Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
CAGL0A02838g5.435ON82882842460.0
TDEL0E019005.435ON7627706096e-67
NCAS0F033905.435ON8618455652e-60
KAFR0E038305.435ON8457475253e-55
Kpol_1016.55.435ON8128014854e-50
NDAI0B056805.435ON8567364767e-49
KLTH0F16038g5.435ON7928364552e-46
Suva_2.5415.435ON8694103791e-36
YDR369C (XRS2)5.435ON8543923682e-35
Skud_4.6385.435ON8432313423e-32
Smik_4.6355.435ON8634063254e-30
ZYRO0F10054g5.435ON6601913191e-29
TBLA0A028205.435ON9254142933e-26
TPHA0J025905.435ON7756962871e-25
Kwal_55.214225.435ON7821962871e-25
SAKL0G02552g5.435ON8344142702e-23
KNAG0C049005.435ON7692132532e-21
KLLA0E02201g5.435ON8357101906e-14
AER402C5.435ON8694041881e-13
Ecym_47615.435ON798811541e-09
KAFR0J023906.300ON223122761.0
SAKL0D00220gsingletonON577140781.2
TDEL0A071406.300ON223140761.3
Smik_13.4106.300ON222143742.0
Skud_13.3706.300ON223145723.5
Skud_4.7723.83ON386121733.7
KLTH0E09570g2.394ON59570734.4
TPHA0B046701.61ON45874716.2
Smik_7.1626.140ON67153726.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0A02838g
         (828 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0A02838g Chr1 complement(297872..300358) [2487 bp, 828 aa] {...  1640   0.0  
TDEL0E01900 Chr5 (359266..361554) [2289 bp, 762 aa] {ON} Anc_5.4...   239   6e-67
NCAS0F03390 Chr6 complement(683109..685694) [2586 bp, 861 aa] {O...   222   2e-60
KAFR0E03830 Chr5 (759871..762408) [2538 bp, 845 aa] {ON} Anc_5.4...   206   3e-55
Kpol_1016.5 s1016 (10036..12474) [2439 bp, 812 aa] {ON} (10036.....   191   4e-50
NDAI0B05680 Chr2 complement(1384354..1386924) [2571 bp, 856 aa] ...   187   7e-49
KLTH0F16038g Chr6 (1302028..1304406) [2379 bp, 792 aa] {ON} weak...   179   2e-46
Suva_2.541 Chr2 complement(965557..968166) [2610 bp, 869 aa] {ON...   150   1e-36
YDR369C Chr4 complement(1215016..1217580) [2565 bp, 854 aa] {ON}...   146   2e-35
Skud_4.638 Chr4 complement(1137885..1140416) [2532 bp, 843 aa] {...   136   3e-32
Smik_4.635 Chr4 complement(1135040..1137631) [2592 bp, 863 aa] {...   129   4e-30
ZYRO0F10054g Chr6 complement(814872..816854) [1983 bp, 660 aa] {...   127   1e-29
TBLA0A02820 Chr1 (678796..681573) [2778 bp, 925 aa] {ON} Anc_5.4...   117   3e-26
TPHA0J02590 Chr10 complement(574619..576946) [2328 bp, 775 aa] {...   115   1e-25
Kwal_55.21422 s55 (830578..832926) [2349 bp, 782 aa] {ON} YDR369...   115   1e-25
SAKL0G02552g Chr7 complement(209978..212482) [2505 bp, 834 aa] {...   108   2e-23
KNAG0C04900 Chr3 (946975..949284) [2310 bp, 769 aa] {ON} Anc_5.4...   102   2e-21
KLLA0E02201g Chr5 complement(205466..207973) [2508 bp, 835 aa] {...    78   6e-14
AER402C Chr5 complement(1407938..1410547) [2610 bp, 869 aa] {ON}...    77   1e-13
Ecym_4761 Chr4 (1479649..1482045) [2397 bp, 798 aa] {ON} similar...    64   1e-09
KAFR0J02390 Chr10 (452888..453559) [672 bp, 223 aa] {ON} Anc_6.3...    34   1.0  
SAKL0D00220g Chr4 complement(18466..20199) [1734 bp, 577 aa] {ON...    35   1.2  
TDEL0A07140 Chr1 (1246460..1247131) [672 bp, 223 aa] {ON} Anc_6....    34   1.3  
Smik_13.410 Chr13 (651723..652391) [669 bp, 222 aa] {ON} YMR202W...    33   2.0  
Skud_13.370 Chr13 (641454..642125) [672 bp, 223 aa] {ON} YMR202W...    32   3.5  
Skud_4.772 Chr4 complement(1365597..1366757) [1161 bp, 386 aa] {...    33   3.7  
KLTH0E09570g Chr5 complement(864260..866047) [1788 bp, 595 aa] {...    33   4.4  
TPHA0B04670 Chr2 (1098809..1100185) [1377 bp, 458 aa] {ON} Anc_1...    32   6.2  
Smik_7.162 Chr7 (291286..293301) [2016 bp, 671 aa] {ON} YGL113W ...    32   6.6  

>CAGL0A02838g Chr1 complement(297872..300358) [2487 bp, 828 aa] {ON}
           similar to uniprot|P33301 Saccharomyces cerevisiae
           YDR369c XRS2
          Length = 828

 Score = 1640 bits (4246), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 802/828 (96%), Positives = 802/828 (96%)

Query: 1   MWVLRYSYVEETGEVKKVSCCIRQNVQYTIGRSSKNNLVIKNDKSISRQHVSLKWSSSKN 60
           MWVLRYSYVEETGEVKKVSCCIRQNVQYTIGRSSKNNLVIKNDKSISRQHVSLKWSSSKN
Sbjct: 1   MWVLRYSYVEETGEVKKVSCCIRQNVQYTIGRSSKNNLVIKNDKSISRQHVSLKWSSSKN 60

Query: 61  CIELTNTGKLTKSSEKYLGSNELITYSADETQIEMLLGVAPVKIILSRIDELFDIPNSLS 120
           CIELTNTGKLTKSSEKYLGSNELITYSADETQIEMLLGVAPVKIILSRIDELFDIPNSLS
Sbjct: 61  CIELTNTGKLTKSSEKYLGSNELITYSADETQIEMLLGVAPVKIILSRIDELFDIPNSLS 120

Query: 121 QFRETLETLGIQISVDNANVNSTSLITVGDFGYRELFAACNDINIYSSGLLTEICNKLVN 180
           QFRETLETLGIQISVDNANVNSTSLITVGDFGYRELFAACNDINIYSSGLLTEICNKLVN
Sbjct: 121 QFRETLETLGIQISVDNANVNSTSLITVGDFGYRELFAACNDINIYSSGLLTEICNKLVN 180

Query: 181 DHDNFDAEWRSMQSSYHRNLDLEGLLSQFGGIRGKFFFLLYKIDWFIISYLKPFLLKLSV 240
           DHDNFDAEWRSMQSSYHRNLDLEGLLSQFGGIRGKFFFLLYKIDWFIISYLKPFLLKLSV
Sbjct: 181 DHDNFDAEWRSMQSSYHRNLDLEGLLSQFGGIRGKFFFLLYKIDWFIISYLKPFLLKLSV 240

Query: 241 EIHDSIHKNDDLLRLISSKQADEIPIVISNEKIKYLPEDTLQIHSDDIYKFIESGDLYRN 300
           EIHDSIHKNDDLLRLISSKQADEIPIVISNEKIKYLPEDTLQIHSDDIYKFIESGDLYRN
Sbjct: 241 EIHDSIHKNDDLLRLISSKQADEIPIVISNEKIKYLPEDTLQIHSDDIYKFIESGDLYRN 300

Query: 301 AIRYQSMERKPIYDLEDETTNAIIPQKRSLANTSQPTDTSLESTKKKRVRRHKVEPLNSL 360
           AIRYQSMERKPIYDLEDETTNAIIPQKRSLANTSQPTDTSLESTKKKRVRRHKVEPLNSL
Sbjct: 301 AIRYQSMERKPIYDLEDETTNAIIPQKRSLANTSQPTDTSLESTKKKRVRRHKVEPLNSL 360

Query: 361 SFFAGGISPVPGTNNEYNQSKVNGHLDSEISPDSASTTREQKIPGQSHTISTTRMEHALT 420
           SFFAGGISPVPGTNNEYNQSKVNGHLDSEISPDSASTTREQKIPGQSHTISTTRMEHALT
Sbjct: 361 SFFAGGISPVPGTNNEYNQSKVNGHLDSEISPDSASTTREQKIPGQSHTISTTRMEHALT 420

Query: 421 DDNSEPTIVQRSIAEGISHRDQLIGNDEVVEDQHHLPDRKKRDIHENTMYNNSYNGNKSL 480
           DDNSEPTIVQRSIAEGISHRDQLIGNDEVVEDQHHLPDRKKRDIHENTMYNNSYNGNKSL
Sbjct: 421 DDNSEPTIVQRSIAEGISHRDQLIGNDEVVEDQHHLPDRKKRDIHENTMYNNSYNGNKSL 480

Query: 481 YGVENSLTQSNLLQSMGYEKSNNKTELSKKNAGGIMSTEKNLDAQRPNLKSQTLNSLEDN 540
           YGVENSLTQSNLLQSMGYEKSNNKTELSKKNAGGIMSTEKNLDAQRPNLKSQTLNSLEDN
Sbjct: 481 YGVENSLTQSNLLQSMGYEKSNNKTELSKKNAGGIMSTEKNLDAQRPNLKSQTLNSLEDN 540

Query: 541 DPKRTLQKRDIDIVKLVQTTKESEVKRLSSTIVKIEDSELTEEAINKLNDLVLVEPVADL 600
           DPKRTLQKRDIDIVKLVQTTKESEVKRLSSTIVKIEDSELTEEAINKLNDLVLVEPVADL
Sbjct: 541 DPKRTLQKRDIDIVKLVQTTKESEVKRLSSTIVKIEDSELTEEAINKLNDLVLVEPVADL 600

Query: 601 IRTKSDISANNTTQQQWKNRKNFKKFVKICPKYKSEQSSIESMSRHIRGSGEILTREFLQ 660
           IRTKSDISANNTTQQQWKNRKNFKKFVKICPKYKSEQSSIESMSRHIRGSGEILTREFLQ
Sbjct: 601 IRTKSDISANNTTQQQWKNRKNFKKFVKICPKYKSEQSSIESMSRHIRGSGEILTREFLQ 660

Query: 661 TKNVPVDYYNSHHDQNDFVDEINTAPQANKSNSFVHQILPEIGDENENSFSFTRTXXXXX 720
           TKNVPVDYYNSHHDQNDFVDEINTAPQANKSNSFVHQILPEIGDENENSFSFTRT     
Sbjct: 661 TKNVPVDYYNSHHDQNDFVDEINTAPQANKSNSFVHQILPEIGDENENSFSFTRTAIGNG 720

Query: 721 XXXXXXXXXXXXQQLFVVDDDFEDSQDVGHLLNKADTTEPPQQLQDHEDTMNDGPGSTTP 780
                       QQLFVVDDDFEDSQDVGHLLNKADTTEPPQQLQDHEDTMNDGPGSTTP
Sbjct: 721 NNNSANEINNSNQQLFVVDDDFEDSQDVGHLLNKADTTEPPQQLQDHEDTMNDGPGSTTP 780

Query: 781 VRNKRNRGKVSVTNGGNRVRSVVKGFTNEXXXXXXXXXEPTFKFSRHR 828
           VRNKRNRGKVSVTNGGNRVRSVVKGFTNE         EPTFKFSRHR
Sbjct: 781 VRNKRNRGKVSVTNGGNRVRSVVKGFTNEDDDDDDDDDEPTFKFSRHR 828

>TDEL0E01900 Chr5 (359266..361554) [2289 bp, 762 aa] {ON} Anc_5.435
           YDR369C
          Length = 762

 Score =  239 bits (609), Expect = 6e-67,   Method: Compositional matrix adjust.
 Identities = 222/770 (28%), Positives = 365/770 (47%), Gaps = 96/770 (12%)

Query: 1   MWVLRYSYVEETGEVKKVSCCIRQNVQYTIGRSSKNNLVIKNDKSISRQHVSLKWSSSKN 60
           MW+L+Y+Y  E G +++VS C+ +   ++IGRSSKN L IKNDKSISR H+S+ W S   
Sbjct: 1   MWILKYTYELEDGTIRRVSSCLVKQQTFSIGRSSKNPLNIKNDKSISRNHISVVWDSEVK 60

Query: 61  CIELTNTGKLTKSSEKYLGSNELITYSAD---ETQIEMLLGVAPVKIILSRIDELFDIPN 117
            I L N G+LT +  KYL   E + +         I + LG  P+K+ +   D +FD+P+
Sbjct: 61  LIRLINQGRLTAAGGKYLKVGESMDFEEKLHIREPIIIELGTKPIKVEVVWQDVVFDLPS 120

Query: 118 SLSQFRETLETLGIQISVDNANVNSTSLITVG--DFGYRELFAACNDINIYSSGLLTEIC 175
            LSQF +TL+ +GI +  D  +  ST++I      F Y+ LF   N   I +S  L E+ 
Sbjct: 121 QLSQFIDTLDHVGIGVKADTVDNRSTTIIVTDKIKFAYKCLFGLINGAVIRNSQFLVEVT 180

