Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
CAGL0A02860g5.437ON40240220640.0
Suva_2.5425.437ON4423436355e-78
NCAS0F034005.437ON4153586311e-77
Skud_4.6395.437ON4423406278e-77
KAFR0E038205.437ON3963396186e-76
YDR370C5.437ON4423416001e-72
Smik_4.6365.437ON4463455956e-72
NDAI0B056905.437ON4233615859e-71
TDEL0B021805.437ON4183445231e-61
Kpol_1016.45.437ON4133595133e-60
KLTH0F15994g5.437ON3903704888e-57
ZYRO0F10098g5.437ON3732894861e-56
TBLA0A028005.437ON4533364762e-54
SAKL0G02596g5.437ON4003574627e-53
Kwal_55.214155.437ON3892864619e-53
KNAG0C048905.437ON4053744331e-48
TPHA0J026005.437ON4413254203e-46
AER404C5.437ON3863633752e-40
KLLA0E02245g5.437ON4033143255e-33
KLLA0E12893g3.570ON3842281151e-05
NDAI0I032603.570ON3772281089e-05
TPHA0G036503.570ON377791042e-04
KAFR0J001603.570ON380137940.005
NCAS0E002403.570ON380180920.008
Kwal_47.192763.570ON38690900.013
KLTH0G00660g3.570ON383132890.017
YGL246C (RAI1)3.570ON38777870.033
Suva_7.153.570ON38977870.034
Skud_7.213.570ON38979860.039
Smik_7.153.570ON38777860.047
CAGL0C01925g3.570ON40077840.072
ZYRO0E09592g3.570ON38079830.10
AFR262CsingletonON77575800.24
SAKL0F00726g3.570ON38377800.25
KAFR0E025005.481ON670133800.27
Kpol_380.83.570ON379233790.30
Kwal_55.201955.375ON402142750.83
Kpol_1035.408.34ON151733713.2
Suva_5.1373.537ON465119713.3
KLTH0E03674g5.375ON400142695.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0A02860g
         (402 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0A02860g Chr1 complement(300736..301944) [1209 bp, 402 aa] {...   799   0.0  
Suva_2.542 Chr2 complement(968396..969724) [1329 bp, 442 aa] {ON...   249   5e-78
NCAS0F03400 Chr6 complement(686480..687727) [1248 bp, 415 aa] {O...   247   1e-77
Skud_4.639 Chr4 complement(1140646..1141974) [1329 bp, 442 aa] {...   246   8e-77
KAFR0E03820 Chr5 (758469..759659) [1191 bp, 396 aa] {ON} Anc_5.4...   242   6e-76
YDR370C Chr4 complement(1217782..1219110) [1329 bp, 442 aa] {ON}...   235   1e-72
Smik_4.636 Chr4 complement(1137846..1139186) [1341 bp, 446 aa] {...   233   6e-72
NDAI0B05690 Chr2 (1387153..1388424) [1272 bp, 423 aa] {ON} Anc_5...   229   9e-71
TDEL0B02180 Chr2 (388145..389401) [1257 bp, 418 aa] {ON} Anc_5.4...   206   1e-61
Kpol_1016.4 s1016 (8493..9362,9366..9737) [1242 bp, 413 aa] {ON}...   202   3e-60
KLTH0F15994g Chr6 (1298649..1299821) [1173 bp, 390 aa] {ON} weak...   192   8e-57
ZYRO0F10098g Chr6 complement(818672..819793) [1122 bp, 373 aa] {...   191   1e-56
TBLA0A02800 Chr1 (675150..676511) [1362 bp, 453 aa] {ON} Anc_5.4...   187   2e-54
SAKL0G02596g Chr7 complement(214675..215877) [1203 bp, 400 aa] {...   182   7e-53
Kwal_55.21415 s55 (826461..827630) [1170 bp, 389 aa] {ON} YDR370...   182   9e-53
KNAG0C04890 Chr3 (945616..946833) [1218 bp, 405 aa] {ON} Anc_5.4...   171   1e-48
TPHA0J02600 Chr10 complement(577310..578635) [1326 bp, 441 aa] {...   166   3e-46
AER404C Chr5 complement(1412412..1413572) [1161 bp, 386 aa] {ON}...   149   2e-40
KLLA0E02245g Chr5 complement(210001..211212) [1212 bp, 403 aa] {...   129   5e-33
KLLA0E12893g Chr5 complement(1140409..1141563) [1155 bp, 384 aa]...    49   1e-05
NDAI0I03260 Chr9 (765221..766354) [1134 bp, 377 aa] {ON} Anc_3.570     46   9e-05
TPHA0G03650 Chr7 (776977..778110) [1134 bp, 377 aa] {ON} Anc_3.5...    45   2e-04
KAFR0J00160 Chr10 complement(26405..27547) [1143 bp, 380 aa] {ON...    41   0.005
NCAS0E00240 Chr5 complement(34922..36064) [1143 bp, 380 aa] {ON}...    40   0.008
Kwal_47.19276 s47 (1168248..1169408) [1161 bp, 386 aa] {ON} YGL2...    39   0.013
KLTH0G00660g Chr7 complement(44243..45394) [1152 bp, 383 aa] {ON...    39   0.017
YGL246C Chr7 complement(37617..38780) [1164 bp, 387 aa] {ON}  RA...    38   0.033
Suva_7.15 Chr7 complement(32131..33300) [1170 bp, 389 aa] {ON} Y...    38   0.034
Skud_7.21 Chr7 complement(41773..42942) [1170 bp, 389 aa] {ON} Y...    38   0.039
Smik_7.15 Chr7 complement(32394..33557) [1164 bp, 387 aa] {ON} Y...    38   0.047
CAGL0C01925g Chr3 complement(202920..204122) [1203 bp, 400 aa] {...    37   0.072
ZYRO0E09592g Chr5 (764748..765890) [1143 bp, 380 aa] {ON} simila...    37   0.10 
AFR262C Chr6 complement(904657..906984) [2328 bp, 775 aa] {ON} S...    35   0.24 
SAKL0F00726g Chr6 complement(63291..64442) [1152 bp, 383 aa] {ON...    35   0.25 
KAFR0E02500 Chr5 (511386..513398) [2013 bp, 670 aa] {ON} Anc_5.4...    35   0.27 
Kpol_380.8 s380 (14034..15173) [1140 bp, 379 aa] {ON} (14034..15...    35   0.30 
Kwal_55.20195 s55 complement(291627..292835) [1209 bp, 402 aa] {...    33   0.83 
Kpol_1035.40 s1035 (101912..102910,102960..102968,103011..106556...    32   3.2  
Suva_5.137 Chr5 complement(203068..204465) [1398 bp, 465 aa] {ON...    32   3.3  
KLTH0E03674g Chr5 complement(333386..334588) [1203 bp, 400 aa] {...    31   5.2  

>CAGL0A02860g Chr1 complement(300736..301944) [1209 bp, 402 aa] {ON}
           similar to uniprot|Q06349 Saccharomyces cerevisiae
           YDR370c
          Length = 402

 Score =  799 bits (2064), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 386/402 (96%), Positives = 386/402 (96%)

Query: 1   MEEVVNQLEALSLSNDXXXXXXXXXXXXXXXXNSRARDDHTVVIRGNKQRLKTSHHKNMP 60
           MEEVVNQLEALSLSND                NSRARDDHTVVIRGNKQRLKTSHHKNMP
Sbjct: 1   MEEVVNQLEALSLSNDKRRVKGQRKGKKKKHGNSRARDDHTVVIRGNKQRLKTSHHKNMP 60

Query: 61  QFYDSAKTLGIFHDHKLYEMNRMDLFPQLKDPIAHIAKSTPAEKTQLVRPFLGISLYENH 120
           QFYDSAKTLGIFHDHKLYEMNRMDLFPQLKDPIAHIAKSTPAEKTQLVRPFLGISLYENH
Sbjct: 61  QFYDSAKTLGIFHDHKLYEMNRMDLFPQLKDPIAHIAKSTPAEKTQLVRPFLGISLYENH 120

Query: 121 DKYSPMTAKELDTTEACSTYLDQYENSHGQKYGEDRDFVIVTARHHMIDLAILPFSRQFT 180
           DKYSPMTAKELDTTEACSTYLDQYENSHGQKYGEDRDFVIVTARHHMIDLAILPFSRQFT
Sbjct: 121 DKYSPMTAKELDTTEACSTYLDQYENSHGQKYGEDRDFVIVTARHHMIDLAILPFSRQFT 180

Query: 181 NVNLLCAYTPGNLLEISQDPADNTNDKVGVNTDNPILKKICFSGFALEDILTESANDEER 240
           NVNLLCAYTPGNLLEISQDPADNTNDKVGVNTDNPILKKICFSGFALEDILTESANDEER
Sbjct: 181 NVNLLCAYTPGNLLEISQDPADNTNDKVGVNTDNPILKKICFSGFALEDILTESANDEER 240

Query: 241 NPTFLIVENEIANTRLLMRCEIDAYNPITSHYTELKCYAKYNFGNPNHRRKLLKSWIQTG 300
           NPTFLIVENEIANTRLLMRCEIDAYNPITSHYTELKCYAKYNFGNPNHRRKLLKSWIQTG
Sbjct: 241 NPTFLIVENEIANTRLLMRCEIDAYNPITSHYTELKCYAKYNFGNPNHRRKLLKSWIQTG 300

Query: 301 VIPTTDIVIGVRDTESGCLQDVRCYNRNLLYNKLISKSLPRCDSELNYDPAISVVWYRSL 360
           VIPTTDIVIGVRDTESGCLQDVRCYNRNLLYNKLISKSLPRCDSELNYDPAISVVWYRSL
Sbjct: 301 VIPTTDIVIGVRDTESGCLQDVRCYNRNLLYNKLISKSLPRCDSELNYDPAISVVWYRSL 360

Query: 361 INTLTTTIASLLDKFGRDEPQLFSIKVDNNCNIRIEHRQNPN 402
           INTLTTTIASLLDKFGRDEPQLFSIKVDNNCNIRIEHRQNPN
Sbjct: 361 INTLTTTIASLLDKFGRDEPQLFSIKVDNNCNIRIEHRQNPN 402

>Suva_2.542 Chr2 complement(968396..969724) [1329 bp, 442 aa] {ON}
           YDR370C (REAL)
          Length = 442

 Score =  249 bits (635), Expect = 5e-78,   Method: Compositional matrix adjust.
 Identities = 123/343 (35%), Positives = 208/343 (60%), Gaps = 7/343 (2%)

