVIVYDKPGSDRSTCRPQHLAGIPPLVEAGKLVCAGAIYN-EPAQAGGERTFAGSH 59
          M EW V + D  G+DR+   P+H+  +  L +   LV AGA+   E  + GG        
Sbjct: 1  MPEWLVKIEDIEGADRTPYYPEHMQNLKNLFDEKILVGAGALTTPEGKETGG-------I 53

Query: 60 LQIVADTKEEALELVHNDVFAKNGIWDLENI 90
          L I A TKEEA+E+V  DVFA+ GI+ ++ I
Sbjct: 54 LIIAAKTKEEAIEVVKRDVFARKGIFKMDTI 84

>SAKL0D07260g Chr4 (597979..599709) [1731 bp, 576 aa] {ON} similar
          to uniprot|P40362 Saccharomyces cerevisiae YJL069C
          UTP18 Possible U3 snoRNP protein involved in maturation
          of pre-18S rRNA based on computational analysis of
          large-scale protein-protein interaction data
          Length = 576

 Score = 31.6 bits (70), Expect = 0.30,   Method: Composition-based stats.
 Identities = 18/48 (37%), Positives = 26/48 (54%), Gaps = 5/48 (10%)

Query: 44 NEPAQAGGERTFAGSHLQIVADTKEEALELVHND--VFAKNGIWDLEN 89
          NE A  GGE     SH +  AD +E  ++ VH+D   F  +G+  +EN
Sbjct: 45 NEDAYVGGEEN---SHEEETADGEENEMDRVHDDQLFFVDDGVETIEN 89

>Kwal_14.1851 s14 complement(494548..496155) [1608 bp, 535 aa] {ON}
           YBR212W (NGR1) - negative growth regulatory protein
           [contig 235] FULL
          Length = 535

 Score = 30.4 bits (67), Expect = 0.76,   Method: Composition-based stats.
 Identities = 16/45 (35%), Positives = 23/45 (51%), Gaps = 1/45 (2%)

Query: 18  TCRPQHLAGIPPLVEAGKLVCAGAIYNEPAQAGGERT-FAGSHLQ 61
           T R   +  +P  + A  L  A  ++N+PA  G   + FA SHLQ
Sbjct: 472 TGRHSAMQDMPSCLPAANLNRAATVWNQPAAPGSTNSMFASSHLQ 516

>KNAG0C00570 Chr3 complement(98150..98737) [588 bp, 195 aa] {ON} 
          Length = 195

 Score = 28.5 bits (62), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 22/38 (57%)

Query: 25  AGIPPLVEAGKLVCAGAIYNEPAQAGGERTFAGSHLQI 62
           A +P  V  G  V +  ++  PA+A GE+TF  + +QI
Sbjct: 156 AALPADVPKGWSVHSQLVFGLPAEAAGEKTFIDNKVQI 193

>YEL031W Chr5 (90258..93905) [3648 bp, 1215 aa] {ON}  SPF1P-type
           ATPase, ion transporter of the ER membrane involved in
           ER function and Ca2+ homeostasis; required for
           regulating Hmg2p degradation; confers sensitivity to a
           killer toxin (SMKT) produced by Pichia farinosa KK1
          Length = 1215

 Score = 28.1 bits (61), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 17/65 (26%), Positives = 27/65 (41%)

Query: 21  PQHLAGIPPLVEAGKLVCAGAIYNEPAQAGGERTFAGSHLQIVADTKEEALELVHNDVFA 80
           P+H + IPP  + G L        E +Q    R    S  ++  D KE  + ++   +FA
Sbjct: 351 PEHKSDIPPPPDGGALAIVTKTGFETSQGSLVRVMIYSAERVSVDNKEALMFILFLLIFA 410

Query: 81  KNGIW 85
               W
Sbjct: 411 VIASW 415

>NDAI0A02090 Chr1 complement(466744..470346) [3603 bp, 1200 aa] {ON}
           Anc_7.322 YDL145C
          Length = 1200

 Score = 27.7 bits (60), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 15/67 (22%), Positives = 26/67 (38%)

Query: 34  GKLVCAGAIYNEPAQAGGERTFAGSHLQIVADTKEEALELVHNDVFAKNGIWDLENIIIY 93
           GK+      Y   +  G        H   +A+ K E +  +H  +  K+  WD   ++IY
Sbjct: 488 GKIAAKNVKYVSWSLDGQHVALMSKHTITIANKKLELVNSMHETIRIKSAAWDESGVLIY 547

Query: 94  QFGCAVR 100
                +R
Sbjct: 548 STLNHIR 554

>Smik_5.72 Chr5 (98889..102536) [3648 bp, 1215 aa] {ON} YEL031W
           (REAL)
          Length = 1215

 Score = 27.7 bits (60), Expect = 6.2,   Method: Composition-based stats.
 Identities = 17/65 (26%), Positives = 27/65 (41%)

Query: 21  PQHLAGIPPLVEAGKLVCAGAIYNEPAQAGGERTFAGSHLQIVADTKEEALELVHNDVFA 80
           P+H + IPP  + G L        E +Q    R    S  ++  D KE  + ++   +FA
Sbjct: 351 PEHKSDIPPPPDGGALAIVTKTGFETSQGSLVRVMIYSAERVSVDNKEALMFILFLLIFA 410

Query: 81  KNGIW 85
               W
Sbjct: 411 VVASW 415

>NDAI0B00595 Chr2 (131225..132361) [1137 bp, 378 aa] {ON}
          Length = 378

 Score = 27.3 bits (59), Expect = 8.3,   Method: Composition-based stats.
 Identities = 18/62 (29%), Positives = 29/62 (46%), Gaps = 2/62 (3%)

Query: 28  PPLVEAGKLVCAGAIYNEPAQAGGERTFAGSHLQIVADTKEEALELVHNDVFAKNGIWDL 87
           PPL +A K      +++    +GG        L  V  TKE+A EL+ + +     I +L
Sbjct: 180 PPLQDAWKFGADIILHSATKYSGGHSDLLAGVL--VVKTKEQAYELIEDRIHLGTNIGNL 237

Query: 88  EN 89
           E+
Sbjct: 238 ES 239

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.138    0.435 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 10,828,562
Number of extensions: 362508
Number of successful extensions: 657
Number of sequences better than 10.0: 28
Number of HSP's gapped: 645
Number of HSP's successfully gapped: 28
Length of query: 104
Length of database: 53,481,399
Length adjustment: 74
Effective length of query: 30
Effective length of database: 44,996,115
Effective search space: 1349883450
Effective search space used: 1349883450
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 59 (27.3 bits)