Query: 176 NKLVNDHDNFDAEWRSMQSSYHRNLDLEGLLSQFGGIRGKFFFLLYKIDWFIISYLKPFL 235
           N L      F+  W S+  +    L    L      ++G  F+L+   D   ++Y++  L
Sbjct: 181 NILSKPTTTFEESWDSLIQNESYMLYPNNLGPHEVILKGYKFYLIAS-DVITMAYVQEAL 239

Query: 236 LKLSVEIHDSIHKNDDLL-RLISSKQADEIPIVISNEKIKYLPEDTLQIHS-DDIYKFIE 293
            + + E+   +   + LL RL      D++ IV+  E+   +P D +++H+  D+   + 
Sbjct: 240 ERGNGELI-VVENTEQLLDRLKQENSTDDL-IVLKAEETTKIPGDKIKLHTLVDLVNAVS 297

Query: 294 SGDLYRNAIRYQSMERKP---IYDLEDETTNAIIPQKRSLAN---TSQPTDTSLESTKKK 347
              +         ME  P   I   +   T   +   +SL+N   T + T T  E    K
Sbjct: 298 HNTVKTLLGGVPPMEAGPGDVIGSHQPTLTKTEVSSSQSLSNKEHTPEHTVTPAEKPPVK 357

Query: 348 RVRRHKVEPLNSLSFFAGGISPVPGTNNEYNQSKVNGHLDSEISPDSASTTREQKIPGQS 407
           R R ++V+PL+SL FFAGG         +Y+  +    + ++    +AS T +  I  Q 
Sbjct: 358 RRRYNRVKPLDSLMFFAGG---------DYSTEEPEQEISTQPVNPAASDTAKTSITTQI 408

Query: 408 HTISTTRMEHALTDDNSEPTIVQRSIAEGISHRDQLIGNDEVVEDQHHLPDRKKRDIHEN 467
           +       + +   D  +P IV ++ A+ ++     I +     + H +          N
Sbjct: 409 NVPENDASQESSAFDKFQPNIVLKNSAKPLT-----IDSPGDAHNTHEI----------N 453

Query: 468 TMYNNSYNGNKSLYGVENSLTQSNLLQSMGYEKSNNKTELSKKNAGGIMSTEKNLDAQRP 527
           T        N+ +  +   +        M + +S  ++E  + N   + +T       RP
Sbjct: 454 T-------ANQHVKDIAQQI-------EMNHPESEQQSE--QANLNMVETTP------RP 491

Query: 528 NLKSQTLNSLED--NDPKRTLQKRDIDIVKLVQTTKESEVKRLSSTIVKIEDSELTEEAI 585
             + +TL   +   N+P  +    +  +V L++  K  EVKRL ST+V+++  ELTE+AI
Sbjct: 492 TARKKTLQDFKSTVNNPDNSASSTE-GLVDLIKDAKSREVKRLKSTLVQVDTDELTEDAI 550

Query: 586 NKLNDLVLVEPVADLIRTKSDISANNTTQQQ---WKNRKNFKKFVKICPKYKSE---QSS 639
           N+L DL +V+P   LIR +   SA  +   Q   W  RKNFK FVK+  KYK +   ++ 
Sbjct: 551 NQLGDLAIVQPNDSLIRRQKIDSAETSRNDQHPPWDGRKNFKNFVKVQAKYKEQRMGENY 610

Query: 640 IESMSRHIRGSGEILTREFLQTKNVPVDYYNSHHDQNDFVDEINTAPQANKSNSFVHQIL 699
            E  S  IR SG +LTR+++ +K   +    S  +  DF       P+A++  S    + 
Sbjct: 611 REGSSDFIRNSGYLLTRQYVPSK---IYTKESSKEMQDF-------PEASEQTSRQFSV- 659

Query: 700 PEIGDENENS--FSFTRTXXXXXXXXXXXXXXXXXQQLFVVDDDFEDSQD 747
           P++ D+ E++  F+FTR                    LFVVD+D  DSQ+
Sbjct: 660 PQVIDDPEDAEPFTFTR----------HTSGTPANNGLFVVDED--DSQN 697

>NCAS0F03390 Chr6 complement(683109..685694) [2586 bp, 861 aa] {ON}
           Anc_5.435 YDR369C
          Length = 861

 Score =  222 bits (565), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 248/845 (29%), Positives = 371/845 (43%), Gaps = 176/845 (20%)

Query: 1   MWVLRYSYVEETGEVKKVSCCIRQNVQYTIGRSSKNNLVIKNDKSISRQHVSLKWSSSKN 60
           MWVLRY Y  E G  +K+S CI+++V YTIGRS+KN+L IKNDKSISRQH+SLKW   +N
Sbjct: 1   MWVLRYQYDLEDGSTQKISRCIQKSVCYTIGRSNKNHLSIKNDKSISRQHLSLKW-EDRN 59

Query: 61  CIELTNTGKLTKSSEKYLGSNELITYSADETQIEMLLGVAPVKIILSRIDELFDIPNSLS 120
            I + N GKLT   E+YL   + +T+  +   + + LG  PV + L      + IPN L+
Sbjct: 60  DIHIINQGKLTYIGEQYLDVGQSLTF-GNVNSLSIKLGTKPVMVHLEFYSSNWLIPNGLT 118

Query: 121 QFRETLETLGI----QISVDNANVNSTSLITVGDFGYRELFAACNDINIYSSGLLTEICN 176
           QF ETL+  G+    QI VD        +  +   G   L+    DI +      +  C 
Sbjct: 119 QFHETLKDFGVNVATQIPVDQKTQIDLIVDEINGSGLIPLWGFMKDIPVKKPQFFSTACE 178

Query: 177 KLVNDHDNFDAEWRSMQ-------SSYHRNLD--------------------------LE 203
            L ++ ++FD  W  +Q        S++ +L                           L+
Sbjct: 179 ILSSNDNDFDNSWHRLQETSNTLFCSHYISLKDRSRLFENYVILILFDNETNKDAVKTLK 238

Query: 204 GLLSQFGGIRGKFFFLLYKIDWFIISYLKP------FLLKLSVEIHDSIHKNDDLLRLIS 257
             L+  G I   F  L    D+  I+ LKP       L+K       S    +D L  + 
Sbjct: 239 TALNLGGAIVNDFSDLNASKDY--INNLKPTTNQHICLVKFG-----SFKSPNDQLPDLE 291

Query: 258 SKQADEIPIVISNEKIKYL----PEDTLQIHSDDIYKFIESGDLYRNAIRYQSMERKPIY 313
             + ++I   I ++KI  L    PE   Q+ + D+    E        I Y S +RK   
Sbjct: 292 YFKLEDIITAIRDDKIMKLITTIPERE-QVMNQDVSLIPE--------ITYPS-DRKTNI 341

Query: 314 DLEDETTNAIIPQKRSLANTSQPTDTSLES--TKKKRVRRHKVEPLNSLSFFAGGISPVP 371
                T ++I   K+++ +   P + +L +   KK+R+ R +V+PL+SL+FFAGG SP  
Sbjct: 342 QPSHHTVDSIHNDKKNVLSNRDPGEATLVNPIVKKRRLNRQRVKPLDSLAFFAGGASPKI 401

Query: 372 GTNNEYNQSKVNGHLDSEISPDSASTTREQKIPGQSHTISTTRMEHALT--DDNSEPTIV 429
           G                  SP    T +  K   +S      R  + LT    NS+P I 
Sbjct: 402 G------------------SPAVQETAQATK--DESAESDKFRTNNGLTQPSGNSQPLI- 440

Query: 430 QRSIAEGISHRDQLIGNDEVVEDQHHLPDRKKRDIHENTMYNNSYNGNKSLYGVENSLTQ 489
                    H + ++   EV+E  H+      ++I E          +KS   +E+  T+
Sbjct: 441 ---------HSEPIVLK-EVLEADHN------KNIQEGPTTAVPVIQSKSTQPLEH--TE 482

Query: 490 SNLLQSMGYEKSNNKTE------LSKKNAGGIMSTEKNLD--AQRPNLKSQTLNSLEDND 541
            N    +G   +    E      + + N   + ST+  +    ++ NLKS   NSLE  +
Sbjct: 483 QNKNSEIGSVAATPTPEVLTGNGVERPNTPQVPSTQALVSNHKEKKNLKS---NSLE--E 537

Query: 542 PKRTLQKRDIDIVKLVQTTKESEVKRLSSTIVKIEDSELTEEAINKLNDLVLVEPVADLI 601
           PK          V+ +Q TK  EV RL ST+V+I+  ELTE AIN+L  LV+VEP   LI
Sbjct: 538 PK--------SFVQAIQETKNREVTRLKSTMVEIDTDELTEGAINQLGSLVIVEPNQSLI 589

Query: 602 RTKSDISANNT--------TQQQWKNRKNFKKFVKICPKYKSEQSSIESMSRHIRGSGEI 653
           R K+      T        T ++W  RKNFKKFVKI PKY  + +  ++    IR +  +
Sbjct: 590 RKKASRCECRTPTGEDSDKTAREWSRRKNFKKFVKIYPKYMKKDTESDTTDL-IRNNAFL 648

Query: 654 LTREFLQTK-------NVPVDYYN--SHHDQ------------------NDFVDEINTAP 686
           +TR ++  K       NVP D  +   HHD                   NDF+     + 
Sbjct: 649 ITRNYVPMKKFTGQYNNVPNDDEDMYEHHDYERENIENGDGDLAIPPVVNDFIPSSQLSQ 708

Query: 687 ---QANKSNSFVHQILPEIGDENENSFSFTRTXXXXXXXXXXXXXXXXXQQLFVVDDDFE 743
              Q +  ++ +    P+  D+   SFSF R+                   LFVVD+D  
Sbjct: 709 RRLQIDSQSARIKDTQPDFSDDEGQSFSFRRSMANAKKTTANNG-------LFVVDEDDL 761

Query: 744 DSQDV 748
           DS ++
Sbjct: 762 DSINI 766

>KAFR0E03830 Chr5 (759871..762408) [2538 bp, 845 aa] {ON} Anc_5.435
           YDR369C
          Length = 845

 Score =  206 bits (525), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 215/747 (28%), Positives = 350/747 (46%), Gaps = 119/747 (15%)

Query: 1   MWVLRYSYVEETGEVKKVSCCIRQNVQYTIGRSSKNNLVIKNDKSISRQHVSLKW----S 56
           MW+LRY    E G ++KVSCC+++   Y+IGRSSKN L IKNDKSISRQH++++W     
Sbjct: 1   MWILRYENELEDGTLRKVSCCLQKWKMYSIGRSSKNPLTIKNDKSISRQHITIRWDCNNE 60

Query: 57  SSKNCIELTNTGKLTKSSEKYLGSNELITYSADET--QIEMLLGVAPVKIILSRIDELFD 114
            +   + + N GKLT   E Y+ S+E   +  DET   + + LG  PV + +S     +D
Sbjct: 61  GTGTVLSVVNQGKLTAIDENYMKSDESKAFD-DETYSTVVVKLGTKPVVVRISWTPIFWD 119

Query: 115 IPNSLSQFRETLETLGIQISVDNANVNSTSLITVGDFG--YRELFAAC-NDINIYSSGLL 171
           +     QF +++ ++GI   + ++NV   SL+   +     R +FA    +  +    LL
Sbjct: 120 LSKDFLQFEKSINSMGICTQMQSSNVRDISLVINDEKSNWSRIMFALLKQNCTLVKPVLL 179

Query: 172 TEICNKLVND-HDNFDAEWRSMQSSYHRNLDLEGLLSQFGGIRGKF----FFLLYKIDWF 226
           +E+CN L+ D   NFD  W  +  S+       G   +   I   F    F+ +  I   
Sbjct: 180 SEVCNVLLADCQTNFDEIWAQLFESFSNYTVYPGFTVEGNDILRAFQDVQFYTVGSISHD 239

Query: 227 IISYLKPFLLKL-----SVEIHDSIHK-----NDDLLRLISSKQADEIPIVISNEKIKYL 276
            + YLK  + +L     S +  D +       N +LL+ I+ KQ D  P  I   KI Y 
Sbjct: 240 DLLYLKATVSELQGNFKSFDTADDLVTYIKTVNHNLLKCIALKQEDPAPDEIQGIKI-YA 298

Query: 277 PEDTLQIHSDDIYKFIESGDLYRNAIRYQSMERKPIYDLEDETTNA-IIPQKRSLANTSQ 335
            ++ +Q   D  +K + +     N  R ++      +  ED   N+ + P   S  NT+ 
Sbjct: 299 IKEIVQAILDGNFKNLPTHIGRSNTSRKRNFTDSISHYNEDAQRNSHVHPDNTSTLNTNT 358

Query: 336 --------------------PTDTSLESTKKKRVRRHKVEPLNSLSFFAGG--------- 366
                               PT      TK++R+ R  V+PL+SLSFFAGG         
Sbjct: 359 HATISAAAEASREGGESLEPPTVMGPSPTKRRRLVRRTVKPLDSLSFFAGGSTNPSTTLK 418

Query: 367 -ISPVPGTN--NEYNQSKVNGHLDSEISPDSASTTREQKIPGQSHTISTTRMEHALTDDN 423
            +SPV  +N  N  +  K N  ++S++  ++A   R+++   Q   + T     AL   +
Sbjct: 419 TVSPVVPSNASNTTSDEKPN-KVESKLGVNNAR--RDEQTNDQVDVVQT-----ALQSLS 470