Query: 60  PQFYDSAKTLGIFHDHKLYEMNRMDLFPQLKDPIAHIAKSTPAEKTQLVRPFLGISLYEN 119
           P  +  +K + +F D++LY   R D+ P LK+ I+H+ +S   E  +L   +LG+ L+ N
Sbjct: 85  PDIFYESKEVALFTDNQLYVAARKDVIPNLKEDISHLYESPLLEARKLKTLYLGLDLFAN 144

Query: 120 HDKYSPMTAKELDTTEACSTYLDQYE-NSHGQKYGEDRDFVIVTARHHMIDLAILPFSRQ 178
            D+  PMT  ELDT   C +Y++ +  N+ G+ +   + F +VT RHH++DL + PF R+
Sbjct: 145 IDELVPMTISELDTIAPCISYIEDWRLNNSGKPFKIGKKFTVVTTRHHIVDLTMHPFDRR 204

Query: 179 FTNVNLLCAYTPGNLLEISQDPA-DNTNDKVGVNTDNPILKKICFSGFALEDILTE---- 233
               +++  Y     + +S++P  D+   K G+ + +P +KKIC SGF  E+ LTE    
Sbjct: 205 NKQKSIIATYMGNGFISLSRNPKYDHKASKEGIYSGDPNIKKICHSGFEFENCLTENTKN 264

Query: 234 SANDEERNPTFLIVENEIA-NTRLLMRCEIDAYNPITSHYTELKCYAKYNFGNPNHRRKL 292
           S +   + P F IVE +++ +  LLMRCE+DA+NP++   TELKC+   +  N +HR+KL
Sbjct: 265 SGSSASKCPVFSIVEGKLSEDIGLLMRCEMDAFNPVSKTNTELKCFGPLSMQNSSHRKKL 324

Query: 293 LKSWIQTGVIPTTDIVIGVRDTESGCLQDVRCYNRNLLYNKLISKSLPRCDSELNYDPAI 352
           LK+WIQTG++P +DI++G+RD+ SG L D++ Y+R+ L+ K     LP    E+NY+  +
Sbjct: 325 LKTWIQTGLLPNSDIMVGLRDSYSGQLLDIQWYSRDTLFRKFNHPGLPLNKKEMNYNAKV 384

Query: 353 SVVWYRSLINTLTTTIASLLDKFGRDEPQLFSIKVDNNCNIRI 395
           +V W +  I ++   + + + ++  ++P+ F I +D N  I I
Sbjct: 385 AVEWCKHCIKSICDLVEANISRYNCNKPEPFEINIDANGTIII 427

>NCAS0F03400 Chr6 complement(686480..687727) [1248 bp, 415 aa] {ON}
           Anc_5.437 YDR370C
          Length = 415

 Score =  247 bits (631), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 128/358 (35%), Positives = 215/358 (60%), Gaps = 24/358 (6%)

Query: 62  FYDSAKTLGIFHDHKLYEMNRMDLFPQLKDPIAHIAKSTPAEKTQLVRPFLGISLYENHD 121
           FY+S+  + ++H+HKLY  ++ D+ P LK+ IA + K + +E   L R +LG  LY+  +
Sbjct: 46  FYESSNQVALYHNHKLYPASQYDIIPHLKNDIAQLPKKSASEARTLKRSYLGSDLYDGFE 105

Query: 122 KYSPMTAKELDTTEACSTYLDQYENSHGQKYGEDRDFVIVTARHHMIDLAILPFSRQFTN 181
            + PM+AK+LD+ E C +++  +E     KY   R F IV+ RHH++++ +  F+ +  N
Sbjct: 106 TFVPMSAKDLDSLEPCMSFIKDWERKASTKYKPGRKFNIVSTRHHIVEMTMKLFTGKTNN 165

Query: 182 VN---------LLCAYT---PGNLLEISQDPADNTND-KVGVNTDNPILKKICFSGFALE 228
            N         L   YT    G LL  ++D ++  N    G+ + N ILK+IC+SGFALE
Sbjct: 166 YNNTKKVQDYVLNVVYTGDETGRLL-FTKDWSNTGNSMNEGIYSKNIILKRICYSGFALE 224

Query: 229 DILTESANDEER---------NPTFLIVENEIAN-TRLLMRCEIDAYNPITSHYTELKCY 278
           D++TE+ ++ E+            F +VEN++ +   +L+RCE+DA+N     +TELKC+
Sbjct: 225 DLMTETTSELEKEGEKLTGGEKAVFAVVENKLDDDICILLRCELDAFNGAEKKFTELKCF 284

Query: 279 AKYNFGNPNHRRKLLKSWIQTGVIPTTDIVIGVRDTESGCLQDVRCYNRNLLYNKLISKS 338
           +     N +HRRKLLK+W+QTGV+P +DI+IG+RD+  G L+DV  Y+R+ L +K+ +++
Sbjct: 285 SPLKMSNFSHRRKLLKAWVQTGVLPDSDILIGIRDSSFGELEDVEWYSRDRLRSKINNRN 344

Query: 339 LPRCDSELNYDPAISVVWYRSLINTLTTTIASLLDKFGRDEPQLFSIKVDNNCNIRIE 396
           LP    + N++  ++  W +  I ++   +   LD+     PQ F I++D+  NIRI+
Sbjct: 345 LPESKIDWNFNAQVATQWSQHCIRSICKLVDENLDQKAISNPQGFQIRIDSRRNIRIK 402

>Skud_4.639 Chr4 complement(1140646..1141974) [1329 bp, 442 aa] {ON}
           YDR370C (REAL)
          Length = 442

 Score =  246 bits (627), Expect = 8e-77,   Method: Compositional matrix adjust.
 Identities = 123/340 (36%), Positives = 202/340 (59%), Gaps = 7/340 (2%)

Query: 63  YDSAKTLGIFHDHKLYEMNRMDLFPQLKDPIAHIAKSTPAEKTQLVRPFLGISLYENHDK 122
           +  +K + +F +++ Y   R DL P L+D I  + +S+  E  +   P+LG  L+ N D+
Sbjct: 88  FQDSKEVALFTNYQAYTTARKDLIPSLRDGITELYESSLLEARRRKVPYLGHDLFANIDQ 147

Query: 123 YSPMTAKELDTTEACSTYLDQYE-NSHGQKYGEDRDFVIVTARHHMIDLAILPFSRQFTN 181
           + PMT  ELD+   C +Y++ ++ ++HG+ +   + F IV+ARHH++DL +  F R+   
Sbjct: 148 FVPMTISELDSISPCISYVENWKLSNHGKNFKIGKKFTIVSARHHIVDLTMHRFDRRNKR 207

Query: 182 VNLLCAYTPGNLLEISQDPA-DNTNDKVGVNTDNPILKKICFSGFALEDILTESANDEER 240
            +L+  Y    L+  S++P  D    K G+ + +P +KKIC+SGF  E  +TE     + 
Sbjct: 208 KSLIVTYMGAGLISFSRNPKNDFQMSKEGIYSSDPNMKKICYSGFEFEHWVTEDIKATDL 267

Query: 241 N----PTFLIVENEIA-NTRLLMRCEIDAYNPITSHYTELKCYAKYNFGNPNHRRKLLKS 295
           N    P F +VE++++ +  LLMRCEIDA+NP++   TELKC+   +  N NHR+KLLK+
Sbjct: 268 NGPKHPIFSVVESKLSEDIGLLMRCEIDAFNPVSRTNTELKCFGPLSMHNSNHRKKLLKT 327

Query: 296 WIQTGVIPTTDIVIGVRDTESGCLQDVRCYNRNLLYNKLISKSLPRCDSELNYDPAISVV 355
           WIQTG++P +DIVIG+RD+ SG L D++ Y+R+ LY K     LP    ELN++  ++V 
Sbjct: 328 WIQTGLLPNSDIVIGLRDSHSGQLLDIQWYSRDSLYKKFNHPGLPPSKKELNFNAKVAVE 387

Query: 356 WYRSLINTLTTTIASLLDKFGRDEPQLFSIKVDNNCNIRI 395
           W    I ++   + + +  +    P+ F + +D N  I I
Sbjct: 388 WCNHCIKSICELVEANISHYNSTRPESFEVSIDANGTIAI 427

>KAFR0E03820 Chr5 (758469..759659) [1191 bp, 396 aa] {ON} Anc_5.437
           YDR370C
          Length = 396

 Score =  242 bits (618), Expect = 6e-76,   Method: Compositional matrix adjust.
 Identities = 133/339 (39%), Positives = 201/339 (59%), Gaps = 14/339 (4%)

Query: 62  FYDSAKTLGIFHDHKLYEMNR--MDLFPQLKDPIAHIAKSTPAEKTQLVR-PFLGISLYE 118
           F+  ++ +  +HD ++YE N    D+ P L   I+ IA+   A   +  +  ++G  LY+
Sbjct: 50  FFQISREVATYHDGRIYEPNETSQDILPLLNKDISKIAQGVSAIDARKYKVKYIGSDLYQ 109

Query: 119 NHDKYSPMTAKELDTTEACSTYLDQYENSHGQKYGEDRDFVIVTARHHMIDLAILPF-SR 177
             + +  M+ +ELD+   C  Y+ ++E  H  KY E++ + IV+ARHH+++L +  F + 
Sbjct: 110 GFENFESMSREELDSALPCFAYIKKWEAHHHCKYTENKKYTIVSARHHIVNLIMSIFDTS 169

Query: 178 QFTNVNLLCAYTPGNLLEISQDPADNTNDKVGVNTDNPILKKICFSGFALEDILTESAND 237
           + T VN    Y    LL  SQD +D      G+ T N  LKKIC+SGFALED+LT+S   
Sbjct: 170 KETIVN--STYLGNGLLTFSQDTSDPMTMNEGIFTKNKNLKKICYSGFALEDLLTKS--- 224

Query: 238 EERNPTFLIVENEIA-NTRLLMRCEIDAYNPITSHYTELKCYAKYNFGNPNHRRKLLKSW 296
            ++ P F I EN++  N  LL+RCE+DAYN +T +YTELKCYA     +P HR+KLLK+W
Sbjct: 225 -QKEPLFSITENQLDDNITLLLRCEMDAYNQLTQNYTELKCYAPLKMASPQHRKKLLKTW 283

Query: 297 IQTGVIPTTDIVIGVRDTESGCLQDVRCYNRNLLYNKLISKSLPRCDSELNYDPAISVVW 356
           IQTGV+P++D++ G+R   +G L D+  Y+R+ LY +  +++LP     LN++  I+V W
Sbjct: 284 IQTGVLPSSDLMFGIRSPYNGELLDIEWYSRDGLYRRFNNRNLPENKKSLNFNANIAVEW 343

Query: 357 YRSLINTLTTTIASLLDKFGRDEPQLFSIKVDNNCNIRI 395
               I T+   I+   D    D PQ F IKVD   NI I
Sbjct: 344 SHHCIKTICELIS---DNLQGDAPQAFQIKVDTFRNISI 379