Query: 424 SEPTIVQRSIA-EGI---SHRDQLIGNDEVVEDQHHLPDRK-KRDIHENTMY-------N 471
           S+PT   RSI  +GI    + D+++ N  +   + ++P +    D+  N +        N
Sbjct: 471 SQPT-TNRSIQNKGILRTENNDEMLTNASI--KRRNMPLKPLSPDVDTNLLIQPIDSNSN 527

Query: 472 NSYNGNKSLYGVENSLTQSNLLQSMGYEKSNNKTELSKKNAGGIMSTEKNLDAQRPNLKS 531
            S   N     +E++   SN L  +      N+  LS+K+  G    + +L         
Sbjct: 528 VSQETNVPKESMEDNDNSSNTLSEV------NRNILSRKSESGPHKFDVSL--------- 572

Query: 532 QTLNSLEDNDPKRTLQKRDIDIVKLVQTTKESEVKRLSSTIVKIEDSELTEEAINKLNDL 591
                      KR+  K     ++ VQ+TK  EVKR+ + IV +  SEL+EEAINKL++L
Sbjct: 573 ----------TKRS--KSPAAFIEAVQSTKTREVKRIRTKIVDVSPSELSEEAINKLSNL 620

Query: 592 VLVEPVADLIRTKSDISANNTTQQQWKNRKNFKKFVKICPKYKSEQSSIESMSRHIRGSG 651
            +VE   +LIR +     N++    WK R+NFKKF K+ P+++    S       +R + 
Sbjct: 621 TIVESNPNLIRERR-ADKNDSVNDMWKGRRNFKKFNKVWPQHRDGYDS-------LRNNA 672

Query: 652 EILTREFLQTKNVPVDYYNSHHDQNDF 678
            ++ R +++ K  P D   + +D +DF
Sbjct: 673 FLIIRNYVELK--PYDGKRNDNDSSDF 697

>Kpol_1016.5 s1016 (10036..12474) [2439 bp, 812 aa] {ON}
           (10036..12474) [2439 nt, 813 aa]
          Length = 812

 Score =  191 bits (485), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 213/801 (26%), Positives = 365/801 (45%), Gaps = 150/801 (18%)

Query: 1   MWVLRYSYVEETGEVKKVSCCIRQNVQYTIGRSSKNNLVIKNDKSISRQHVSLKWSSSKN 60
           MWVLRY Y  + G V+K+SCCIR    Y +GRSSKN L ++NDKSISRQ +S++W   K+
Sbjct: 1   MWVLRYQYSLDDGSVEKISCCIRNEETYYLGRSSKNQLSVRNDKSISRQQISIQWDRDKD 60

Query: 61  CIELTNTGKLTKSSEKYLGSNELITYSADETQIEMLLGVAPVKIILSRIDELFDIPNSLS 120
           CI + N GK+T   E+YL   E +++ +    + M +G  P+ + LS   +  +   +  
Sbjct: 61  CIMVKNLGKVTMVEERYLSDGETLSFQSKNDLVTMKIGTTPIVVNLSWEVKRCNYMKTDM 120

Query: 121 QFRETLETLGIQ-ISVDNAN----VNSTSLITVGDFGYRELFAACNDINIYSSGLLTEIC 175
                L++ G Q  +++N++    +    + T+ D  Y + ++  +D  + +S  L +I 
Sbjct: 121 DMVHLLQSYGFQPTTIENSHSLDMIIQNDVTTISD-KYLKCYSMIHDTILINSKTLRDIL 179

Query: 176 NKLVNDHDNFDAEWRSMQSSYHRNLDLEGL-LSQFG-GIRGKFFFLLYKIDWFIISYLKP 233
              +     FD+ W  + +S+  N+    + +++    ++G   FLL   + +   Y + 
Sbjct: 180 TNNIIMTKKFDSYWVKL-NSHESNIQNHTINVTKLAKSLKGMHMFLL-DPESYNCEYFEK 237

Query: 234 FLLKLSVEIHDSIHKNDDLLRLISSKQADEIPIVISNEKIKYLPEDTLQIHSDDIYKFI- 292
           FL ++       ++ ND    L +  +  E  +++S+ K++         +   + +FI 
Sbjct: 238 FLEEIGCIPRKFLNINDLETYLETQFKGGEF-LLLSSAKLE---------NQSRLERFIS 287

Query: 293 ---ESGDLYRNAIRY---QSMERKPIYDLEDETTNAIIPQKRSLA----NTSQPTDTSLE 342
              ES       +     QS+ R      ++E+ N I P  + +       + P   ++E
Sbjct: 288 IPLESFLDKLLFLDLDFGQSINRS-----KEESKNVIEPVLKEVGVEQTTEAVPISKNVE 342

Query: 343 ----STKKKRVRRHKVEPLNSLSFFAGGIS---------PVPGTNN-------EYNQSKV 382
                 KK+R+ R +V+PL+SL+FFAGG++         PV   NN       E  +S+ 
Sbjct: 343 IYEPQPKKRRLNRSRVKPLDSLNFFAGGVTSIGASQLPLPVEEANNITRKKDKEVIKSQG 402

Query: 383 NGHLDSEISPDSA------STTREQKIPGQ--SHTISTTRMEHALTDDNSEPTIVQRSIA 434
            G ++ E   D +      ST  E K P     H +   RM+ A+  D S   I +  + 
Sbjct: 403 KGEINIETEMDESGNGELLSTASEFKKPKSDVQHKLEK-RMQVAI--DRSPEKIKKPKLE 459

Query: 435 EGISHRDQLIGNDEVVEDQHHLPDRKKRDIHENTMYNNSYNGNKSLYGVENSLTQSNLLQ 494
           E IS              Q  L ++ K                        S T S L++
Sbjct: 460 ENISI-------------QQLLSNKVK----------------------STSDTSSVLIE 484

Query: 495 SMGYEKSNNKTELSKKNAGGIMSTEKNLDAQRPNLKSQTLNSLEDNDPKRTLQKRDIDIV 554
           +   ++SN K                    +   ++ +TL   +    +R +++  +D+V
Sbjct: 485 TQIAKESNTKA------------------IEYGKVRQKTLTDYKHTSDER-IERPSVDLV 525

Query: 555 KLVQTTKESEVKRLSSTIVKIEDSELTEEAINKLNDLVLVEPVADLIRTKS-DI---SAN 610
             +Q  KE E  R+ ++IV+I+++ELTEEAINK +DL +V+    L + KS DI   + +
Sbjct: 526 HAIQDIKERETLRVKTSIVEIKENELTEEAINKFSDLTVVDINTRLFKDKSLDINKPANS 585

Query: 611 NTTQQQWKNRKNFKKFVKICPKYKSEQSS---IESMSRHIRGSGEILTREFLQTKNVP-V 666
           N     W  +KNFKKFVK+ PKYK  Q +    +S S  IR S  ++TR F+  K    +
Sbjct: 586 NQNNMDWSGKKNFKKFVKMVPKYKRSQGNGQHADSCSTFIRNSAMLITRNFVPMKQYSKL 645

Query: 667 DYYNSHHDQNDFVD-EINTAPQANKSNSFVHQILPEIGDENENSFSFTRTXXXXXXXXXX 725
           D  ++ ++  DF + E+N  P      ++           +E SF+FTR           
Sbjct: 646 DNNSNSNEMTDFSNIEVNKKPVEKNREAYSSD-----DSVDEPSFTFTRN---------- 690

Query: 726 XXXXXXXQQLFVVDDDF-EDS 745
                  +QLFV+D+   EDS
Sbjct: 691 ----SSSKQLFVMDESINEDS 707

>NDAI0B05680 Chr2 complement(1384354..1386924) [2571 bp, 856 aa]
           {ON} Anc_5.435 YDR369C
          Length = 856

 Score =  187 bits (476), Expect = 7e-49,   Method: Compositional matrix adjust.
 Identities = 211/736 (28%), Positives = 329/736 (44%), Gaps = 104/736 (14%)

Query: 1   MWVLRYSYVEETGEVKKVSCCIRQNVQYTIGRSSKNNLVIKNDKSISRQHVSLKWSSSKN 60
           MW+LRY Y  E G +KKVS C+ +++ Y+IGRSSKN L IKNDKSISRQH+++KW  S  
Sbjct: 1   MWILRYQYGLEDGGIKKVSICLERSIAYSIGRSSKNPLSIKNDKSISRQHITIKWEPSGQ 60

Query: 61  CIELTNTGKLTKSSEKYLGSNE-LITYSADETQIEMLLGVAPVKIILSRIDELFDIPNSL 119
            + L N GKLT   E+YL  +E LI    D  ++++ LG  PV + +        IPN  
Sbjct: 61  -LHLVNQGKLTSVKERYLAIDESLIFNVVDTKELDVHLGTNPVIVQIRWQPMNLYIPNMY 119

Query: 120 SQFRETLETLGIQISVDNANVNS--TSLITVGDFGYRELFAACNDINIYSSGLLTEICNK 177
            QFR  L   GI+++ D    +S  T+++   +  Y  L A    I ++ S  LTE+ N 
Sbjct: 120 EQFRGLLTKYGIEVTSDILQEDSHITAVVMTPNDYYVPLLALALGIPVFKSQYLTEVSNM 179

Query: 178 LVNDHDNFDAEWRSMQSSYHRNLDLEGLLSQFGGIRGKFFFLLYKIDWFIISYL------ 231
           L  D+  FD + + + S     L     LS       K FF     D+F I  L      
Sbjct: 180 LRPDNITFDTDVQKINSMESLKLVPSFSLSN----NSKNFFQ----DYFFIITLNKSSVS 231

Query: 232 ----KPFLLKLSVE--------IHDSIHKNDDLLRLISSKQADEIPIVISNEKIKYLPED 279
               K F+L+ S++        I D     + + +++S+     I IV   +  K +  +
Sbjct: 232 EHADKSFILRKSLQLIGGEEEIIKDPTELQNSVTKILST-SGKNIVIVTDEDNGKRMIMN 290

Query: 280 TLQIHSDDIY-------------KFIESGDLYRNAIRYQSMERKPIYDLEDETTNAIIPQ 326
               +  DI+                E+G +   A      E+  +   E     AI  +
Sbjct: 291 FECRNVKDIFDSFVKNDPKLLKSNLTETGVVSPKAPEIFENEKLMVEIQEPPIEAAITEE 350

Query: 327 KRSLANT--SQPTDTSLESTKKKRVRRHKVEPLNSLSFFAGGISPVPGTNNEYNQSKVNG 384
             S  N   + P   +    KK+R+ R +V+PL SL FF GG +   GT  E + + +  
Sbjct: 351 STSSKNLKHTPPEPVTTHIVKKRRLARKRVKPLESLDFFVGGST--TGTPFETSSTTLQQ 408

Query: 385 HLDSEISPDSASTTREQKIPGQSHTISTTRMEHALTDDNSEPTIVQRSIAEGISHRDQLI 444
            +     PD A    EQ        I  +++  ++    +EP     SI  G S R +  
Sbjct: 409 EIIEPKVPDVAPILNEQ--------IQQSQVNKSI----NEPAKDIYSI--GGSDRKETA 454

Query: 445 GNDEVVEDQHHLPDRKKRDIHENTMYNNSYNGNKSLYGVENSLTQSNLLQSMGYEKSNNK 504
                  D+H     ++ D   +   + S +GN                 S   EK +N 
Sbjct: 455 ALTYATIDKHMQEPTQQIDDIPSQHIDISPHGN-----------------SNEQEKRSNS 497

Query: 505 TELSKKNAGGIMSTEKNLDAQRPNLKSQTLNSLEDNDPKRTLQKRDIDIVKLVQTTKESE 564
           +E S      + + EK  D +  N K+  +   ED+  KR  +     +V+ +Q  K  E
Sbjct: 498 SEKSPMITQQV-NDEK--DEKISNAKALKIGKREDS--KRYSETTPKSMVETIQDIKNRE 552

Query: 565 VKRLSSTIVKIEDSELTEEAINKLNDLVLVEPVADLI-RTKSDISANNTTQQQWKN---- 619
           V RL S+I  ++  ELTE+AIN+ ++L +VE  A LI RT+++ + N +T    ++    
Sbjct: 553 VTRLQSSIAHVDAEELTEDAINEFSNLAIVESNASLIRRTENNDNTNKSTNSVVRHDSPD 612

Query: 620 --------RKNFKKFVKICPKY------KSEQSSIESMSRHIRGSGEILTREFLQTKNVP 665
                   R+NFK+FVK+ PKY       + +      S  IR +  ++TR ++  K   
Sbjct: 613 NIMNVLEGRRNFKRFVKVYPKYIQNKNDSNNERGDNGASDFIRNNAFLITRNYVPLKQYS 672

Query: 666 VDYYNSHHDQNDFVDE 681
             Y +SH  +N F DE
Sbjct: 673 -KYDDSHGGKNGFNDE 687

>KLTH0F16038g Chr6 (1302028..1304406) [2379 bp, 792 aa] {ON} weakly
           similar to uniprot|P33301 Saccharomyces cerevisiae
           YDR369C XRS2 classified as an early recombination
           function required for DNA repair but dispensable for
           mitotic recombination (xrs2 is hyper-Rec during
           vegatative growth) required for double strand breaks
           meiotic recombination and spore viability DNA repair
           protein
          Length = 792