>YDR370C Chr4 complement(1217782..1219110) [1329 bp, 442 aa] {ON}
           Putative protein of unknown function
          Length = 442

 Score =  235 bits (600), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 121/341 (35%), Positives = 204/341 (59%), Gaps = 7/341 (2%)

Query: 62  FYDSAKTLGIFHDHKLYEMNRMDLFPQLKDPIAHIAKSTPAEKTQLVRPFLGISLYENHD 121
            +  +K + +F + + Y + R DL P LK+ IA + +S+  E  +   P+LG  L+ N D
Sbjct: 87  IFHESKEVALFTNGRAYTILRKDLIPNLKESIAELYESSLLEAKKRKVPYLGHDLFANID 146

Query: 122 KYSPMTAKELDTTEACSTYLDQY-ENSHGQKYGEDRDFVIVTARHHMIDLAILPFSRQFT 180
           ++ PMT  ELD+   C +Y++ +  ++ G+ +   + F +VT RHH++DL +  F+R+  
Sbjct: 147 EFVPMTISELDSVSPCFSYIENWILDNPGKDFKIGKKFTVVTTRHHIVDLTMHLFNRRNR 206

Query: 181 NVNLLCAYTPGNLLEISQD-PADNTNDKVGVNTDNPILKKICFSGFALEDILTESANDEE 239
             +L+  Y    LL   ++   D+   K G+ +++P +KKIC+SGF  E+ +TE++   +
Sbjct: 207 QTSLIVTYMGAGLLSFCRNVKKDSQMSKEGIYSNDPNMKKICYSGFEFENWVTENSKVAD 266

Query: 240 ----RNPTFLIVENEIAN-TRLLMRCEIDAYNPITSHYTELKCYAKYNFGNPNHRRKLLK 294
               + P F +VE++++    LL+RCE+DA+NP++   TELKC+A  +  N NHRRKLLK
Sbjct: 267 LTGSKCPIFSLVESKLSEEIGLLIRCEMDAFNPVSETNTELKCFAPLSMHNSNHRRKLLK 326

Query: 295 SWIQTGVIPTTDIVIGVRDTESGCLQDVRCYNRNLLYNKLISKSLPRCDSELNYDPAISV 354
           +W+QTG++P +DI+IG+RD+ SG L D++ Y+R+LL  K     LP    ELNY+  I+V
Sbjct: 327 TWVQTGLLPNSDIMIGLRDSHSGQLLDIQWYSRDLLCKKFNHPGLPTNKKELNYNAQIAV 386

Query: 355 VWYRSLINTLTTTIASLLDKFGRDEPQLFSIKVDNNCNIRI 395
            W    I  +   + + +  +   +P+ F I +D N  I I
Sbjct: 387 EWCHYCIEAICKLVEANISDYSSTKPESFEIGIDTNNAIVI 427

>Smik_4.636 Chr4 complement(1137846..1139186) [1341 bp, 446 aa] {ON}
           YDR370C (REAL)
          Length = 446

 Score =  233 bits (595), Expect = 6e-72,   Method: Compositional matrix adjust.
 Identities = 120/345 (34%), Positives = 199/345 (57%), Gaps = 7/345 (2%)

Query: 63  YDSAKTLGIFHDHKLYEMNRMDLFPQLKDPIAHIAKSTPAEKTQLVRPFLGISLYENHDK 122
           +  +K + +F + + Y   R D+ P LK  IA + + +  +  +   P+LG  L+ N  +
Sbjct: 88  FHESKEVALFTNGQAYTTVRKDILPNLKGDIAELCERSLLDARERKLPYLGHDLFANIGQ 147

Query: 123 YSPMTAKELDTTEACSTYLDQYE-NSHGQKYGEDRDFVIVTARHHMIDLAILPFSRQFTN 181
           + PMT  ELD+   C +Y++ +  N+HG+ +   R F +VT RHH++D+ +  F R+   
Sbjct: 148 FVPMTISELDSILPCISYIENWRLNNHGEDFKIGRKFTVVTTRHHIVDMTMHLFDRRNKK 207

Query: 182 VNLLCAYTPGNLLEISQDPA-DNTNDKVGVNTDNPILKKICFSGFALEDILTESANDEER 240
            +L+  Y    L+  S++   D+   K G+ + +P +KKIC+SGF  E+ +TE     + 
Sbjct: 208 RSLVATYMGAGLISFSRNQKNDSRMSKEGIYSSDPNMKKICYSGFEFENWVTEGIKAADL 267

Query: 241 N----PTFLIVENEIAN-TRLLMRCEIDAYNPITSHYTELKCYAKYNFGNPNHRRKLLKS 295
           N    P F +VE++++    LL+RCE+DA+NP++   TELKC+A  +  N NHRRKLLK+
Sbjct: 268 NGSKLPVFSVVESKLSEEIGLLIRCEMDAFNPVSGANTELKCFAPLSMHNSNHRRKLLKT 327

Query: 296 WIQTGVIPTTDIVIGVRDTESGCLQDVRCYNRNLLYNKLISKSLPRCDSELNYDPAISVV 355
           WIQTG+ P +DI+IG+RD+ SG L D++ Y+R+ L  K     LP    ELNY+  ++V 
Sbjct: 328 WIQTGLSPNSDIMIGLRDSHSGQLLDIQWYSRDSLCMKFNHSGLPSNKRELNYNAKVAVE 387

Query: 356 WYRSLINTLTTTIASLLDKFGRDEPQLFSIKVDNNCNIRIEHRQN 400
           W    I ++   + + +  +    P+ F I +D+N  I I   +N
Sbjct: 388 WCNHCIKSICELLGANISDYSCKNPESFEISIDSNNTIAITKLKN 432

>NDAI0B05690 Chr2 (1387153..1388424) [1272 bp, 423 aa] {ON}
           Anc_5.437 YDR370C
          Length = 423

 Score =  229 bits (585), Expect = 9e-71,   Method: Compositional matrix adjust.
 Identities = 123/361 (34%), Positives = 213/361 (59%), Gaps = 19/361 (5%)

Query: 53  TSHHKNMPQFYDSAKTLGIFHDHKLYEMNRMDLFPQLKDPIAHIAKSTPA--EKTQLVRP 110
           +++ K    F++++K + ++H+ +LY  +  +L PQL+  IA +A  + +  E   L  P
Sbjct: 50  STYPKTPSSFFETSKDVALYHNKQLYSSDDTNLIPQLEPAIAKLANPSCSLNEARDLKLP 109

Query: 111 FLGISLYENHDKYSPMTAKELDTTEACSTYLDQYENSHGQKYGEDRDFVIVTARHHMIDL 170
           +LG  LY+ ++ + PM   ELD+ E C  Y++ +E  +   Y     F IV+ARHH++++
Sbjct: 110 YLGSDLYDGYESFIPMDPDELDSIEPCFKYIESWELQNKHDYQLGNKFTIVSARHHIVEM 169

Query: 171 AILPFS-RQFTNVNLLCAYTPGN--LLEISQDPADNTNDKVGVNTDNPILKKICFSGFAL 227
            +  F+ R+  +  L   Y  G+  +L  S+D   N  D  G+ + + +++KI +SGFAL
Sbjct: 170 TMCIFNKRKMDDFILNVTYKGGSNGMLLFSRDV--NKKDDGGIYSKDGVVRKISYSGFAL 227

Query: 228 EDILTESANDEERN-----------PTFLIVENEIAN-TRLLMRCEIDAYNPITSHYTEL 275
           ED+LT + ND   +             F I+EN++ +   LL+RCE+D+YNP+   +TE+
Sbjct: 228 EDLLTTNKNDHNADNSDVTLVGGDKAVFAIIENKLNDDISLLLRCEMDSYNPVNKCFTEM 287

Query: 276 KCYAKYNFGNPNHRRKLLKSWIQTGVIPTTDIVIGVRDTESGCLQDVRCYNRNLLYNKLI 335
           KC+A+    N NHRRKLLK+W+QTGVIP +DI+IG+RD   G L D+  ++R  LY ++ 
Sbjct: 288 KCFARLKMNNHNHRRKLLKAWVQTGVIPNSDILIGIRDPMFGELNDIEWFSRMNLYRQIN 347

Query: 336 SKSLPRCDSELNYDPAISVVWYRSLINTLTTTIASLLDKFGRDEPQLFSIKVDNNCNIRI 395
           +++LP    +LNY+  I+V W +  I ++   +   +DK   +  Q F I+++ +  I+I
Sbjct: 348 NRNLPEAKLDLNYNAEIAVQWSQHCIKSICKLVDESIDKTRLNTSQSFQIRINASRAIQI 407

Query: 396 E 396
           +
Sbjct: 408 K 408

>TDEL0B02180 Chr2 (388145..389401) [1257 bp, 418 aa] {ON} Anc_5.437
           YDR370C
          Length = 418

 Score =  206 bits (523), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 123/344 (35%), Positives = 201/344 (58%), Gaps = 20/344 (5%)

Query: 62  FYDSAKTLGIFHDHKLY--EMNRMDLFPQLKDPIAHIAKSTPAEKTQLVRPFLGISLYEN 119
           F++  + +  + +  L+  + ++  L+P L+   A IA++    K +L  P++G  LY+ 
Sbjct: 70  FFEGCEEVATYQNGYLFMKDSSKKPLYPCLQMFAALIAENR-GPKNKL--PYIGCDLYQG 126

Query: 120 HDKYSPMTAKELDTTEACSTYLDQYENSHGQKYGEDRDFVIVTARHHMIDLAILPFSRQF 179
           H++Y P+ + ELD++ AC  Y+ ++E     K        I++ RHH++DL +  F    
Sbjct: 127 HERYKPLPSSELDSSIACFEYIKKWERRKISKSFNSGKVTIISPRHHVVDLVMALFHDD- 185

Query: 180 TNVNLLCAYTPGNLLEISQDPADNTNDKVGVNTDNPILKKICFSGFALEDILTESANDEE 239
             V+++C       L  S D +    ++ G+N+ N + +KIC+SGFALED LT S +DE 
Sbjct: 186 -EVSIICTNIGKGKLIFSGDRS--KEERNGLNSKNSMTRKICYSGFALEDKLTTS-HDER 241

Query: 240 RNPTFLIVENEIANTRL--LMRCEIDAYNPITSHYTELKCYAKYNFGNPNHRRKLLKSWI 297
             P + IVE +I N RL  L+RCE+DAYNPI + YTELKC+ K N  +  HRRKLLK+W+
Sbjct: 242 MGPFYSIVEGKI-NERLSLLLRCEMDAYNPIFNRYTELKCFTKLNVQDTAHRRKLLKTWV 300