 Score =  179 bits (455), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 217/836 (25%), Positives = 358/836 (42%), Gaps = 145/836 (17%)

Query: 1   MWVLRYSYVEETGEVKKVSCCIRQNVQYTIGRSSKNNLVIKNDKSISRQHVSLKWSSSKN 60
           MW+LRY Y++ETG   +VSCC+++  QY +GRS K+ L IK DKSISR+HV L+   +  
Sbjct: 1   MWILRYQYIDETGSEIRVSCCLKKGTQYVVGRSVKSPLQIKGDKSISRKHVQLEVRQNSK 60

Query: 61  CIELTNTGKLTKSSEKYLGSNELITYSADETQIEMLLGVAPVKIILSRIDELFDIPNSLS 120
            +E+ N GKLTK     +  ++++ + AD++ + + +G  PVK  ++    ++ IP+ L+
Sbjct: 61  -LEVLNAGKLTKIGGDNVKMDQMLEFGADQS-VALEMGAGPVKGTVTYEPAIWKIPHDLA 118

Query: 121 ---QFRETLETLGIQISVDNANVNSTSLITVGDFGYRE---LFAACNDINIYSSGLLTEI 174
                +  L    IQ++  N+  + TS+  + +        LFA    I I   G + + 
Sbjct: 119 ITESLKNHLSLYDIQVT--NSLTSKTSVQIIKEHQKSHGNCLFALVKKIPIMCEGFIGDF 176

Query: 175 CNKLVNDHDNFDAEWRSMQSSYHRNLDLEGLLSQFGGIRGKFFFLLYKIDWFIISYLKPF 234
            ++  +   +FDA+W  +       L+L+   + F G+             F+++  K F
Sbjct: 177 VSQFADTQIDFDAKWEQITLKNAPFLELQTKDAAFKGLN------------FVVTNQKTF 224

Query: 235 LLKLSVEIHDSIHKNDDLLRLISS------KQADEIPIVISNEKIKYLPEDTLQIHSDDI 288
            +  S  I D+   N  L   +S+      KQ     +VI    + +L E+   + S+  
Sbjct: 225 AIYKS--IIDAGSGNLWLCGDVSNLGTFIEKQIKSENVVI----LIHLIEEAPALASEQN 278

Query: 289 YKF-IESGDLYRNAIRYQSMERKPIYDLEDET-TNAI------IPQKRSLANTSQP---- 336
               I+   L +N  R    + + + D+ D    N I      +PQ+++L   S      
Sbjct: 279 NSMHIQEAKLLKNKARSLGFKTRDVNDIVDAVLKNDILSLLDRVPQEKALEENSAGGSIA 338

Query: 337 ---------TDTSLESTKKKRVRRHKVEPLNSLSFFAGGIS----------PVPGTNNEY 377
                     D      K+KR  R +++PLNSL+FF GG S          P    N E 
Sbjct: 339 GSQVLADIVADAPNLRNKRKRANR-QIQPLNSLAFFGGGSSLSQKLEQVSTPAKEQNLEL 397

Query: 378 NQSKVNGHLDSEISPDSASTTREQKIPGQSHTISTTRMEHALTDDNSEPTIVQRSI---A 434
            Q  +  H + E+ P S     E+     +   STT          SE  I Q  +   +
Sbjct: 398 -QEGLGVHTNPEVHPLSKKPREEKNTLHSAGNNSTTTF--------SETPIHQEDVQIGS 448

Query: 435 EGISHRDQLIGNDEVVEDQHHLPDRKKRDIHENTMYNNSYNGNKSLYGVENSLTQSNLLQ 494
           E ++H              H +  ++    H +       N  K    V       N L+
Sbjct: 449 EPLNH-----------SAAHSVISKEDESTHTDERNKTLVNSAKDARTVTFPSIHKNELK 497

Query: 495 SMGYEKSNNKTELSKKNAGGIMSTEKNLDA-QRPNLKSQTLNSLEDNDPKRTLQKRDIDI 553
           S     +  K E      G I   +  + A +RP                R+L       
Sbjct: 498 SSRTLSNEAKVE------GNISHADTEVQAIKRP----------------RSL------- 528

Query: 554 VKLVQTTKESEVKRLSSTIVKIEDSELTEEAINKLNDLVLVEPVADLIRTKSDISANNT- 612
           ++  Q  K+ EV RL   +  +   ELTEEAINKL++L  VE V DL+R  S++  N+  
Sbjct: 529 IQAFQEAKQHEVHRLKKNMADVGSEELTEEAINKLDNLASVEKV-DLMRRPSEVPENSNQ 587

Query: 613 ---TQQQWKNRKNFKKFVKICPKYKSEQSSIESMSRHIRGSGEILTREFLQTKNVPVDYY 669
              T  QW  RKNFKKFVK+ P + S +SS ++++  +R    ++TR+++     P D  
Sbjct: 588 RILTNPQWARRKNFKKFVKLWPSHSS-RSSPDNITDAVRNKAYLITRDYVSL--CPYDGT 644

Query: 670 NSHHDQNDFVDEIN---TAPQANKSNSFVHQILPEIGDENENSFSFTRTXXXXXXXXX-- 724
            ++   + F D       A Q+N + S  +  L  +  EN  +F+F              
Sbjct: 645 RNNSADDGFGDACQQHAAAEQSNLTASPGNLALLGVEVENGPAFAFQSQRAANSQANSLF 704

Query: 725 --------XXXXXXXXQQLFVVDDDFEDSQ-DVGHLLNKADTTEPPQQLQDHEDTM 771
                           Q+LFVVD+D  DSQ  V    N  + ++ P +L+D + ++
Sbjct: 705 NETDNRRVEERSPERNQELFVVDED--DSQPQVACYSN--NVSQVPSRLEDADQSL 756

>Suva_2.541 Chr2 complement(965557..968166) [2610 bp, 869 aa] {ON}
           YDR369C (REAL)
          Length = 869

 Score =  150 bits (379), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 121/410 (29%), Positives = 199/410 (48%), Gaps = 65/410 (15%)

Query: 1   MWVLRYSYVEETGEVKKVSCCIRQNVQYTIGRSSKNNLVIKNDKSISRQHVSLKW----- 55
           MWV+RY  + E G +  +SCC++ +  Y+IGRSSKN LVIKNDKSISRQHV+ KW     
Sbjct: 1   MWVIRYQNILEDGSINSISCCLQASKSYSIGRSSKNELVIKNDKSISRQHVTFKWEINDS 60

Query: 56  -SSSKNCIELTNTGKLTKSSEKYL--GSNELITYSADETQIEMLLGVAPVKIILSRIDEL 112
            +   N + L N GKLT  ++K++  G    I+ +      E+ LG  P++I    IDE+
Sbjct: 61  LNPKGNKLSLVNQGKLTSINKKFMKVGETSTISVTKVSNHTEIELGTTPIRIKFEWIDEI 120

Query: 113 FDIPNSLSQFRETLETLGI----QISVDNANVNSTSLITVGDFGYRELFAACNDINIYSS 168
           ++IP++L+QF+  L   GI     I  D+A++  +   +  D G REL+A  + I +  S
Sbjct: 121 WNIPSNLAQFQTILSQFGIATKTSIDDDSASILISDFPSNNDDGMRELYALVHTIPLKKS 180

Query: 169 GLLTEICNKLVND---HDNFDAEWRSMQSSYHRNLDLEGLLSQFGGIRGKFFFLLYKIDW 225
            LL ++CN L++    +  FD  W +M +        + L   F       F    ++D 
Sbjct: 181 QLLVDLCNSLLSSSVMNLKFDETWNNMVN--------KPLFKVFDYDPSVLFSKFMRLDN 232

Query: 226 FII-------SYLKPFLLKLSVEIH-----DSIHKNDDLLR--------LISSKQADEIP 265
            I        S L   L +L+V +      + ++K+ DLL+          ++K+ +   
Sbjct: 233 VITLTTIGNESGLPNILRRLNVRLFHFDCLNDLYKHVDLLKPSEKYLILTFTNKRENGQK 292

Query: 266 IVISNEKIKYLPEDTLQ--IHSDDIYKFIESGDLYRNAIRYQSMERKPIYDLEDETTNAI 323
           +      I  + +DTL   I++  +   ++  +         +   K ++  E E T A+
Sbjct: 293 LCTLQNLITSIIDDTLPSVINTKAVPFEVQENNTPEKVFEGHTAISKTVHTPETEATPAV 352

Query: 324 IPQKRSLANTSQPTDTSLESTKKKRVRRHKVEPLNSLSFFAGGISPVPGT 373
                                KK+R+ R +V+PL+SL+FFAGG+S  P +
Sbjct: 353 --------------------LKKRRLNRRRVQPLDSLNFFAGGLSADPSS 382

>YDR369C Chr4 complement(1215016..1217580) [2565 bp, 854 aa] {ON}
           XRS2Protein required for DNA repair; component of the
           Mre11 complex, which is involved in double strand
           breaks, meiotic recombination, telomere maintenance, and
           checkpoint signaling
          Length = 854

 Score =  146 bits (368), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 123/392 (31%), Positives = 194/392 (49%), Gaps = 39/392 (9%)

Query: 1   MWVLRYSYVEETGEVKKVSCCIRQNVQYTIGRSSKNNLVIKNDKSISRQHVSLKWSSSK- 59
           MWV+RY    E G +  +SCC++    Y+IGRSSKN L+IKNDKSISRQH++ KW  +  
Sbjct: 1   MWVVRYQNTLEDGSISFISCCLQAFKTYSIGRSSKNPLIIKNDKSISRQHITFKWEINNS 60

Query: 60  -----NCIELTNTGKLTKSSEKYLGSNELITYSADE----TQIEMLLGVAPVKIILSRID 110
                + + L N GKLT  ++K++   E  T +A +    T IE  LG  P++I    I+
Sbjct: 61  SDLKHSSLCLVNKGKLTSLNKKFMKVGETFTINASDVLKSTIIE--LGTTPIRIEFEWIN 118

Query: 111 ELFDIPNSLSQFRETLETLGI--QISVDN--ANVNSTSLITVGDFGYRELFAACNDINIY 166
           E+++IP  L+QFR  L   GI  +IS+++  AN+  +      D   REL+A  + I + 
Sbjct: 119 EVWNIPPHLTQFRTMLSEYGISTEISINDIPANLMISDYPKSEDNSIRELYALVSTIPMK 178

Query: 167 SSGLLTEICNKLVNDHDN---FDAEWRSMQSSYHRNL---DLEGLLSQFGGIRGKFFFLL 220
            S  L E+CN L+        FD  W  M S+   N+   D   LLS+F  +        
Sbjct: 179 KSRFLMELCNTLLPTSKTNLKFDEMWNDMISNPEYNVFDFDPNILLSKFMRLNNIRVLTT 238

Query: 221 YKIDWFIISYLKPFLLKLSVEIHDSIHKNDDLLRLISSKQADEIPIVISN----EKIKYL 276
            K +  + S L+ F + L     D+I   D L + + S +A    ++++     E  K L
Sbjct: 239 IKSEPRLSSLLRTFNINLFA--FDNI---DSLYKYVDSLEASTEYLILTTTDKKENGKIL 293

Query: 277 PEDTLQIHSDDIYKFIESGDLYRNAIRYQSMERKPIYDLEDETTNAIIPQKRSLANTSQP 336
              T++     I     S  +       ++++    +D   E  + I+   R+    + P
Sbjct: 294 C--TIKTMLTSIIDGTLSAVINMKGASSRTLDNGK-FDQISEGMSTILKTSRAPEVEASP 350

Query: 337 TDTSLESTKKKRVRRHKVEPLNSLSFFAGGIS 368
                  +KK+++ R +V PL+SL FFAGG+S
Sbjct: 351 V-----VSKKRKLNRRRVLPLDSLDFFAGGLS 377

 Score = 83.2 bits (204), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 54/129 (41%), Positives = 76/129 (58%), Gaps = 15/129 (11%)

Query: 553 IVKLVQTTKESEVKRLSSTIVKIEDSELTEEAINKLNDLVLVEPVADLIRTKSDISANNT 612
            V+ +Q TK  EVKR+ STIV+++D EL+EEAIN+L +L +VEP  +L+R   D   N T
Sbjct: 559 FVEAIQETKNREVKRVKSTIVELKDEELSEEAINQLKNLAIVEPSNNLLRKSFDSEGNKT 618

Query: 613 --TQQQWKN---------RKNFKKFVKICPKYKSEQSSIESMSRHIRGSGEILTREFLQT 661
             T ++W+N         RKNFK FVK+ PK K+ +   E    + + S  I    FL T
Sbjct: 619 SRTTEKWENSLMEPEWHKRKNFKTFVKVRPKSKAHK---EEGKNNTQSSDFIRNAAFLIT 675

Query: 662 KN-VPVDYY 669
           +N VP+  Y
Sbjct: 676 RNYVPLKKY 684

>Skud_4.638 Chr4 complement(1137885..1140416) [2532 bp, 843 aa] {ON}
           YDR369C (REAL)
          Length = 843

 Score =  136 bits (342), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 82/231 (35%), Positives = 130/231 (56%), Gaps = 26/231 (11%)