Query: 298 QTGVIPTTDIVIGVRDTESGCLQDVRCYNRNLLYNKLISKSLPRCDSELNYDPAISVVWY 357
           Q G+IP +D++IG RDT+ G L+D+  Y+R  LY K  + S+ R +  LN++  I+V W 
Sbjct: 301 QIGLIPDSDLIIGTRDTQVGQLEDLTWYSRGSLYKKFNNPSIARNNKYLNFNANIAVEWC 360

Query: 358 RSLINT-----LTTTIASLLDKFGRDEPQLFSIKVDNNCNIRIE 396
              I +     +  +++S  D + + E   F + VD + NI ++
Sbjct: 361 FHCIESICDLVMKNSLSSPDDPYPKYES--FKVIVDKSHNIIVK 402

>Kpol_1016.4 s1016 (8493..9362,9366..9737) [1242 bp, 413 aa] {ON}
           (8493..9362,9366..9737) [1242 nt, 414 aa]
          Length = 413

 Score =  202 bits (513), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 121/359 (33%), Positives = 206/359 (57%), Gaps = 18/359 (5%)

Query: 49  QRLKTSHHKNMPQ----FYDSAKTLGIFHDHKLYEMNRMDLFPQLKDPIAHIAKSTPAEK 104
            R   S+ ++ PQ     +  +KT+  F   +L+        P LK  IA+I+  +    
Sbjct: 44  HRFVHSNARSFPQKTKDLFLESKTVAFFQKDQLFINVEDAALPLLKKDIANISGKSVLNS 103

Query: 105 TQLVRPFLGISLYENHDKYSPMTAKELDTTEACSTYLDQYENSH-GQKYGEDRDFVIVTA 163
            +   P+LG  LY + DKY P+    LD+ + C  ++  +EN H G+ YG   D+ I++ 
Sbjct: 104 KKYKLPYLGSDLYASTDKYGPLPEDVLDSPKPCFDFIRHWENEHRGEHYGAHADYTILSP 163

Query: 164 RHHMIDLAILPFS-RQFTNVNLLCAYTPGNLLEISQDPADNTNDKV--GVNTDNPILKKI 220
           RHH+ ++ +  F   +  +V LLC Y    ++ +S+D A ++++    G+N+ NP+ +KI
Sbjct: 164 RHHITEIVMSLFEDEKNCSVYLLCTYLKNGIILLSKDDASSSSNSNTTGLNSSNPMTRKI 223

Query: 221 CFSGFALEDILTESANDEERNPTFLIVENEIANT-RLLMRCEIDAYNPITSHYTELKCYA 279
           C+SGFA ED++ E   +  R P F +VE+++  +  LL+R E+D YN +T+ +TELKC+A
Sbjct: 224 CYSGFAFEDLVLEDIAENAR-PIFSVVESKLTESINLLLRNELDGYNNVTNMFTELKCFA 282

Query: 280 --KYNFGNPNHRRKLLKSWIQTGVIPTTDIVIGVRDTESGCLQDVRCYNRNLLYNKLISK 337
             K  F      +++LK+W+QTG+IP +DIVIG+RDT+SG L+D+  YNR  L     + 
Sbjct: 283 PLKCMFS----AKEVLKTWVQTGLIPESDIVIGIRDTQSGLLEDLVWYNRKDLCRTFNNP 338

Query: 338 SLPRCDSELNYDPAISVVWYRSLINTLTTTIASLLDKFGRDEPQLFSIKVDNNCNIRIE 396
           SLP   S  N++  I+V W +  + ++ + ++S +     + P  F +K+DN+  I I+
Sbjct: 339 SLPPAPSHFNFNANIAVEWLKFTMESIVSLVSSSIA--DSNHPCSFKLKIDNHKTISIQ 395

>KLTH0F15994g Chr6 (1298649..1299821) [1173 bp, 390 aa] {ON} weakly
           similar to uniprot|Q06349 Saccharomyces cerevisiae
           YDR370C Hypothetical ORF
          Length = 390

 Score =  192 bits (488), Expect = 8e-57,   Method: Compositional matrix adjust.
 Identities = 115/370 (31%), Positives = 190/370 (51%), Gaps = 14/370 (3%)

Query: 38  DDHTVVIRGNKQRLKTSHHKNMP-QFYDSAKTLGI---FHDHKLYEMNRMDLFPQLKDPI 93
           D+  V  RG  +R   SH    P  F+D  K +G    + D   +E+ R    P LK  +
Sbjct: 15  DEACVSCRGF-ERASISHFPAEPLHFFDEVKEIGTMTHWIDSDKFELGRKQSAPHLKKDL 73

Query: 94  AHIAKSTPAEKTQLVRPFLGISLYENHDKYSPMTAKELDTTEACSTYLDQYENSHGQKYG 153
                +    KT     ++G  L E++D + P+T  +L+       +L+++E  HG+ Y 
Sbjct: 74  GLFTITKKLAKTN---SYVGHDLLEHYDDFQPLTPNQLEDMSGVFEFLNKWEGDHGKPYS 130

Query: 154 EDRDFVIVTARHHMIDLAILPFSRQFTNVNLLCAYTPGNLLEISQDPADNTNDKVGVNTD 213
              DF IV +RH++IDL + PFS +  +V+    Y  G  L I  D      D  G+ + 
Sbjct: 131 SGSDFTIVCSRHNLIDLIMAPFSDE--DVHFNVKYING-YLHIFPDKQFQKKDD-GIYSS 186

Query: 214 NPILKKICFSGFALEDILTESANDEERNPTFLIVENEIA-NTRLLMRCEIDAYNPITSHY 272
              +++IC++GF LED++TE+     ++  + +V+ +I+ N +LL + E+D +NP    Y
Sbjct: 187 ESNIRRICYTGFELEDLVTETQPGAPKSAFYSLVQGKISKNIKLLFKAEMDCFNPAKRSY 246

Query: 273 TELKCYAKYNFGNPNHRRKLLKSWIQTGVIPTTDIVIGVRDTESGCLQDVRCYNRNLLYN 332
           TE+KC       +  HRRKLL+ W+QT ++P+TD++IG+RD     L    CY R  LY 
Sbjct: 247 TEIKCTTGLKVKSAFHRRKLLRMWVQTSLVPSTDLLIGLRDPYYHQLSSFECYTRQELYQ 306

Query: 333 KLISKSLPRCDSELNYDPAISVVWYRSLINTLTTTIASLLDKFGRDEPQLFSIKVDNNCN 392
           K  +++L     + NY+  ISV W+R L+  L  TI   ++K    E   F + +     
Sbjct: 307 KFNNRNLSLLKKKYNYNANISVQWFRHLVKRLCQTITPYVEK-TPTEAVSFKLTLTKQLE 365

Query: 393 IRIEHRQNPN 402
           +R+   + P+
Sbjct: 366 LRLRKIETPS 375

>ZYRO0F10098g Chr6 complement(818672..819793) [1122 bp, 373 aa] {ON}
           similar to uniprot|Q06349 Saccharomyces cerevisiae
           YDR370C Hypothetical ORF
          Length = 373

 Score =  191 bits (486), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 99/289 (34%), Positives = 170/289 (58%), Gaps = 8/289 (2%)

Query: 109 RPFLGISLYENHDKYSPMTAKELDTTEACSTYLDQYENSHGQKYGEDRDFVIVTARHHMI 168
           R FLG  LY+  + + P++ + LD++  C  +++++EN +   Y +   FV+++ RH+++
Sbjct: 78  RDFLGSDLYQGWEDFLPLSPEILDSSRGCYQWINKWENDNHTSYSQRSPFVVISPRHYLV 137

Query: 169 DLAILPFSRQFTNVNLLCAYTPGNLLEISQDPADNTNDKVGVNTDNPILKKICFSGFALE 228
           +L +  F  Q +  ++LC +     + +SQ   D  + +   + +  + KKI  SG+ALE
Sbjct: 138 ELTMQLF--QQSKYSILCTHLGDGKIVLSQVENDKKSHQ-HTSRNTTMTKKILHSGYALE 194

Query: 229 DILTESANDEERNPTFLIVENEI-ANTRLLMRCEIDAYNPITSHYTELKCYAKYNFGNPN 287
           D+LT     E+ +P F I+E E+ AN  L++RCE+D+YN +T  +TELKCYA  N  N  
Sbjct: 195 DLLTRGPRVED-DPFFAIIEAELDANISLVLRCELDSYNELTETFTELKCYAPLNMHNAY 253

Query: 288 HRRKLLKSWIQTGVIPTTDIVIGVRDTESGCLQDVRCYNRNLLYNKLISKSLPRCDSELN 347
           HR KLLK+WIQ  + P  D++IGVR+T  G LQD++ +    LY K+  ++LP+     N
Sbjct: 254 HREKLLKTWIQLAISPRCDLLIGVRNTHMGLLQDLQYFTNKELYRKINDRNLPKSPKRFN 313

Query: 348 YDPAISVVWYRSLINTLTTTIASLLDKFGRDEPQLFSIKVDNNCNIRIE 396
           Y+  ++V W +  I ++   +   +D   R  PQ F + +D +  I++E
Sbjct: 314 YNADLAVQWCQHCIRSICKLVGENVD---RSSPQCFKLTIDESHKIQLE 359

>TBLA0A02800 Chr1 (675150..676511) [1362 bp, 453 aa] {ON} Anc_5.437
           YDR370C
          Length = 453

 Score =  187 bits (476), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 113/336 (33%), Positives = 183/336 (54%), Gaps = 31/336 (9%)

Query: 87  PQLKDPIAHIAKSTPAEKTQLVRPFLGISLYENHDKYSPMTAKELDTTEACSTYLDQYEN 146
           P LKD I  IA  +  +  +    ++G  L+++++KY  M  + L    +C  Y+  Y+ 
Sbjct: 89  PCLKDDICQIAGKSLLDSKKYKAKYIGADLFKDYEKYHAMEKEPLHDPISCFKYIQYYDK 148

Query: 147 SHG---QKYGEDRDFVIVTARHHMIDLAILPFSR-QFTNVNLLCAYTPGNLLEISQD--- 199
            H    +KYG D++FVI+T+RHH+ DL + PF +     V++L  Y   N + +SQD   
Sbjct: 149 KHANEKKKYGMDKEFVIITSRHHINDLVLAPFKKISDPEVSVLLTYLGDNRILLSQDYAH 208

Query: 200 -PADNTNDKVGVNTDNPILKKICFSGFALEDI---------LTESANDEER------NPT 243
            P D   +K   N+    ++KI  SGFA ED+         LT S  ++++      N  
Sbjct: 209 EPPDWRENKQFYNS----MRKIVNSGFAFEDLVIKDYTSSKLTPSLEEQQKKDPSITNNY 264

Query: 244 FLIVENEIA-NTRLLMRCEIDAYNPITSHYTELKCYAKYNFGNPNHRRKLLKSWIQTGVI 302
           F +VEN+I+    +L+R E+D YNP+T+ YTELKC+ + N G+P HR+KLLK+W+Q G +
Sbjct: 265 FSVVENDISPKLTILLRSEMDGYNPLTNSYTELKCFTRLNMGSPFHRQKLLKTWVQIGQL 324

Query: 303 PTTDIVIGVRDTESGCLQDVRCYNRNLLYNKLISKSLPRCDSELNYDPAISVVWYRSLIN 362
           P +D+++G RDT++G L D+  ++R+ L  K  S   PR     N  P  +  WY  +++
Sbjct: 325 PNSDLLVGSRDTQTGLLNDITWFSRDDLVTKCDSYYSPRLRFHQNTTPTNASAWYYHVLS 384

Query: 363 TLTTTIASLLDKFGRDE---PQLFSIKVDNNCNIRI 395
            +T+     L K  +     P  F + V+ N  I +
Sbjct: 385 AITSLTRDYLKKTPKAPSSVPVPFRLIVEKNRTITL 420

>SAKL0G02596g Chr7 complement(214675..215877) [1203 bp, 400 aa] {ON}
           weakly similar to uniprot|Q06349 Saccharomyces
           cerevisiae YDR370C Hypothetical ORF
          Length = 400

 Score =  182 bits (462), Expect = 7e-53,   Method: Compositional matrix adjust.
 Identities = 112/357 (31%), Positives = 190/357 (53%), Gaps = 18/357 (5%)

Query: 53  TSHHKNMP-QFYDSAKTLGIF----HDHKLYEMNRMDLFPQLKDPIAHIAKSTPAEKTQL 107
            SH  ++P +F+  ++ +G F       K    +++ L P LKD I     +     +++
Sbjct: 35  VSHFPSVPCKFFQESREIGTFTRMVSSGKYLFDDKLGLRP-LKDDICEYIHNPAKNASKI 93

Query: 108 VRPFLGISLYENHDKYSPMTAKELDTTEACSTYLDQYENSHGQKYGEDRDFVIVTARHHM 167
              +LG  L    + Y P++  EL+  +    ++  +E  +G+KYG +  F IV+ RHH+
Sbjct: 94  KTQYLGYDLLNGFEDYIPLSEDELNNMDGILNFIGNWEEKNGKKYGSENKFTIVSNRHHL 153

Query: 168 IDLAILPFSRQFTNVNLLCAYTPGNLLEISQDPADNTNDKVGVNTDNPILKKICFSGFAL 227
           IDL + PFS +    NL+  +  G LL IS D +    D  G+ + +  ++K+C++GF L
Sbjct: 154 IDLIMCPFSLE--EANLIVTHLDG-LLIISSDKSKPKVDS-GIRSKDTRVRKLCYTGFEL 209

Query: 228 EDILTESANDEERNPT--FLIVENEIA-NTRLLMRCEIDAYNPITSHYTELKCYAKYNFG 284
           E+++T+   D     T  + IVEN++     LL++ E+D+YNP T +Y ELKC   +   
Sbjct: 210 ENLVTKGKVDSPGMHTCFYSIVENKLTEGVSLLLQAEMDSYNPKTDNYVELKCSVNFQLK 269

Query: 285 NPNHRRKLLKSWIQTGVIPTTDIVIGVRDTESGCLQDVRCYNRNLLYNKLISKSLPRCDS 344
           N NHRRKLL+ WIQTG++P TD+++G RD     L  ++ Y R+ +Y K  +++L     
Sbjct: 270 NSNHRRKLLRMWIQTGLVPRTDLLVGFRDPYYNQLDALKPYTRDEIYKKFSTRNLNENRK 329

Query: 345 ELNYDPAISVVWYRSLINTLTTTIASLLDKFGRDEP-QLFSIKVDNNCNIRIEHRQN 400
             N++  ++V W   +I      I  L+DK   DEP Q F + +  +  + +    N
Sbjct: 330 YYNFNSTVAVQWSHHVI----AKITELVDKNLTDEPLQSFKLTLTRDLQLSLTKLAN 382

>Kwal_55.21415 s55 (826461..827630) [1170 bp, 389 aa] {ON} YDR370C -
           Hypothetical ORF [contig 130] FULL
          Length = 389

 Score =  182 bits (461), Expect = 9e-53,   Method: Compositional matrix adjust.
 Identities = 91/286 (31%), Positives = 171/286 (59%), Gaps = 6/286 (2%)

Query: 111 FLGISLYENHDKYSPMTAKELDTTEACSTYLDQYENSHGQKYGEDRDFVIVTARHHMIDL 170
           ++G  L ++ D+Y P+T K+L+       +L++++  HG+ + ++ DF IV +RH++IDL
Sbjct: 88  YIGHDLLDHFDEYVPITPKQLEDMAGVQAFLERWKQLHGRSFCDNADFTIVCSRHNLIDL 147

Query: 171 AILPFSRQFTNVNLLCAYTPGNLLEISQDPADNTNDKVGVNTDNPILKKICFSGFALEDI 230
            ++PFS +  +V+L   ++ G  L +S D      D+ G+++ +  +KKIC++GF LE++
Sbjct: 148 IMMPFSDE--DVHLKIQFSNG-YLNLSPDAQYQKTDQ-GIHSGDTKIKKICYTGFELENL 203

Query: 231 LTESANDEERNPTFLIVENEIAN-TRLLMRCEIDAYNPITSHYTELKCYAKYNFGNPNHR 289
           +T ++  + R+  + +VE ++ +  +LL++ E+D +N  T  YTE+KC +     +  HR
Sbjct: 204 ITATSKPDVRSSFYSLVEGKLGDGIKLLLKAEMDCFNSSTRSYTEIKCSSGLKVKSTYHR 263

Query: 290 RKLLKSWIQTGVIPTTDIVIGVRDTESGCLQDVRCYNRNLLYNKLISKSLPRCDSELNYD 349
           RKLL+ W+QT ++P+T++++G+RD     L    CY R+ LY K  ++ L       NY+
Sbjct: 264 RKLLRMWVQTSLVPSTNLLVGIRDPYYHQLTSFECYTRSQLYRKFNNQRLTVMRKNYNYN 323

Query: 350 PAISVVWYRSLINTLTTTIASLLDKFGRDEPQLFSIKVDNNCNIRI 395
             ISV W+R +I  L   I   ++K  ++E   F + +  N  I++
Sbjct: 324 ATISVQWFRHVIQQLCQMIKPFIEKGSKEEVN-FRLTLRKNLTIKL 368

>KNAG0C04890 Chr3 (945616..946833) [1218 bp, 405 aa] {ON} Anc_5.437
           YDR370C
          Length = 405

 Score =  171 bits (433), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 115/374 (30%), Positives = 184/374 (49%), Gaps = 21/374 (5%)

Query: 40  HTVVIRGNKQ-RLKTSHHKNMPQF-------YDSAKTLGIFHDHKLY----EMNRMDLFP 87
           H + I   K+ R K  HH +  ++       +  +K +  +   KLY        + + P
Sbjct: 18  HRLSINDQKRVRFKEFHHHDPGKYVSKPAHIFQKSKEVACYTGGKLYINDGNTTNLTILP 77

Query: 88  QLKDPIAHIAKSTPAEKTQLVRP-FLGISLYENHDKYS-PMTAKELDTTEACSTYLDQY- 144
            LK+ IA +A+S   +K+   +  +LG+SLY   + Y   M+   LD+ + C  Y++++ 
Sbjct: 78  LLKEDIAALAQSKNTQKSGSFKSKYLGLSLYAGFEDYVFTMSPDMLDSAKPCLDYINEWN 137

Query: 145 ENSHGQK-YGEDRDFVIVTARHHMIDLAILPFSRQFTNVNLLCAYTPGNLLEISQ-DPAD 202
             S G+K +GE    +IV  RHH+++L +  F+   ++  L+C    G  + +SQ D   
Sbjct: 138 RGSKGEKKFGESYRHIIVGPRHHLVELTMALFAND-SDYKLVCTVLRGKFIVLSQFDDGS 196

Query: 203 NTNDKVGVNTDNPILKKICFSGFALEDILTESANDEERNPTFLIVENEIANTRLL-MRCE 261
             N   G+   +   + +C+SGF +  I   S N       F      I    L    CE
Sbjct: 197 QRNRNEGITLSDRRTRMLCYSGFVICKIW--SLNRGIIPSQFFYYGTPIRRGHLATFTCE 254

Query: 262 IDAYNPITSHYTELKCYAKYNFGNPNHRRKLLKSWIQTGVIPTTDIVIGVRDTESGCLQD 321
           +DAYN I +HYTELKCY   N  +  H+ KLL++W+QT V P TD+VIG R+   G LQD
Sbjct: 255 MDAYNQIENHYTELKCYGPLNMKSSYHKSKLLRTWVQTEVSPDTDVVIGCRNAYDGTLQD 314

Query: 322 VRCYNRNLLYNKLISKSLPRCDSELNYDPAISVVWYRSLINTLTTTIASLLDKFGRDEPQ 381
           +   +R  LY K  +K  PR  +  NY+  ++V W +  +  +   I   L++    EPQ
Sbjct: 315 ITQLSRESLYRKFNNKHQPRAHTNFNYNAQVAVEWSQYAMKAIIRLIEGNLNQKSVLEPQ 374

Query: 382 LFSIKVDNNCNIRI 395
            F + V    +I I
Sbjct: 375 AFVVTVYRGHDIGI 388

>TPHA0J02600 Chr10 complement(577310..578635) [1326 bp, 441 aa] {ON}
           Anc_5.437 YDR370C
          Length = 441

 Score =  166 bits (420), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 100/325 (30%), Positives = 171/325 (52%), Gaps = 14/325 (4%)

Query: 57  KNMPQFYDSAKTLGIFHDHKLYEM--NRMDLF-----PQLKDPIAHIAKSTPAEKTQLVR 109
           K+ P  +  AK + +++D ++ ++  N  +L      P L   I+++++ +  +  +   
Sbjct: 77  KSQPNIFQEAKGVALYYDKRITKITNNEAELINESNPPFLTKDISNLSEISLLDSKKFKL 136

Query: 110 PFLGISLYENHDKYSPMTAKELDTTEACSTYLDQYENSHGQKYGEDRDFVIVTARHHMID 169
           P++G +LY+  +K+ PM +  LD+T  C  YL   + S   K   +  +  +T RHH+ +
Sbjct: 137 PYMGYNLYDEIEKFGPMDSTLLDSTVPCFEYLRTLKISEEDKL-YNTPYTFMTPRHHLTE 195