Query: 1   MWVLRYSYVEETGEVKKVSCCIRQNVQYTIGRSSKNNLVIKNDKSISRQHVSLKWSSSKN 60
           MWV+RY    E G +  +SCC++ +  Y+IGRSSKN+L+IKNDKSISRQH++ KW  +  
Sbjct: 1   MWVIRYQNTVEDGHISHISCCLQASKSYSIGRSSKNSLIIKNDKSISRQHITFKWEINGG 60

Query: 61  C------IELTNTGKLTKSSEKYLGSNE-LITYSADETQIEML-LGVAPVKIILSRIDEL 112
                  + L N GKLT  ++K+L   E  I Y+ + + +  + LG +P  I ++ + E+
Sbjct: 61  LNLKASHLSLINQGKLTSINKKFLKVGEKFIIYAPEVSNLTTIELGTSPFHIEVAWVSEI 120

Query: 113 FDIPNSLSQFRETLETLGI--QISVDNANVNSTSLITVGDF------GYRELFAACNDIN 164
           ++IP+ L++FR TL   GI  + S+D+  +N    + + DF      G REL+A  N I 
Sbjct: 121 WNIPSHLTEFRTTLSQFGISTESSIDDGPIN----LMISDFPSSDDNGMRELYALVNAIP 176

Query: 165 IYSSGLLTEICNKLVND---HDNFDAEWRSMQSSYHRNL---DLEGLLSQF 209
           +    LL ++C  L+     +  FD  W+ + +S   N+   D   L S+F
Sbjct: 177 LKKLRLLVDVCKTLLPASVRNLKFDEMWKDVLNSPEFNVFNFDASVLSSKF 227

 Score = 92.8 bits (229), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 77/239 (32%), Positives = 115/239 (48%), Gaps = 52/239 (21%)

Query: 543 KRTLQKRD----IDIVKLVQTTKESEVKRLSSTIVKIEDSELTEEAINKLNDLVLVEPVA 598
           K  LQKR     +  V+ +Q TK  EV+R  STIV++ED EL+EE IN+L +L +VEP  
Sbjct: 537 KELLQKRKSNTPLSFVEAIQETKNREVERFKSTIVQLEDDELSEEGINQLKNLAIVEPNE 596

Query: 599 DL-----------IRTKSDISANNTTQQQWKNRKNFKKFVKICPKYKSEQSSIESMSRHI 647
           DL           +RT++  + +   +Q+W  RKNFK F+K+ PK+K +    E      
Sbjct: 597 DLLRKPQILGTNSVRTRAQKNESGIMRQEWHERKNFKTFIKVWPKFKMQN---EGNKGDT 653

Query: 648 RGSGEILTREFLQTKN-VPVDYYNSHH--------DQNDFVDEI-------NTAPQANKS 691
           + S  I +  FL T+N VP+  Y+ ++        +  D +  I       NT    N S
Sbjct: 654 QNSDFIRSAAFLITRNYVPLRKYSKNNKATECNGKENEDMLGLIEMENLVSNTGVSGNTS 713

Query: 692 NSFVHQ--------ILPEIGDE-NENSFSFTRTXXXXXXXXXXXXXXXXXQQLFVVDDD 741
           ++ + Q        I  +I DE N+ SFSF+R                   +LFV +DD
Sbjct: 714 SAVIQQGPRTQNTFINEDISDEGNQQSFSFSR---------HSDIAQPAKNKLFVTEDD 763

>Smik_4.635 Chr4 complement(1135040..1137631) [2592 bp, 863 aa] {ON}
           YDR369C (REAL)
          Length = 863

 Score =  129 bits (325), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 125/406 (30%), Positives = 202/406 (49%), Gaps = 69/406 (16%)

Query: 1   MWVLRYSYVEETGEVKKVSCCIRQNVQYTIGRSSKNNLVIKNDKSISRQHVSLKWSSSK- 59
           MWV+RY  + E G +  +SCC++ +  Y+IGRSSKN L+IK+DKSISRQH++LKW S+  
Sbjct: 1   MWVVRYQNILEDGTISVISCCLQASKSYSIGRSSKNPLIIKHDKSISRQHITLKWQSNSG 60

Query: 60  -----NCIELTNTGKLTKSSEKYLGSNELITYSA----DETQIEMLLGVAPVKIILSRID 110
                N + L N GKLT  + K++   E     A    + T IE  LG  P++I +   +
Sbjct: 61  SDSNHNSLCLINQGKLTSINNKFMKVGETFIIEALGVSNSTFIE--LGATPIRIEVEWKN 118

Query: 111 ELFDIPNSLSQFRETLETLGI--QISVDNANVNSTSLITVGDFG------YRELFAACND 162
           ++++IP+ L+QFR  L   GI  + S++    N    I + D+        REL A   +
Sbjct: 119 QVWNIPSHLAQFRTALSQFGISTETSINEVPTN----IMISDYPSSDDNVIRELCALAEN 174

Query: 163 INIYSSGLLTEICNKLVNDHD---NFDAEWRSMQSS-----YHRNLDLEGLLSQFGGIRG 214
           I +  S LL ++CN L++       FD  W  +  S     +  N DL  L S+F  +  
Sbjct: 175 IPLKKSQLLVKLCNTLLSASITDLTFDERWNDIVKSPEYDVFDANPDL--LFSKFMKLSD 232

Query: 215 KFFFLLYKIDWFIISYLKPFLLKL--SVEIHDSIHKNDDLLR------LISSKQADEIPI 266
                    + ++ S L+ F +KL   V+I +S++K+ D L+      +++S    E   
Sbjct: 233 ITILTTISNEPYLPSILRRFNIKLFDFVDI-NSLYKHVDSLKPSTKYLILTSMNKKENGQ 291

Query: 267 VISNEK--IKYLPEDTLQIHSDDIYKFIESGDLYRNAIRYQSMERKPIYDLEDETTNAII 324
           ++   K  +  L +DTL                  + I  +S+     ++  +  T    
Sbjct: 292 ILCTTKCLLTSLIKDTLA-----------------SVINTKSVS----FEAPNNETPVRD 330

Query: 325 PQKRSLANT---SQPTDTSLESTKKKRVRRHKVEPLNSLSFFAGGI 367
           P+K S A+    +  T+ S    KK+R+ R +V PL+SL+FFAGG+
Sbjct: 331 PEKLSSASKIHHTIETEASPVILKKRRLNRRRVLPLDSLNFFAGGL 376

 Score = 72.8 bits (177), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 52/132 (39%), Positives = 77/132 (58%), Gaps = 19/132 (14%)

Query: 553 IVKLVQTTKESEVKRLSSTIVKIEDSELTEEAINKLNDLVLVEPVADLIRTKSDI----- 607
            V+ +Q TK+ EVKR+ STIV++ED EL+EEAIN+L  L +VE   DL+R   D      
Sbjct: 555 FVQAIQQTKKREVKRVKSTIVELEDDELSEEAINQLERLAIVEANNDLLRKLPDYRLNTV 614

Query: 608 ------SANNTTQQQWKNRKNFKKFVKICPKYKSEQSSIES---MSRHIRGSGEILTREF 658
                   N   +Q+W+ RKNFK FVK  PK+K+++   ++    S  IRG+  ++TR +
Sbjct: 615 SSSTEKGGNGVIRQEWQRRKNFKTFVKAWPKFKAQKEGSKNDTQKSDFIRGAAFLITRNY 674

Query: 659 LQTKNVPVDYYN 670
                VP+  Y+
Sbjct: 675 -----VPLKKYS 681

>ZYRO0F10054g Chr6 complement(814872..816854) [1983 bp, 660 aa] {ON}
           weakly similar to uniprot|P33301 Saccharomyces
           cerevisiae YDR369C XRS2 classified as an early
           recombination function required for DNA repair but
           dispensable for mitotic recombination (xrs2 is hyper-Rec
           during vegatative growth) required for double strand
           breaks meiotic recombination and spore viability DNA
           repair protein
          Length = 660

 Score =  127 bits (319), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 71/191 (37%), Positives = 103/191 (53%), Gaps = 4/191 (2%)

Query: 1   MWVLRYSYVEETGEVKKVSCCIRQNVQYTIGRSSKNNLVIKNDKSISRQHVSLKWSSSKN 60
           MW+LRY Y  E G +K VSCC+R    Y IGRSSKN L IKNDKSISRQHVS+ W     
Sbjct: 1   MWILRYQYDLEDGNLKHVSCCLRLGETYNIGRSSKNLLNIKNDKSISRQHVSICWDGKDR 60

Query: 61  CIELTNTGKLTKSSEKYLGSNELITYSADETQIEMLLGVAPVKIILSRIDELFDIPNSLS 120
            ++L N GK+T  SEKYL   E I++      + + LG  P+K+ L  +D ++ +P    
Sbjct: 61  QLKLINQGKMTAVSEKYLKMGESISFGKSMGTVLVELGTKPLKMQLQWMDSIWMVPQGSR 120

Query: 121 QFRETLETLGIQISVDNANVNSTSLITVGDFG--YRELFAACNDINIYSSGLLTEICNKL 178
                LE LGI++   ++ ++  +LI + +     R L+     I + +   L  +  K+
Sbjct: 121 SDHSALEELGIEVL--SSELSRANLIVIDEQQNYSRWLYGLVKRIPLMNLEFLNVVSQKV 178

Query: 179 VNDHDNFDAEW 189
                 FD+ W
Sbjct: 179 SGHETEFDSIW 189

 Score = 96.7 bits (239), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 69/199 (34%), Positives = 102/199 (51%), Gaps = 37/199 (18%)

Query: 552 DIVKLVQTTKESEVKRLSSTIVKIEDSELTEEAINKLNDLVLVEPVADLIRTKSDISANN 611
           D+++++Q TK  EVKRL+STI+++ D ELTE+AIN+L +LVLV+   +L+R +      +
Sbjct: 459 DMIQMIQDTKNHEVKRLNSTIIQVGDEELTEDAINQLGNLVLVDRNDNLMRRRDRSPTVD 518

Query: 612 TTQQQWKNRKNFKKFVKICPKYKSEQS-SIESMSRHIRGSGEILTREFLQTKNVPVDYYN 670
           +    W NRKNFK FVK+ PKY  + S S E  S  IR    +LTR+++ T+       +
Sbjct: 519 SHNPNWNNRKNFKNFVKVWPKYGGQDSTSREGSSDTIRNRAFLLTRQYVPTRTY-TSGDS 577

Query: 671 SHHDQNDFVDEINTAPQANKSNSFVHQILPEIGDENENSFSFTRTXXXXXXXXXXXXXXX 730
           S   Q D  D     P+A        Q +P++     N+                     
Sbjct: 578 SKQAQEDLYDFPEPQPEA--------QSVPQVEAPGPNN--------------------- 608

Query: 731 XXQQLFVVDDDFEDSQDVG 749
               LFV+D+D  DSQDV 
Sbjct: 609 ----LFVMDED--DSQDVA 621

 Score = 37.4 bits (85), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 16/25 (64%), Positives = 21/25 (84%)

Query: 344 TKKKRVRRHKVEPLNSLSFFAGGIS 368
           TKK+R+ R +V+PL+ LSFFAGG S
Sbjct: 317 TKKRRLNRPRVKPLDILSFFAGGDS 341

>TBLA0A02820 Chr1 (678796..681573) [2778 bp, 925 aa] {ON} Anc_5.435
           YDR369C
          Length = 925

 Score =  117 bits (293), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 108/414 (26%), Positives = 201/414 (48%), Gaps = 60/414 (14%)

Query: 1   MWVLRYSYVEETGEVKKVSCCIRQNVQYTIGRSSKNNLVIKNDKSISRQHVSLKWSS-SK 59
           MW++ YSY      +  VSCC++QN  Y+IGRS K+ L +KNDKSISRQHV+  W+    
Sbjct: 1   MWIISYSYKSADDTLTNVSCCLKQNETYSIGRSKKSPLFVKNDKSISRQHVTFHWTGNLN 60

Query: 60  NCIELTNTGKLTKSSEKYLGSNELITYSAD-ETQIEMLLGVAPVKIILSRIDELFDIPNS 118
           N + L N GKLT+ + + L   E + ++AD E   E+ LG  PV +  +  + +++IP  
Sbjct: 61  NQLSLLNQGKLTRVNSRILNPAETLLFNADIEHPAEVELGATPVVVCGAWTNHVYNIPIE 120

Query: 119 LSQFRETLETLGIQISVDNANVNSTSLITVGDFGYREL----------FAACNDINIYSS 168
             QF   L+  G  I+       + ++  V D   R +          ++  N   I  S
Sbjct: 121 FQQFESQLKDYGFNINF--GPQKNEAITYVIDIEPRPMNNNFISGTLYYSLVNKSIILKS 178

Query: 169 GLLTEICNKLVNDHDNFDAEWRSMQSSY----HRNLDLEGLLSQFGGIRGKFFFLLYKID 224
             LT + N L  +   F+ +++++  +      RN++LE L  +  GI+     ++   +
Sbjct: 179 SFLTSLLNLLNPNVTTFNIDFQNLLDASKIEDFRNINLESLKVELTGIK----LIVLNDN 234

Query: 225 WFIISYLKPFLLKLSVEIHDSIHKNDDLLRLISSK-QADEIPIVISNEKIKYLPEDTLQI 283
              + Y   F+  + V    +I   DD + + + K  ++E  I+++    +++  +T+++
Sbjct: 235 TTDLIY---FIAAMEVINLPTITTEDDTIFINTVKSHSEERLILLTTSNSRHI--ETIKV 289

Query: 284 HS-DDIYKFIESGDLYR----------NAIRYQSMERKPIYDLEDETTNAIIP--QKRSL 330
           H+  D Y+ I++ ++            + I   S E   + + E++T + + P  +  + 
Sbjct: 290 HTFKDFYQGIKNQNINHLIQVIKKDSPHTIERNSRETISLNN-ENQTYSQLSPYIEDNNK 348

Query: 331 ANTSQPTDTSLEST------------------KKKRVRRHKVEPLNSLSFFAGG 366
            N++  +D+ L+ T                  K++R+ R +V+PL+SL FF GG
Sbjct: 349 VNSNTISDSLLKQTSELIKPSVNDHAPEKPPVKRRRLNRKRVQPLDSLHFFVGG 402

>TPHA0J02590 Chr10 complement(574619..576946) [2328 bp, 775 aa] {ON}
           Anc_5.435 YDR369C
          Length = 775

 Score =  115 bits (287), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 191/696 (27%), Positives = 318/696 (45%), Gaps = 144/696 (20%)

Query: 1   MWVLRYSYVEETGEVKKVSCCIRQNVQYTIGRSSKNNLVIKNDKSISRQHVSLKW---SS 57
           M +LRY  V   G V  VSCC+  +V+Y IGRSSKN   IKNDKSISRQHVSL W   S 
Sbjct: 1   MIILRYKNVLADGPVNVVSCCLLCDVEYAIGRSSKNKFAIKNDKSISRQHVSLLWKYSSD 60

Query: 58  SKNC-IELTNTGKLTKSSEKYLGSNELITYSADETQIEMLLGVAPVKIILSRIDELFD-- 114
            KN  I++ N GK+T   +KYL  +E + ++  + ++E+ +G +P+ +      E+F+  
Sbjct: 61  DKNVIIQIKNFGKVTMIKDKYLSQDETLQFTLIDKKLEVNIGTSPITL------EIFNQE 114

Query: 115 -IPNSLSQFRETLETLGIQISVDNANVNSTSLITVGDFG-------------YRELFAAC 160
            + NS+    E ++    ++ ++N N+     +T+   G               ELF+  
Sbjct: 115 VVCNSI----EDIQNSDSKLILNNLNILQDDPLTLKREGPTIIIKENSYTDILLELFSNV 170

Query: 161 NDINIYSSGLLTEICNKLVNDHDNFDAEWRSMQSSYHRNLDLEGLLSQFGGIRGKFFFLL 220
             I I +   L  I N   ND   F + W  +   Y R  +           +GK   L 
Sbjct: 171 FGIPIVTIEELRGIAN--AND---FYSYWDKI---YSRKKN-----------KGKACMLD 211

Query: 221 YKIDWFI------ISYLKPFLLKLSVEIHDSIHKNDDLLRLIS---SKQADEIPIVISNE 271
               ++I      + Y+K  +  L+ EI   +   DDL++ I    SK       V+SN+
Sbjct: 212 LSTCYYISEVDKYVDYVKVAIRSLNAEIK-ILKDKDDLVKDIRKNISKGNISKFFVLSND 270

Query: 272 KIKYLPEDTLQIHSDDIYKFIESGDLYRNAIRYQSMERKPIYDLEDETTNAIIPQKRSLA 331
            I    E    I    I K +E       A++  +M+   ++D    +    IP++    
Sbjct: 271 -ITQGEEAPFNISVTSIAKLLE-------AVKTNNMKDIVMHDY--SSFKIEIPRE---- 316

Query: 332 NTSQPTDTSL------ESTKKKRVRRHKVEPLNSLSFFAGGISPVPGTNNEYNQSKVNGH 385
               P D ++       + K++R+ R KV+PL++LSFFAGG+S    + N    + V  H
Sbjct: 317 -VKSPKDDNIIEKQEPPAPKRRRMNRSKVKPLDTLSFFAGGMSHDTHSINTKPSNDVQSH 375

Query: 386 LDSEISPDSASTTREQKIPGQSHTISTTRMEHALTDDNSEPTIVQRSIAEGISHRDQLIG 445
            ++E   +++     Q +         +  +    D ++E   +Q+S A   +  D+L  
Sbjct: 376 QETEKDVNNSKIESIQDV--------ESNQDQTKYDKSTE---LQKSKAVSKNADDKL-- 422

Query: 446 NDEVVEDQHHLPDRKKRDIHEN-TMYNNSYNGNKSLYGVENSLTQSNLLQSMGYEKSNNK 504
            D   E          + I+ N T    S++ + +   +ENS   +NL  +M       K
Sbjct: 423 QDSTAE----------KPINFNPTTKTPSFSPSINDKAIENS--NANLDPTME------K 464

Query: 505 TELSKKNAGGIMSTEKNLDAQRPNLKSQTLN---SLEDNDP-----KRTL-------QKR 549
           T ++KK A   + T+ NL   +  L ++ +N   S + ND      +RTL       +  
Sbjct: 465 TRVNKKPAS--LDTKNNLLDNK--LIAEQINEALSAKTNDAPVVRRRRTLLDYGNTDKSS 520

Query: 550 DIDIVKLVQTTKESEVKRLSSTIVKIEDSELTEEAINK--------LND-LVLVEPVADL 600
             D+V+ +Q  K   V R++S IV ++++EL EE +NK        +ND L+   P A  
Sbjct: 521 STDLVRTIQNVKSRGVDRVNSKIVTVDENELNEEELNKFFDVVVVDVNDKLMKKHPNAQK 580

Query: 601 IRTKSDISANNTTQQQWKNRKNFKKFVKICPKYKSE 636
           +   ++I  N      +KNRK++K F K  PK++S+
Sbjct: 581 VIDNANIDHN----SNFKNRKDYKLFKKSIPKWQSK 612

>Kwal_55.21422 s55 (830578..832926) [2349 bp, 782 aa] {ON} YDR369C
           (XRS2) - DNA repair protein [contig 130] FULL
          Length = 782

 Score =  115 bits (287), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 69/196 (35%), Positives = 108/196 (55%), Gaps = 6/196 (3%)

Query: 1   MWVLRYSYVEETGEVKKVSCCIRQNVQYTIGRSSKNNLVIKNDKSISRQHVSLKWSSSKN 60
           MW+LRY YV   G    VSCC++Q +QY+IGRS+KN L IK+DKSISR HV L+   S N
Sbjct: 1   MWILRYQYVAGNGMDVHVSCCLKQGLQYSIGRSTKNPLQIKSDKSISRNHVELEVDQSCN 60

Query: 61  CIELTNTGKLTKSSEKYLGSNELITYSADETQIEMLLGVAPVKIILSRIDELFDIPNSLS 120
            + L   GKLTK S K + + + + ++ADE ++   +G +P+K  + +    + IP+ LS
Sbjct: 61  VV-LRVVGKLTKVSGKSVKAGQHLQFTADE-EVLFEMGASPIKATVVKQQSFWKIPHDLS 118

Query: 121 QFRETLETLG-IQISVDNANVNSTSLITVGDFG---YRELFAACNDINIYSSGLLTEICN 176
             +     L    I V N+  ++TS+  + D        LF+   +I I     + +   
Sbjct: 119 LSQSLSRHLADFDIQVTNSLSSTTSIQIIKDSSKSFSNCLFSLIKNIPILREHFIGDFVT 178

Query: 177 KLVNDHDNFDAEWRSM 192
           ++ + H +FD+ W  M
Sbjct: 179 QINDVHADFDSRWDRM 194

 Score = 90.5 bits (223), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 101/387 (26%), Positives = 165/387 (42%), Gaps = 73/387 (18%)

Query: 307 MERKPIYDLEDETTNAIIPQKRSLANTSQPTDTSLESTKKKRVRRHKVEPLNSLSFFAGG 366
           +ER P+ +L  +       ++ +  +  +  DT   S K+KR  R +V PL+SL+FF GG
Sbjct: 320 LERVPVRNLPSKAPTGFPLEEATNKSVIKSADTPKPSNKRKRTNR-QVVPLDSLAFFGGG 378

Query: 367 IS----------PVPGTNNEYNQSKVNGHLDSEISPDSA--STTREQKIPGQSHTISTTR 414
            +          P     +E +Q+      + E SP  A     R+  IP     +S  R
Sbjct: 379 SAAESKQNPTEVPESERGHETSQNTTTEFAEGEPSPKKARIGALRKPDIP----NVSEER 434

Query: 415 MEHALTDDNSEPTIVQRSIAEGISHRDQLIGNDEVVEDQHHLPDRKKRDIHENTMYNNSY 474
           ++        EP +  RS        D  I    +V+     P R ++ +  +  +    
Sbjct: 435 VK--------EPVVQTRSKRASERSADTSI----LVQAN---PKRSRKTLQASEGHTILE 479

Query: 475 NGNKSLYGVENSLTQSNLLQSMGYEKSNNKTELSKKNAGGIMSTEKNLDAQRPNLKSQTL 534
           N N SL  +E+           G       T L  + A       +  +A+RP       
Sbjct: 480 NDNNSL-NIES-----------GPLPKTKSTSLGNEAAQAQADAVQTREAKRP------- 520

Query: 535 NSLEDNDPKRTLQKRDIDIVKLVQTTKESEVKRLSSTIVKIEDSELTEEAINKLNDLVLV 594
                           +   + V+ TK  EV RL   IV +   ELTEEAINKL+ L LV
Sbjct: 521 ----------------VSFAQAVKETKSHEVDRLEKDIVNVTSEELTEEAINKLDKLALV 564

Query: 595 EPVADLIRTKSD--ISANNTTQQQWKNRKNFKKFVKICPKYKSEQSSIESMSRHIRGSGE 652
           E   DL+R   +  +   +   +QW  RKNFKKFVK+ P  +S ++S +S +  +R    
Sbjct: 565 E-TKDLMRADREYAVCGQSGGSEQWAGRKNFKKFVKLWPS-RSSRNSPDSATNALRNRAH 622

Query: 653 ILTREFLQTKNVPVDYYNSHHDQNDFV 679
           ++TRE++  +  P +  N+++  + F+
Sbjct: 623 LITREYVPLR--PYEGQNANNQDDSFL 647

>SAKL0G02552g Chr7 complement(209978..212482) [2505 bp, 834 aa] {ON}
           weakly similar to uniprot|P33301 Saccharomyces
           cerevisiae YDR369C XRS2 classified as an early
           recombination function required for DNA repair but
           dispensable for mitotic recombination (xrs2 is hyper-Rec
           during vegatative growth) required for double strand
           breaks meiotic recombination and spore viability DNA
           repair protein
          Length = 834

 Score =  108 bits (270), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 111/414 (26%), Positives = 189/414 (45%), Gaps = 55/414 (13%)

Query: 1   MWVLRYSYVEETGEVKKVSCCIRQNVQYTIGRSSKNNLVIKNDKSISRQHVSLKWSSSKN 60
           MW+LRY Y  E G    +SCC++Q + Y IGRS+K+ L IKNDKSISR+H+ LK  + +N
Sbjct: 1   MWILRYRYDTEDGNWCSISCCLKQGLIYDIGRSTKSPLHIKNDKSISRKHIQLK-VNKEN 59

Query: 61  CIELTNTGKLTKSSEKYLGSNELITYSADETQIEMLLGVAPVKIILSRIDELFDIPNSL- 119
            + L NTGKLT  + + L  ++ + +   + Q+ + LG+ P+   +   D+++ + + L 
Sbjct: 60  ELNLLNTGKLTTLNAEVLMVDQSLNFHP-KGQLRLELGIKPIIATIEWQDQVWKVSHDLL 118

Query: 120 --SQF-RETLETLGIQISVDNANVNSTSLITVGDFGYRE-LFAACNDINIYSSGLLTEIC 175
             S F R+   + GI ++   +   +  +I      Y   LF+    I+I     L++  
Sbjct: 119 YNSMFKRQEFNSYGISVTTTMSTRTNLQIIKQNQDTYSNCLFSLVKGIDIVRESFLSDFQ 178

Query: 176 NKLVNDHDNFDAEWRSMQSSYHRNLDLEGLLSQFGGI----RGKFFFLLYKIDWFIISYL 231
           + L     ++D  W+++   +    +    +S F  I      K  + L+K   + I   
Sbjct: 179 SHLYMTPTDYDGIWKNLLQKHMVFPNFTTCVSIFQNISIIVASKSIYNLFK---YTIEVA 235

Query: 232 KPFLL------KLSVEIHDSIHKNDD-LLRLISSKQA--DEIPIVISNEKIKYLPEDTLQ 282
              LL      K    I ++ H  D  +L+ I+      D+   +  +E  + L E  L+
Sbjct: 236 GGELLYCENMEKFEQFIQEAAHSKDVIILKHITEANLTNDKNSNIDMSEDARKLEE--LK 293

Query: 283 IHSDDI-YKFIESGDLYRNAIR---YQSMERKPI-------YDLED-------------- 317
             ++ + YK  +  DL    ++    Q +E+ P         DLE+              
Sbjct: 294 AAAESLGYKLHDVNDLVDAVLKRDPRQLLEKIPTKISFRSEKDLEEPKLPLKIDEFITPV 353