Query: 170 LAILPFSR---QFTNVNLLCAYTPGNLLEISQDPA-DNTNDKVGVNTDNPILKKICFSGF 225
           L +  +     + T  + L      +L+ IS+D A +N          N   KK+  SGF
Sbjct: 196 LMMTVYESRESELTGKSWLFTRIKDDLIVISEDLAKENNPSPQNHKLQNSFSKKVINSGF 255

Query: 226 ALEDILTESANDEERNPTFLIVENEIA-NTRLLMRCEIDAYNPITSHYTELKCYAKYNFG 284
             E+++ E+   E   P F I EN +   +  ++R E+D+YN  T  +TELKC+ K + G
Sbjct: 256 TFEELVIENFQ-ECHKPYFYISENRLTPKSTFIIRSEMDSYNNKTETFTELKCFNKLHLG 314

Query: 285 NPNHRRKLLKSWIQTGVIPTTDIVIGVRDTESGCLQDVRCYNRNLLYNKLISKSLPRCDS 344
              HR+KLLK+W QTG+ P  DIVIG+RDT SG L+D+  Y+R  +Y KL   SLP+  +
Sbjct: 315 VAQHRKKLLKTWFQTGLSPNCDIVIGIRDTSSGILEDLLWYSRENMYQKLQDPSLPKFKN 374

Query: 345 ELNYDPAISVVWYRSLINTLTTTIA 369
             ++ P I + W    I+ + +   
Sbjct: 375 SFDFKPHIGIQWLNHCIHAIESAFT 399

>AER404C Chr5 complement(1412412..1413572) [1161 bp, 386 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR370C
          Length = 386

 Score =  149 bits (375), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 102/363 (28%), Positives = 179/363 (49%), Gaps = 30/363 (8%)

Query: 40  HTVVIRGNKQRLKTSHHKNMPQFYDSAKTLGIFHDHKLYEMNRMDLFPQLKDPIAHIAKS 99
           H  + R  K+R       ++  F +S +    F    +Y+++     P L D I      
Sbjct: 32  HGPITRRGKER-------SIRIFSESREVGTAFRQGLVYDLDDKKNLPLLNDEICEYI-- 82

Query: 100 TPAEKTQLVRPFLGISLYENHDKYSPMTAKELDTTEACSTYLDQYENSHGQKYGEDRDFV 159
           +   K++L+  ++G  L    + + P+T++EL        ++ ++E  +   Y     F 
Sbjct: 83  SHRSKSKLI-GYVGSDLSVESETFHPVTSEELHCLHGLLKFIAKWEADNEVNYASRSKFT 141

Query: 160 IVTARHHMIDLAILPFSRQ-----FTNVNLLCAYTPGNLLEISQDPADNTNDKVGVNTDN 214
           IV+ RHH++D+ ++PF  +     FT    L   T    L  SQ P        G+N+ +
Sbjct: 142 IVSPRHHILDILMIPFGNERCRLVFTAHRGLFVIT----LAPSQRPT-------GINSPS 190

Query: 215 PILKKICFSGFALEDILTESANDEERNPTFLIVENEI-ANTRLLMRCEIDAYNPITSHYT 273
              +KIC++GF LE +LT ++  E R   +  +E ++  +  +L++CE+DAYNP    YT
Sbjct: 191 SATRKICYTGFELERLLTATSGTE-RGSFYSFIEAKLEPDITILLQCEMDAYNPKRQKYT 249

Query: 274 ELKCYAKYNFGNPNHRRKLLKSWIQTGVIPTTDIVIGVRDTESGCLQDVRCYNRNLLYNK 333
           E+K    +N  N  H  KLLK W QT ++P+TDI++G RD  +  L+ V  Y+ + +  K
Sbjct: 250 EIKSSVDFNVRNVRHLSKLLKIWAQTALLPSTDILVGFRDPSTHVLKTVVPYSVDQIAEK 309

Query: 334 LISKSLPRCD-SELNYDPAISVVWYRSLINTLTTTIASLLDKFGRDEPQLFSIKVDNNCN 392
           L  +   R   S  N++P ++  W    I  +   ++SL+D      PQ F +++D N  
Sbjct: 310 LYIRDRTRSHPSYFNFNPEVAKDWTHYAIREICERLSSLVDATS-SSPQSFLVEIDKNLQ 368

Query: 393 IRI 395
           ++I
Sbjct: 369 MKI 371

>KLLA0E02245g Chr5 complement(210001..211212) [1212 bp, 403 aa] {ON}
           weakly similar to uniprot|Q06349 Saccharomyces
           cerevisiae YDR370C Hypothetical ORF
          Length = 403

 Score =  129 bits (325), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 89/314 (28%), Positives = 158/314 (50%), Gaps = 16/314 (5%)

Query: 87  PQLKDPIAHIAKSTPAEKTQLVRPFLGISLYENHDKYSPMTAKELDTTEACSTYLDQYEN 146
           P+L+  +    K +  E   +   F+GI L + +D Y P+    L++         +YE 
Sbjct: 90  PRLRPEVCTYIKDSKWENKAVKDSFIGIDLTKGYDDYVPLDRNVLNSLVILKEAYQRYEK 149

Query: 147 SHGQKYGEDRDFVIVTARHHMIDLAILPFSRQFTNVNLLCAYTPGNLLEISQDPADNTND 206
           +      E   FV  + RHH+ID+ + PF  +   ++LL    P   + IS D + +  +
Sbjct: 150 TLNP---EKTTFV--SLRHHIIDIIMCPFLDE--PLSLLMTVQPDKNILISVDKSKDKPN 202

Query: 207 KVGVNTDNPILKKICFSGFALEDILTESANDE---ERNPTFLIVENEIAN-TRLLMRCEI 262
            +   T N   KKIC++GFALED+L ES  +    E    + IV   + +   LL++ E+
Sbjct: 203 GIH-ETRNSFNKKICYTGFALEDLLIESPTEGHILEHELYYSIVHGSLNDEIDLLIQAEM 261

Query: 263 DAYNPITSHYTELKCYAKYNFGNPNHRRKLLKSWIQTGVIPTTDIVIGVRDTESGCLQDV 322
           D+ N +T  YTE+K    +  GN  HRRKLL+ WIQT ++P +D++IG R++ S  L+ +
Sbjct: 262 DSINTLTDTYTEIKSSVHFKLGNTYHRRKLLRMWIQTNLLPKSDLLIGFRNSYSNELEQL 321

Query: 323 RCYNRNLLYNKLISKSLPRCDSEL-NYDPAISVVWYRSLINTLTTTIASLLDKFGRDEPQ 381
           + Y    +Y+K+ + S+     +   ++P ++  W++ +   L   +  L  +       
Sbjct: 322 KAYKIQDIYHKINNSSIVGKPGKFYKFNPNVANDWFQHIFQVLKQNLLLLSQE---STST 378

Query: 382 LFSIKVDNNCNIRI 395
            F +++D N  + I
Sbjct: 379 TFKVQIDTNLTLSI 392

>KLLA0E12893g Chr5 complement(1140409..1141563) [1155 bp, 384 aa]
           {ON} similar to uniprot|P53063 Saccharomyces cerevisiae
           YGL246C RAI1 Nuclear protein that binds to and
           stabilizes the exoribonuclease Rat1p required for
           pre-rRNA processing
          Length = 384

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 56/228 (24%), Positives = 89/228 (39%), Gaps = 34/228 (14%)

Query: 114 ISLYENHDKYSPMTAKELDTT--EACSTYLDQYENSHGQKYGEDRDFVIVTARHHMIDLA 171
           + L     K+     +E D+T      + L++YE    +K   D    I+T R  +  L 
Sbjct: 57  LDLLSGIKKFKECNTEEFDSTTLHGLLSTLEEYERRKSKKTKVD----IITFRGIIRKLI 112

Query: 172 ILPF-SRQFTNVNLLCAYTPGNLLEISQDPADNTNDKVGVNTDNPILKKICFSGFALEDI 230
              F S QF  VN       G L  I +   D +   +  N ++ +  +  +SG+  E +
Sbjct: 113 SSAFDSSQFNPVNFRIVSFDGQLF-IKEVKTDASETSINKNRES-LQARAYYSGYKFEAL 170

Query: 231 LTESA-------NDEERNPTFLI---------VENEIANTRLLMRCEIDAYNPIT----- 269
            T S           E+ P  +I         V   I   ++L+  E+D           
Sbjct: 171 ATLSLPLPLVPRTTLEKRPKKIINNGDQFISMVRTGIGKCKILIGAEVDCIFDFKEDSDD 230

Query: 270 --SHYTELKCYAKYNFGNPNHR--RKLLKSWIQTGVIPTTDIVIGVRD 313
              HY ELKC    N  +  H+  RKL K+W+Q  ++    I+ G RD
Sbjct: 231 NLKHYAELKCTTMVNTVSDAHKFERKLFKTWLQCFLVGINRIIYGFRD 278

>NDAI0I03260 Chr9 (765221..766354) [1134 bp, 377 aa] {ON} Anc_3.570
          Length = 377

 Score = 46.2 bits (108), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 53/228 (23%), Positives = 93/228 (40%), Gaps = 36/228 (15%)

Query: 188 YTPGNLLEISQDPADNTNDKVGVNTDNPILKKICFSGFALEDILTESA-------NDEER 240
           Y P +L  +S D      D     T +PI    C++G+  E + T S           E+
Sbjct: 121 YNPVDLRIVSFDGQIFIKDVTKQETQDPIDLN-CYTGYKFESLATLSQPLPLVSRTTLEK 179

Query: 241 NPT---------FLIVENEIANTRLLMRCEIDAYNPITS-------HYTELKCYAKYNFG 284
            P            +V+  + +++L++  EID              HY ELKC  +    
Sbjct: 180 RPKKISSNGDEYIAVVKTGVGSSKLVLGAEIDCIFDFKEENKDNLRHYAELKCSTQIITA 239

Query: 285 NPNHR--RKLLKSWIQTGVIPTTDIVIGVRDTESGCLQDVRCYNRNLLYNKLISKSLPRC 342
              HR  RKL K+W+Q  ++    I+ G RD E+  L+ V  ++      + +   L   
Sbjct: 240 ADAHRFERKLFKTWLQCFLVGIPRIIYGFRD-ENYTLKSVEEFS-----TEEVPILLKEH 293

Query: 343 DSELNYDPAISVVWYRSLINTLTTTIASLLDKFGRDEPQLFSIKVDNN 390
           + ++N     ++ WY      LT  +  L+ +   DE + + +  +NN
Sbjct: 294 NPKMNTSCIDAIKWY----GLLTEWLLKLIPRDSGDEIRPYRLVFENN 337

>TPHA0G03650 Chr7 (776977..778110) [1134 bp, 377 aa] {ON} Anc_3.570
           YGL246C
          Length = 377

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 38/79 (48%), Gaps = 9/79 (11%)

Query: 246 IVENEIANTRLLMRCEIDAYNPIT-------SHYTELKCYAKYNFGNPNHR--RKLLKSW 296
           +V+  + N ++L+  E+DA             HY ELKC A  N  N   +   KL K+W
Sbjct: 196 VVKTGVGNCKILLGAEVDAIFDFKEKGKDNLQHYIELKCTAAINNINDTKKFENKLFKTW 255

Query: 297 IQTGVIPTTDIVIGVRDTE 315
           IQ  +I  T I  G RD +
Sbjct: 256 IQCFLIGITRITYGFRDEQ 274

>KAFR0J00160 Chr10 complement(26405..27547) [1143 bp, 380 aa] {ON}
           Anc_3.570 YGL246C
          Length = 380

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 35/137 (25%), Positives = 56/137 (40%), Gaps = 21/137 (15%)

Query: 246 IVENEIANTRLLMRCEIDAYNPIT-------SHYTELKCYAKYNFGN--PNHRRKLLKSW 296
           +V+  I   R+LM  E+D              HY ELKC    +      N  +KL K+W
Sbjct: 199 VVKTGIGKHRVLMGGEVDGIYDFKEDGADNLKHYLELKCTRSLSSYQDIENFEKKLFKTW 258

Query: 297 IQTGVIPTTDIVIGVRDTESGCLQDVRCYNRNLLYNKLISKSLPRCDSELNYDPAI--SV 354
           +Q  +I    I  G RD         R YN   +  + +++ +P+  +          ++
Sbjct: 259 LQCFLIGIPRITYGFRD---------RSYNLTSI-EEYLTEDVPKLFTNRGVKAQCMDAI 308

Query: 355 VWYRSLINTLTTTIASL 371
            WY  +I  L  T+A L
Sbjct: 309 QWYGEIIGWLYDTLAHL 325

>NCAS0E00240 Chr5 complement(34922..36064) [1143 bp, 380 aa] {ON}
           Anc_3.570
          Length = 380

 Score = 40.0 bits (92), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 43/180 (23%), Positives = 73/180 (40%), Gaps = 28/180 (15%)

Query: 160 IVTARHHMIDLAILPF-SRQFTNVNLLCAYTPGNLLEISQDPADNTNDKVGVNTDNPILK 218
           I+T R  +  L    F +  F  +NL      G L    +D AD  + KV    +N  + 
Sbjct: 101 IITFRGIIRKLISSAFETANFNPINLRIVSFDGQLF--IKDMADLNDKKVLNAKENDHID 158

Query: 219 KICFSGFALEDILTES--------ANDEERNPTFL--------IVENEIANTRLLMRCEI 262
              +SG+  E + T S        A  ++R+            +V+  + + +L++  EI
Sbjct: 159 LGSYSGYKFETLATLSQPVPYVSRATLDKRSKKICNNGDEYVTVVKTGVGSAKLVLGAEI 218

Query: 263 DAYNPIT-------SHYTELKCYAKYNFGNPNHR--RKLLKSWIQTGVIPTTDIVIGVRD 313
           D              HY ELKC  +       H+  RK+ ++W+Q  ++    I+ G RD
Sbjct: 219 DCVFDFKEDGKDNLKHYAELKCTTQVITAADAHKFERKIFRTWLQCFLVGIPRIIYGFRD 278

>Kwal_47.19276 s47 (1168248..1169408) [1161 bp, 386 aa] {ON} YGL246C
           (RAI1) - Product of gene unknown [contig 344] FULL
          Length = 386

 Score = 39.3 bits (90), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 28/90 (31%), Positives = 44/90 (48%), Gaps = 10/90 (11%)

Query: 246 IVENEIANTRLLMRCEIDA---YNPITS----HYTELKCYAKYN-FGNP-NHRRKLLKSW 296
           +V + + N +L++  E+D    +   TS    HY ELKC    + F    +  RKL K+W
Sbjct: 200 VVRSGVGNCKLVLGAEVDCVFDFAEDTSNNLKHYAELKCTKGVSTFAEARSFERKLFKTW 259

Query: 297 IQTGVIPTTDIVIGVRDTESGCLQDVRCYN 326
           +Q  ++    I+ G RD E   L+ V  Y 
Sbjct: 260 LQCFLVGINRIIYGFRD-EHFILRSVEEYG 288

>KLTH0G00660g Chr7 complement(44243..45394) [1152 bp, 383 aa] {ON}
           highly similar to uniprot|P53063 Saccharomyces
           cerevisiae YGL246C RAI1 Nuclear protein that binds to
           and stabilizes the exoribonuclease Rat1p required for
           pre-rRNA processing
          Length = 383

 Score = 38.9 bits (89), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 32/132 (24%), Positives = 59/132 (44%), Gaps = 15/132 (11%)

Query: 246 IVENEIANTRLLMRCEIDAYNPIT-------SHYTELKCYAKYN-FGNPN-HRRKLLKSW 296
           +V + + + +L++  E+D     T        HY ELKC    + F       RK+ K+W
Sbjct: 200 VVRSGVGHCKLVLGAEVDCVFDFTEDSSDNLKHYAELKCTKGVSTFAEARAFERKMFKTW 259

Query: 297 IQTGVIPTTDIVIGVRDTESGCLQDVRCYNRNLLYNKLISKSLPRCDSELNYDPAISVVW 356
           +Q  ++    ++ G RD E+  L+ V  Y+      + +   L   + +L      +V W
Sbjct: 260 LQCFLVGINRVIYGFRD-ENFILRSVEEYS-----TQEVPLLLKNNNPQLTNACMDAVRW 313

Query: 357 YRSLINTLTTTI 368
           Y +L   L ++I
Sbjct: 314 YGALTEWLLSSI 325

>YGL246C Chr7 complement(37617..38780) [1164 bp, 387 aa] {ON}
           RAI1Nuclear protein with decapping endonuclease activity
           targeted toward mRNAs with unmethylated
           7-methylguanosine cap structures; binds to and
           stabilizes the exoribonuclease Rat1p; required for
           pre-rRNA processing; homologous to human DOM3Z
          Length = 387

 Score = 38.1 bits (87), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 20/77 (25%), Positives = 36/77 (46%), Gaps = 9/77 (11%)

Query: 246 IVENEIANTRLLMRCEIDAYNPITS-------HYTELKCYAKYNFGNPNHR--RKLLKSW 296
           +V   + N +L++  E+D              HY ELKC  +    +  H+  RKL ++W
Sbjct: 206 VVRTGVGNCKLILGAEVDCIFDFKENGRDNLKHYAELKCTQQVANISDTHKFERKLFRTW 265

Query: 297 IQTGVIPTTDIVIGVRD 313
           +Q  ++    I+ G +D
Sbjct: 266 LQCFLVGIPRIIYGFKD 282

>Suva_7.15 Chr7 complement(32131..33300) [1170 bp, 389 aa] {ON}
           YGL246C (REAL)
          Length = 389

 Score = 38.1 bits (87), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 20/77 (25%), Positives = 36/77 (46%), Gaps = 9/77 (11%)

Query: 246 IVENEIANTRLLMRCEIDAYNPIT-------SHYTELKCYAKYNFGNPNHR--RKLLKSW 296
           +V   + N +L++  E+D              HY ELKC  +    +  H+  RKL ++W
Sbjct: 206 VVRTGVGNCKLILGAEVDCVFDFKENGKDNLKHYAELKCTQQVMNVSDTHKFERKLFRTW 265

Query: 297 IQTGVIPTTDIVIGVRD 313
           +Q  ++    I+ G +D
Sbjct: 266 LQCFLVGIPRIIYGFKD 282

>Skud_7.21 Chr7 complement(41773..42942) [1170 bp, 389 aa] {ON}
           YGL246C (REAL)
          Length = 389

 Score = 37.7 bits (86), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 20/79 (25%), Positives = 37/79 (46%), Gaps = 9/79 (11%)

Query: 246 IVENEIANTRLLMRCEIDAYNPIT-------SHYTELKCYAKYNFGNPNHR--RKLLKSW 296
           +V   + N +L++  E+D              HY ELKC  +    +  H+  RKL ++W
Sbjct: 206 VVRTGVGNCKLILGAEVDCVFDFKENGKDNLKHYAELKCTQQVMNISDTHKFERKLFRTW 265

Query: 297 IQTGVIPTTDIVIGVRDTE 315
           +Q  ++    I+ G +D +
Sbjct: 266 LQCFLVGIPRIIYGFKDDQ 284

>Smik_7.15 Chr7 complement(32394..33557) [1164 bp, 387 aa] {ON}
           YGL246C (REAL)
          Length = 387

 Score = 37.7 bits (86), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 19/77 (24%), Positives = 36/77 (46%), Gaps = 9/77 (11%)

Query: 246 IVENEIANTRLLMRCEIDAYNPIT-------SHYTELKCYAKYNFGNPNHR--RKLLKSW 296
           +V   + + +L++  E+D              HY ELKC  +    +  H+  RKL ++W
Sbjct: 206 VVRTGVGSCKLILGAEVDCIFDFKENGRDNLKHYAELKCTKQVMNASDTHKFERKLFRTW 265

Query: 297 IQTGVIPTTDIVIGVRD 313
           +Q  ++    I+ G +D
Sbjct: 266 LQCFLVGIPRIIYGFKD 282

>CAGL0C01925g Chr3 complement(202920..204122) [1203 bp, 400 aa] {ON}
           similar to uniprot|P53063 Saccharomyces cerevisiae
           YGL246c RAI1
          Length = 400

 Score = 37.0 bits (84), Expect = 0.072,   Method: Compositional matrix adjust.
 Identities = 19/77 (24%), Positives = 37/77 (48%), Gaps = 9/77 (11%)

Query: 246 IVENEIANTRLLMRCEIDAYNPITS-------HYTELKCYAKYNFGNPNHR--RKLLKSW 296
           +V   +   ++++  EID              HYTELKC ++ +  N   R  +K+ ++W
Sbjct: 211 VVRTGVGECKVVLGAEIDCIFDFKEEGKDNLKHYTELKCSSQISTTNDVRRFEKKMFRAW 270

Query: 297 IQTGVIPTTDIVIGVRD 313
           +Q  ++    ++ G RD
Sbjct: 271 LQCFLVGVPRVIYGFRD 287

>ZYRO0E09592g Chr5 (764748..765890) [1143 bp, 380 aa] {ON} similar
           to uniprot|P53063 Saccharomyces cerevisiae YGL246C RAI1
           Nuclear protein that binds to and stabilizes the
           exoribonuclease Rat1p required for pre-rRNA processing
          Length = 380