Query: 318 -ETTNAIIPQKRSLANTSQPTDTSLES----TKKKRVRRHKVEPLNSLSFFAGG 366
            +  +   P K  L N++   D  +       K+KR  R KV PL+SL FFAGG
Sbjct: 354 PDKVSETAPFKGQLENSTARNDFEIMEQKIPVKRKRTNRSKVRPLDSLDFFAGG 407

 Score = 74.3 bits (181), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 46/115 (40%), Positives = 77/115 (66%), Gaps = 10/115 (8%)

Query: 553 IVKLVQTTKESEVKRLSSTIVKIEDSELTEEAINKLNDLVLVEPVADLIRTKSD----IS 608
           +V+ +Q TK  EV RL +T+++I+ +ELTE AIN L++L +VE   DLIR  S+    IS
Sbjct: 575 LVEAIQDTKSREVSRLKNTLIQIDKNELTENAINSLSNLAIVEK-KDLIRKNSERGHCIS 633

Query: 609 ANNTTQQQWKNRKNFKKFVKICPKYKSEQSSIESMSRHI-RGSGEILTREFLQTK 662
           ++      W+ RKNFKKF+K+ P+ +S++ + +S  ++I + S  ++TRE++  K
Sbjct: 634 SDTCL---WEGRKNFKKFIKVQPR-RSQRETFDSDGKNIVKNSAFLITREYVPLK 684

>KNAG0C04900 Chr3 (946975..949284) [2310 bp, 769 aa] {ON} Anc_5.435
           YDR369C
          Length = 769

 Score =  102 bits (253), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 77/213 (36%), Positives = 119/213 (55%), Gaps = 19/213 (8%)

Query: 1   MWVLRYSYVEETGEVKKVSCCIRQNVQYTIGRSSKNN-LVIKNDKSISRQHVSLKWSSSK 59
           MW+LRYSY  E      VSCC++++  Y+IGRSSK N LVIKNDKSISRQH+S +W  S 
Sbjct: 1   MWILRYSYESEDHGTVYVSCCLQRSRNYSIGRSSKTNALVIKNDKSISRQHISFQW-VSH 59

Query: 60  NCIELTNTGKLTKSSEKYLGSNEL--ITYSAD-ETQIEMLLGVAPVKIILSRIDELFDIP 116
           + +++ N GKLT  ++ +L   E   I+ SA  ET I+  +G APV + L   D   D+ 
Sbjct: 60  DYVDIVNDGKLTYINDAFLKPKETTRISISASKETNIK--VGSAPVIVNLVWEDVFIDM- 116

Query: 117 NSLSQFRETLETLGIQISVDNANVN-----STSLITVGDFGY-RELFAACNDIN-IYSSG 169
             +S   ++L+ +GI  +     VN      T  I + +  +  +L A     N +Y + 
Sbjct: 117 TPISDTGQSLKLIGIYPAGSTHGVNIEDAMKTLCIKIKEIKWPHQLIALIRGANRLYKAD 176

Query: 170 LLTEICNKLVNDHDN---FDAEW-RSMQSSYHR 198
           L+  +  +LV+ ++N   FD  W R++ S  ++
Sbjct: 177 LVDLMAQQLVDSNENISSFDEIWNRTVDSGQYK 209

 Score = 80.9 bits (198), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 92/388 (23%), Positives = 165/388 (42%), Gaps = 56/388 (14%)

Query: 327 KRSLANTSQPTDTSLESTKKKRVRRHKVEPLNSLSFFAGGISPVPGTNNEYNQSKVNGHL 386
           ++ +    +P + +    KK+R+ R KV+PLN L FFAGG      T     QS  +G L
Sbjct: 328 QKEMRRPKEPVEDTAVPLKKRRLNRRKVQPLNPLEFFAGG-----DTATTTKQSSDDG-L 381

Query: 387 DSEISPDSASTTREQKIPGQSHTISTT---RMEHALTDDNSEPTIVQRSIAEGISHRDQ- 442
            +  + D    +   K+ G    +S +     +   T     P +   +++  +   D+ 
Sbjct: 382 AATKAVDETEVS--DKMHGSGDVLSNSTNNNQDTVATQGKISPILEMNALSAEVPKGDES 439

Query: 443 --LIGNDEVVEDQHHLPDRKKRDIHENTMYNNSYNGNKSLYGVENSLTQSNLLQSMGYEK 500
             ++  D   E    LPD    ++  N M        K    V     QS++ +S+   K
Sbjct: 440 SHVVEPDRTYEKDDCLPD----NLEVNGMM-------KEPEPVIEKTRQSSINESLRTPK 488

Query: 501 SNNKTELSKKNAGGIMSTEKNLDAQRPNLKSQTLNSLEDNDPKRTLQKRDI------DIV 554
                   +      +    +L A R   K     SL  +     L+ R         +V
Sbjct: 489 EPVAEMEDELEEVDEVDEPTHLKASREASKIVGPESLAPSRDTEVLRPRPAKPRNSSSLV 548

Query: 555 KLVQTTKESEVKRLSSTIVKIEDSELTEEAINKLNDLVLVEPVADLIRTKSDISANNTTQ 614
           + +Q+ K++E +RL  T+  ++ SELT+EAI   +++ +VEP  +++R K  +   ++ +
Sbjct: 549 ETIQSVKDNETRRLQCTLTPVDPSELTDEAIADFSNMAIVEPTVNIVRKKPAMVTESSIR 608

Query: 615 QQWKNRKNFKKFVKICPKYKSEQSSIESMSRHIRGSGEILTREFLQTKNVPVDYYNSHHD 674
               +R NFKKF+K+ PK +    S       +R +  ++TR++     VP+  YN   +
Sbjct: 609 S---DRPNFKKFMKVWPKARKGNDS-------LRNNAYLITRDY-----VPMKAYN--RN 651

Query: 675 QNDFVDEINTAPQANKSNSFVHQILPEI 702
           +    DE     +A         ILP+I
Sbjct: 652 EPKVFDEFENVTKAG--------ILPDI 671

>KLLA0E02201g Chr5 complement(205466..207973) [2508 bp, 835 aa] {ON}
           weakly similar to uniprot|P33301 Saccharomyces
           cerevisiae YDR369C XRS2 classified as an early
           recombination function required for DNA repair but
           dispensable for mitotic recombination (xrs2 is hyper-Rec
           during vegatative growth) required for double strand
           breaks meiotic recombination and spore viability DNA
           repair protein
          Length = 835

 Score = 77.8 bits (190), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 168/710 (23%), Positives = 301/710 (42%), Gaps = 114/710 (16%)

Query: 1   MWVLRYSYVEETGEVKKVSCCIRQNVQYTIGRSSKNNLVIKNDKSISRQHVSLKWSSSKN 60
           MW++ + + +E  +  KV   ++  V+Y+IGRS+K    I+ DKSISR H+ +K+  S  
Sbjct: 1   MWIVSFIFDDEAEKSHKVCKALQYGVEYSIGRSAKCTFRIQTDKSISRVHLLIKFDGSDL 60

Query: 61  CIELTNTGKLTKSSEKYLGSNELITYSADETQIEMLLGVAPVKIILSRIDELFDIPN--S 118
            I  TN GKLTK +E+ +  +E I      T I   +G  P+ + +    E + IP+   
Sbjct: 61  II--TNKGKLTKFNEEIIPLDETIVVHNQNTVIN--IGGMPIDVNVRYFYEEWKIPHRLE 116

Query: 119 LSQFRETLETLGIQISVDNANVNSTSLITVGDFGYRELFAACNDINIYSSGLLTEICNKL 178
           L++ +  +   G+++S   +   +T + +        LFA    + + S   L ++  KL
Sbjct: 117 LNETKSLVSDFGVKLSESFSKKTTTQICSDSSSYSGCLFALLKGVPVVSIEFLNQM-GKL 175

Query: 179 VNDHDNFDAEWRSMQSSYHRNLDLEGLLSQFGGIRGKFFFLLYKIDWFIISYLKPFLLKL 238
           +   +  D      QS Y      +GLL++         F  Y+    ++S +   L+  
Sbjct: 176 LQQGNYLD-----FQSMY------QGLLNRHK------LFPSYRYVPNVLSNMT--LIVF 216

Query: 239 SVEIHDSIH-----KNDDLLRLISSKQADEIPIVISNEKIKYLPEDTLQIHSDDIYKFIE 293
             +++D++         D   L +S + D+  +  ++E    L     Q  + +  K +E
Sbjct: 217 EQKMYDTLRYTIEVGGGDAKLLANSSELDKF-LSTNHEPAVVLGSSISQKMNSESTKLLE 275

Query: 294 SGDL------YRNAIRYQSMERKPIYDLEDETTNAIIPQKRSLANTSQPTDTS---LEST 344
             D        R+ ++  ++ +     LE++       +KR + + + P+      ++S 
Sbjct: 276 EFDKSIAETSLRHGVKLLNINQFVNILLENKINGL---KKRDVVDLTSPSPVQQKKIQSA 332

Query: 345 K-----KKRVRRHKVEPLNSLSFFAGG--------------ISP---------------V 370
           K     KK   +  ++ L+SL+FF GG              IS                V
Sbjct: 333 KASVNGKKTKSKPNIQSLDSLNFFGGGNLEVTQNEEKHEPVISHTSESKVKVKEESKAFV 392

Query: 371 PGTNNEYNQSKVNGH---LDSEISPDSASTTREQKIPGQSHTISTTRMEHALTDDNSEPT 427
           P  +N+   +  NG+   L S I+  S+      +   Q HT ST +      DD +E  
Sbjct: 393 PYNDNQDLDTSANGNTKTLPSYITNKSSLGGMSTEPANQPHT-STKK------DDRTELQ 445

Query: 428 IVQRSIAEGISHRDQLIGNDEVVEDQHHLPDRKKRDIHENTMYNNSYNGNKSLYGVENSL 487
            V+R     +   D L+      +     PD +   +    + + + N N       NS 
Sbjct: 446 KVRRKRPR-VQQLDNLMMRSSSQQATQIEPDDRNDKLKLRRIGDTASNVNAEGVLPSNSP 504

Query: 488 TQS-NLLQSMGYEKSNNK----TELSKKNAGGI--MSTEKNL--------DAQRPNLKSQ 532
           + + N+++++     +NK    + +S    GG   +S +KNL        DAQ  N   Q
Sbjct: 505 SNAENMIKNIKTPDISNKNPTLSAISLLEPGGAEHVSAKKNLISDGGKSIDAQSSNRIEQ 564

Query: 533 TLNSLEDNDPK--------RTLQKR-DIDIVKLVQTTKESEVKRLSSTIVKIEDSELTEE 583
            + ++ + D +          LQ R   +I+  +  TK+ EVKRL   I++++ SELTE 
Sbjct: 565 NMGNMTELDSRPHSVARLETDLQVRSSTNIITAIAETKQKEVKRLQEGIIEVDQSELTES 624

Query: 584 AINKLNDLVLVEPVADLIRTKSDISANNTTQQQWKNRKNFKKFVKICPKY 633
           A+    D   +  +    R  + I  +N    +W  RKNFKKF K  P Y
Sbjct: 625 ALIDFKDAAKINTIQIKPRVLASIPISN-GNTKWLGRKNFKKFKKNWPSY 673

>AER402C Chr5 complement(1407938..1410547) [2610 bp, 869 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR369C
           (XRS2)
          Length = 869

 Score = 77.0 bits (188), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 103/404 (25%), Positives = 169/404 (41%), Gaps = 57/404 (14%)

Query: 1   MWVLRYSYVE--ETGEVKKVSCCIRQNVQYTIGRSSKNNLVIKNDKSISRQHVSLKWSSS 58
           MWV + +Y +  + G ++ +SC +    ++ +GR+SK+ LVI+ +K +SR H+ L+    
Sbjct: 1   MWVFKCNYQKSGQLGALQNISCALCPEREFIVGRASKSTLVIE-EKGVSRTHLRLEVIDD 59

Query: 59  KNCIELTNTGKLTKSSEKYLGSNELITYSADETQIEMLLGVAPVKIILSRIDELFDIPNS 118
              I L  +       +   GS  ++ +   ++ + + +G   V+ IL      F +PN+
Sbjct: 60  HVNILLLGSQLKVGGEDASKGS--VLPFGPSQSPVILEVGSHSVQCILEWAQWEFKVPNT 117

Query: 119 LSQ----FRETLETLGIQISVDNANVNSTSLITV--GDFGYRE-LFAACNDINIYSSGLL 171
           L Q      E ++ LGI++    +   +  +I     D  Y + LFA    I I     L
Sbjct: 118 LLQEDPALLEVIKGLGIRVVTSFSKATTHHIIRPHEDDQDYEKYLFALVKGIPILHLEFL 177

Query: 172 TEICNKLVNDHDNFDAEWRSMQSSYHRNLDLEGLLSQFGGIRGKFFFLLYKIDWFIISYL 231
            +    L     +FD + RS+Q  ++      G   +   + G  F +  K D+ ++ Y 
Sbjct: 178 KQFTALLRQPVTDFDPQLRSIQEQHYA---FRGFTKKAADLNGLHFIVNRKHDFEMLKY- 233

Query: 232 KPFLLKLSVEIHDSIHKNDDLLRLISSKQADEIPI----------VISNEKIKYLPEDTL 281
               L++        H  +DL   + +     IPI           IS E  K   +DT 
Sbjct: 234 ---TLEIGGGTVHFCHDINDLSACLKT-----IPINGALALKYDHGISAEVKKV--DDTR 283