 Score = 36.6 bits (83), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 20/79 (25%), Positives = 36/79 (45%), Gaps = 13/79 (16%)

Query: 246 IVENEIANTRLLMRCEIDAYNPIT-------SHYTELKCYAKYNFGNP----NHRRKLLK 294
           +V+  + N ++++  E+D              HY ELKC A  +   P       RK+ +
Sbjct: 198 VVKTGVGNVKVILGAEVDCIFDFKEEGKDNLKHYAELKCSA--DVSTPADARKFERKVFR 255

Query: 295 SWIQTGVIPTTDIVIGVRD 313
           +W+Q  ++    I+ G RD
Sbjct: 256 TWLQCFLVGIPRIIYGFRD 274

>AFR262C Chr6 complement(904657..906984) [2328 bp, 775 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGL246C
           (RAI1); Tandem gene duplication in this genome
          Length = 775

 Score = 35.4 bits (80), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 33/75 (44%), Gaps = 11/75 (14%)

Query: 246 IVENEIANTRLLMRCEIDAY----NPIT---SHYTELKCYAKYNFGNPNHRRKLLKSWIQ 298
           ++   +   +L++  EID       P      HY ELK   K    N N   KL  SW+Q
Sbjct: 608 VMRTGVGEHKLVLGAEIDGIIDFREPTGDNLKHYVELKVCQK----NRNFSEKLFSSWLQ 663

Query: 299 TGVIPTTDIVIGVRD 313
             ++    ++IG RD
Sbjct: 664 CFLVGINRVIIGFRD 678

>SAKL0F00726g Chr6 complement(63291..64442) [1152 bp, 383 aa] {ON}
           highly similar to uniprot|P53063 Saccharomyces
           cerevisiae YGL246C RAI1 Nuclear protein that binds to
           and stabilizes the exoribonuclease Rat1p required for
           pre-rRNA processing
          Length = 383

 Score = 35.4 bits (80), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 19/77 (24%), Positives = 33/77 (42%), Gaps = 9/77 (11%)

Query: 246 IVENEIANTRLLMRCEIDAYNPIT-------SHYTELKCYAKYN--FGNPNHRRKLLKSW 296
           +V   +  ++L++  E+D              HYTELKC              RK+ K+W
Sbjct: 200 VVRTGVGKSKLILGAEVDCVFDFKEDSGDNLKHYTELKCTKGVTTIAEARAFERKIFKTW 259

Query: 297 IQTGVIPTTDIVIGVRD 313
           +Q  ++    ++ G RD
Sbjct: 260 LQCFLVGVNRVIYGFRD 276

>KAFR0E02500 Chr5 (511386..513398) [2013 bp, 670 aa] {ON} Anc_5.481
           YOR144C
          Length = 670

 Score = 35.4 bits (80), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 39/133 (29%), Positives = 61/133 (45%), Gaps = 12/133 (9%)

Query: 188 YTPGNLLEISQDPAD-NTNDKVGVNTDNPILKKICFS-GFALE-DILTESANDEERNPTF 244
           Y P NL+EI Q+ A   T  KV V T    L++ C S G  LE DIL E   D +R+   
Sbjct: 408 YIPSNLIEICQNQASLFTAKKVTVKTVVNFLRRYCTSLGLELEDDILEEIVRDSDRDIRK 467

Query: 245 LIVENEI---ANTRLLMRCEIDAYNPIT-----SHYTELKCYAKYNFGNPNHRRKLLKSW 296
            ++  +    +   L++R  I   N +T     SH  ++  Y+       + R  L+K  
Sbjct: 468 CLMHLQFWFSSQDHLVLREPIYENNEVTSLREYSHLVDIMSYSDI-INETSSRNSLVKQE 526

Query: 297 IQTGVIPTTDIVI 309
           I T ++ +  I +
Sbjct: 527 IDTTLMTSESIEV 539

>Kpol_380.8 s380 (14034..15173) [1140 bp, 379 aa] {ON}
           (14034..15173) [1140 nt, 380 aa]
          Length = 379

 Score = 35.0 bits (79), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 56/233 (24%), Positives = 90/233 (38%), Gaps = 53/233 (22%)

Query: 113 GISLYENHDK--YSPMTAKELDTTEACSTYLDQYENSHGQKYGEDRDFVIVTARHHMIDL 170
           GI  +++H K    P T K L  T      +  YE    +K   D    I+T R  +  L
Sbjct: 62  GIKKFKDHYKNFQDPGTLKGLLKT------IQAYEEIKQKKVKVD----IITFRGVIRKL 111

Query: 171 AILPF-SRQFTNVNLLCAYTPGNLL--EISQDPADNTNDKVGVNTDNPILKKICFSGFAL 227
               F S +F  VNL      G +   E+ +   +  + K+      P+     +SG+  
Sbjct: 112 ISSAFDSPKFNQVNLRIVLFDGQIFMKEVPRKEEEPKDGKIA----PPV-----YSGYKF 162

Query: 228 EDILT-------ESANDEERNPTFLI---------VENEIANTRLLMRCEIDAYNPIT-- 269
           E+++T        S    E+ P  ++         V   + N +L++  E+DA       
Sbjct: 163 ENLVTVSKPIPYTSRTTIEKRPKKIVSNGDEYISVVRTGVGNCKLMLGAEVDAIFDFKEE 222

Query: 270 -----SHYTELKCYAKYNFGNPNHRRK----LLKSWIQTGVIPTTDIVIGVRD 313
                 HY ELK         P+  RK    + K+WIQ  ++    I+ G RD
Sbjct: 223 DKDNLKHYVELKTTNA--VLTPSDARKFEQKIFKTWIQCFLVGIPRIIYGFRD 273

>Kwal_55.20195 s55 complement(291627..292835) [1209 bp, 402 aa] {ON}
           YDR331W (GPI8) - (putative) transamidase involved in GPI
           anchor attachment [contig 153] FULL
          Length = 402

 Score = 33.5 bits (75), Expect = 0.83,   Method: Compositional matrix adjust.
 Identities = 35/142 (24%), Positives = 66/142 (46%), Gaps = 14/142 (9%)

Query: 256 LLMRCEIDAYNPITSHYTELKCYAKYNFGNPNHRRKLLKSW--IQTGVIPTTDIVIGVRD 313
           LL+   + A +  T+++  L C +++ F N  H   +L  +  ++   IP + I++ + D
Sbjct: 13  LLISQFVWANSEHTNNWAVLVCTSRFWF-NYRHMANVLSMYRTVKRLGIPDSQIILMLSD 71

Query: 314 TESGCLQDVRCYNRNLLYNKLISKSLPRCDSELNYDPAISVVWYRSLINTLTTTIASLLD 373
                  DV C +RNL    + + +    D    Y  ++ V  Y+    T+   I  L D
Sbjct: 72  -------DVACNSRNLFPGSVFNNADRALDL---YGESVEVD-YKGYEVTVENFIRLLTD 120

Query: 374 KFGRDEPQLFSIKVDNNCNIRI 395
           ++G ++P+   +  D N NI I
Sbjct: 121 RWGEEQPKSKRLLTDENSNIFI 142

>Kpol_1035.40 s1035 (101912..102910,102960..102968,103011..106556)
           [4554 bp, 1517 aa] {ON}
           (101912..102910,102960..102968,103011..106556) [4554 nt,
           1518 aa]
          Length = 1517

 Score = 32.0 bits (71), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 21/33 (63%)

Query: 192 NLLEISQDPADNTNDKVGVNTDNPILKKICFSG 224
           NL+E+S+  AD  + K+G  TD  +L KI  SG
Sbjct: 276 NLIELSEMAADINSSKIGAETDQSMLLKISLSG 308

>Suva_5.137 Chr5 complement(203068..204465) [1398 bp, 465 aa] {ON}
           YER038C (REAL)
          Length = 465

 Score = 32.0 bits (71), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 28/119 (23%), Positives = 52/119 (43%), Gaps = 8/119 (6%)

Query: 284 GNPNHRRKLLKSWIQTGVIPTTDIVIGVRDTESGCLQDVRCYNRNLLYNKLISKSLPRCD 343
            N   +R+L KS    GV+P   + +  ++T S   +D    + N  Y +L    +   D
Sbjct: 165 SNTVAKRELQKSLNFPGVVPEIYLDLVTKETISDKYKDWYFISENCHYEELTDLEMKDMD 224

Query: 344 SELNYDPAISVVWYRSLINTLTTTIASLLDKFGRDEPQLFSIKVDNNCNIRIEHRQNPN 402
               +D  +        + +   +IA+LL         LF I  + + ++RIE+++N N
Sbjct: 225 HSFLFDNGVFQGNVPEFMRSKCPSIANLL--------VLFGISEEKSKSLRIEYKENEN 275

>KLTH0E03674g Chr5 complement(333386..334588) [1203 bp, 400 aa] {ON}
           similar to uniprot|P49018 Saccharomyces cerevisiae
           YDR331W GPI8 ER membrane glycoprotein subunit of the
           glycosylphosphatidylinositol transamidase complex that
           adds glycosylphosphatidylinositol (GPI) anchors to newly
           synthesized proteins
          Length = 400

 Score = 31.2 bits (69), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 34/142 (23%), Positives = 64/142 (45%), Gaps = 14/142 (9%)

Query: 256 LLMRCEIDAYNPITSHYTELKCYAKYNFGNPNHRRKLLKSW--IQTGVIPTTDIVIGVRD 313
           LL    + A +  T+++  L C +++ F N  H   +L  +  ++   IP + I++ + D
Sbjct: 13  LLTSTLVGASHEHTNNWAVLVCTSRFWF-NYRHMANVLSMYRTVKRLGIPDSQIILMLSD 71

Query: 314 TESGCLQDVRCYNRNLLYNKLISKSLPRCDSELNYDPAISVVWYRSLINTLTTTIASLLD 373
                  DV C +RNL    + + +    D    Y  ++ V  Y+    T+   I  L D
Sbjct: 72  -------DVACNSRNLFPGSVFNNADRALDL---YGESVEVD-YKGYEVTVENFIRLLTD 120

Query: 374 KFGRDEPQLFSIKVDNNCNIRI 395
           ++  ++P+   +  D N NI I
Sbjct: 121 RWSEEQPKSKRLLTDENSNIFI 142

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.134    0.399 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 44,952,004
Number of extensions: 2057068
Number of successful extensions: 5282
Number of sequences better than 10.0: 58
Number of HSP's gapped: 5371
Number of HSP's successfully gapped: 58
Length of query: 402
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 290
Effective length of database: 40,638,807
Effective search space: 11785254030
Effective search space used: 11785254030
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 67 (30.4 bits)