Query: 282 Q---IHSDDIYKF----IESGDLYRNAIRYQSMERKPIYDLEDETTNAIIPQKR------ 328
               +HS  I  F    +    LY    +  S +R P      E   + I Q +      
Sbjct: 284 YCEVLHSHGIQLFTVHELTKAILYDKLAQLLS-KRPPTMMKLVEPVPSTISQTQEMKQES 342

Query: 329 ----SLANTSQPTDTSLESTKKKRVRRHKVEPLNSLSFFAGGIS 368
               SL NT   T   L    K R R  K +PL+SLSFFAGG+S
Sbjct: 343 LSPISLGNT---TIKDLPRKDKTRKRLKKPQPLDSLSFFAGGLS 383

 Score = 65.9 bits (159), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 127/529 (24%), Positives = 227/529 (42%), Gaps = 85/529 (16%)

Query: 160 CNDINIYSSGLLTEICN---KLVNDHDNFDAEWRSMQSS-YHRNLDLEGLLSQFGGIRGK 215
           C+DIN  S+ L T   N    L  DH    AE + +  + Y   L   G+  Q   +   
Sbjct: 245 CHDINDLSACLKTIPINGALALKYDH-GISAEVKKVDDTRYCEVLHSHGI--QLFTVHEL 301

Query: 216 FFFLLYKIDWFIISYLKPFLLKLSVEIHDSIHKNDDLLRLISSKQADEIPIVISNEKIKY 275
              +LY     ++S   P ++KL   +  +I +  ++      KQ    PI + N  IK 
Sbjct: 302 TKAILYDKLAQLLSKRPPTMMKLVEPVPSTISQTQEM------KQESLSPISLGNTTIKD 355

Query: 276 LPEDTLQIHSDDIYKFIESGDLYRNAIRYQSMERKPIYDLEDETTNAIIPQKRSLANTSQ 335
           LP            + ++S   +   +  Q+       DL  + + ++     +  +   
Sbjct: 356 LPRKDKTRKRLKKPQPLDSLSFFAGGLSRQNSSIGGTADLVKQESMSL----GADTHYGS 411

Query: 336 PTDT-SLESTK-KKRVRRHKVEPLNSL-------SFFAGGISPVPGTNNEYNQSKVNGHL 386
           P D  SL +T+  K+ RR KVEPL +L       +F    IS           +KV+   
Sbjct: 412 PNDVQSLPATQSPKKRRRPKVEPLGNLMTSQLQKAFDDPTIS----------SAKVSP-T 460

Query: 387 DSEISPDSASTTREQKIPGQSHTISTTRMEHALTDDNSE----PTIVQRSIAEGISHRDQ 442
           + EI P     ++ +K P      + T  + ++  ++ +    P      +  G+ + D 
Sbjct: 461 EQEIIP--VRESQAKKTPDPIGAFNGTSQKGSIESNSRKRQPSPGYPYEPLPAGVGNGDI 518

Query: 443 LIGNDEVVEDQHHLPDRKKRDIHENTMYNNSYNGNKSLYGVENSLTQSNLLQSMGYEKSN 502
           L    + +++Q   P  KK  + E  +Y+   +G+   Y  E  LT+S L         N
Sbjct: 519 LNKQWKSLDEQ---PPSKKPRMQETDLYSEVMSGSSEEYREE--LTRSKL---------N 564

Query: 503 NKTELSKKNAGGIMSTEKNLDAQRPNLKSQTLNSLEDNDPKRTLQKRDIDIVKLVQTTKE 562
           +  E S K       + K   +++P      +NS +        ++  +D +K +   KE
Sbjct: 565 SLDEESIK-------SRKRTSSEKP------VNSCKRRQAPAVPEQNIVDAIKQI---KE 608

Query: 563 SEVKRLSSTIVKIEDSELTEEAINKLNDLVLVEPVADLIRTKSDISANNTTQQQWKNRKN 622
            EV R+ +TIV++   ELTE+AI +L  L +V+PV D++R +  +    ++   +  RKN
Sbjct: 609 REVNRIRTTIVELGPEELTEDAIRQLKSLAIVQPV-DMLRQQHTVDTVGSSPLTFA-RKN 666

Query: 623 FKKFVKICPKYKSEQSSIESMSRHIRGSGEILTREFLQTKNVPVDYYNS 671
           +K F K+ PKY + ++S E+     R +  I  R++L     P++ Y +
Sbjct: 667 YKNFKKVWPKYMNRKNSPET-----RNATAISNRKYL-----PLELYET 705

>Ecym_4761 Chr4 (1479649..1482045) [2397 bp, 798 aa] {ON} similar to
           Ashbya gossypii AER402C
          Length = 798

 Score = 63.9 bits (154), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 36/81 (44%), Positives = 50/81 (61%), Gaps = 1/81 (1%)

Query: 553 IVKLVQTTKESEVKRLSSTIVKIEDSELTEEAINKLNDLVLVEPVADLIRTKSDISANNT 612
           IV  ++  KE EV R+ +TIV+I   ELTEEAI KL+ L +VE V D++R          
Sbjct: 526 IVNAIKEIKEREVSRIKTTIVEIGPDELTEEAICKLSTLAVVESV-DMLRKTQSRHMKTE 584

Query: 613 TQQQWKNRKNFKKFVKICPKY 633
           T ++   R+NFK+FVK+ P Y
Sbjct: 585 TNKRHHVRRNFKRFVKVWPAY 605

>KAFR0J02390 Chr10 (452888..453559) [672 bp, 223 aa] {ON} Anc_6.300
           YMR202W
          Length = 223

 Score = 33.9 bits (76), Expect = 1.0,   Method: Composition-based stats.
 Identities = 27/122 (22%), Positives = 50/122 (40%), Gaps = 19/122 (15%)

Query: 165 IYSSGLLTEICNKLVNDHDNFDA---------EWRSMQSSYH------RNLDLEGLLSQF 209
           I+    L +ICN ++  H++ DA         + R+  +S++        ++ E + +  
Sbjct: 30  IFDPVTLNQICNSVIAKHNSSDAIVDVSSLLVDIRTELASHYGPEYINEYVEEEWVFNNA 89

Query: 210 GGIRGKFFFLLYKIDWFIISYLKPFLLKLSVEIHDSIHKNDDLLRLISSKQADEIPIVIS 269
           GG  G+   L   +      YL  F   +  E H  +H  DD   +I  +Q   +P  + 
Sbjct: 90  GGAMGQMIILHASVS----EYLIFFGTAVGTEGHTGVHFADDYFTIIHGEQTAALPFAVE 145

Query: 270 NE 271
            E
Sbjct: 146 PE 147

>SAKL0D00220g Chr4 complement(18466..20199) [1734 bp, 577 aa] {ON}
           uniprot|Q6XAE8 Saccharomyces kluyveri Pyruvate
           decarboxylase-like protein
          Length = 577

 Score = 34.7 bits (78), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 33/140 (23%), Positives = 60/140 (42%), Gaps = 12/140 (8%)

Query: 324 IPQKRSLANTSQPTDTSLESTKKKRVRRHKVEPLNSLSFFAGGISP-----VPGTNNEYN 378
           +P    + N    T+ +LE   +     H    +N +S+F GG +P     V     +Y 
Sbjct: 268 LPNFHGVFNNELSTNGTLEILDQNDFILHLGTNINEVSYFVGGSTPLDKKDVIFIGKDYA 327

Query: 379 QSKVNGHLDSEISPDSASTTREQKIPGQSHTISTTRMEHAL-----TDDNSEPTIVQRSI 433
           Q   NGH+ + I+         Q++  ++     TR   AL     T D+   T+ Q ++
Sbjct: 328 QVGTNGHIITGINCHVFFEELLQRMNSKTMPKVKTRKSTALYNNGYTVDDDSKTVTQANL 387

Query: 434 AEGISHRDQLIGNDEVVEDQ 453
           ++ +S   QL  ND ++ + 
Sbjct: 388 SQVVSA--QLRENDVIINEM 405

>TDEL0A07140 Chr1 (1246460..1247131) [672 bp, 223 aa] {ON} Anc_6.300
           YMR202W
          Length = 223

 Score = 33.9 bits (76), Expect = 1.3,   Method: Composition-based stats.
 Identities = 32/140 (22%), Positives = 57/140 (40%), Gaps = 21/140 (15%)

Query: 171 LTEICNKLVNDH----DNFDAEW------RSMQSSY-----HRNLDLEGLLSQFGGIRGK 215
           + ++CN +++ H    +NF  E        ++ + Y     +  LD E + +  GG  G+
Sbjct: 36  VNQLCNDVLSKHNSTSENFSTEALLRDVRDALATRYGDEYINHYLDEEWIFNNAGGAMGQ 95

Query: 216 FFFLLYKIDWFIISYLKPFLLKLSVEIHDSIHKNDDLLRLISSKQADEIPIVISNEKIKY 275
              L   I      YL  F   +  E H  +H  DD   ++  +Q   +P  +  EK  Y
Sbjct: 96  MIILHASIS----EYLILFGTAVGTEGHTGVHFADDYFTILHGQQNAALPWAL--EKEVY 149

Query: 276 LPEDTLQIHSDDIYKFIESG 295
           LP  T  +    + ++   G
Sbjct: 150 LPGMTHHLQKGHVKQYSMPG 169

>Smik_13.410 Chr13 (651723..652391) [669 bp, 222 aa] {ON} YMR202W
           (REAL)
          Length = 222

 Score = 33.1 bits (74), Expect = 2.0,   Method: Composition-based stats.
 Identities = 34/143 (23%), Positives = 55/143 (38%), Gaps = 19/143 (13%)

Query: 144 SLITVGDFGYRELFAACNDIN-IYSSGLLTEICNKLVNDH---DNFDAEW------RSMQ 193
           SLI V  +    LF      N ++    L EICN +++ H   DN   E+       ++ 
Sbjct: 8   SLIGVAGYIMNVLFTTWLPTNYMFDPKTLNEICNSVISKHNATDNNSTEYLLQDIRDALA 67

Query: 194 SSY-----HRNLDLEGLLSQFGGIRGKFFFLLYKIDWFIISYLKPFLLKLSVEIHDSIHK 248
           S Y     ++ +  E + +  GG  G+   L   +      YL  F   +  E H  +H 
Sbjct: 68  SHYGDEYINKYVREEWIFNNAGGAMGQMIILHASVS----EYLIIFGTAVGTEGHTGVHF 123

Query: 249 NDDLLRLISSKQADEIPIVISNE 271
            DD   ++   Q   +P     E
Sbjct: 124 ADDYFTILHGTQIAALPYATEAE 146

>Skud_13.370 Chr13 (641454..642125) [672 bp, 223 aa] {ON} YMR202W
           (REAL)
          Length = 223

 Score = 32.3 bits (72), Expect = 3.5,   Method: Composition-based stats.
 Identities = 33/145 (22%), Positives = 56/145 (38%), Gaps = 22/145 (15%)

Query: 145 LITVGDFGY--RELFAACNDIN-IYSSGLLTEICNKLVNDH----DNFDAE------WRS 191
           L+ +G  GY    LF      N ++    L +ICN ++  H    D+F  +        +
Sbjct: 7   LLLIGAVGYFMNVLFTTWLPTNYMFDPKTLNQICNSVIAKHNTTADDFSTQVLLQDIRDA 66

Query: 192 MQSSY-----HRNLDLEGLLSQFGGIRGKFFFLLYKIDWFIISYLKPFLLKLSVEIHDSI 246
           + S Y     ++ +D E + +  GG  G+   L   +      YL  F   +  E H  +
Sbjct: 67  LASHYGDEYINKYVDEEWVFNNAGGAMGQMIILHASVS----EYLIIFGTAVGTEGHSGV 122

Query: 247 HKNDDLLRLISSKQADEIPIVISNE 271
           H  DD   ++   Q   +P     E
Sbjct: 123 HFADDYFTILHGTQTAALPYATEAE 147

>Skud_4.772 Chr4 complement(1365597..1366757) [1161 bp, 386 aa] {ON}
           YDR498C (REAL)
          Length = 386

 Score = 32.7 bits (73), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 34/121 (28%), Positives = 62/121 (51%), Gaps = 12/121 (9%)

Query: 453 QHHLPD------RKKRDIHENTM-YNNSYNGNKSLYG-VENSLTQSNLLQSMGYEKSNNK 504
           QHH  D       + RDI  +++ Y+ S++G  S  G +EN+  +  LL S   + +NN 
Sbjct: 152 QHHKRDLAWNDEERDRDIRFHSVDYDKSHHGASSSTGSMENASARDKLL-SKTKQLTNNL 210

Query: 505 TELSKKNAGGIMSTEKNLDAQRPNLKSQTLNSLEDNDPK-RTLQKRDIDIVKLVQTTKES 563
              ++    GI+ ++ NLD  R   ++ +L  ++D   +  T+ KR  D+VK+++     
Sbjct: 211 VRGNQILQSGILQSDLNLDELRA--QTHSLTQIDDKYTQFETVFKRTADLVKVLENASHQ 268

Query: 564 E 564
           E
Sbjct: 269 E 269

>KLTH0E09570g Chr5 complement(864260..866047) [1788 bp, 595 aa] {ON}
           similar to uniprot|P30620 Saccharomyces cerevisiae
           YMR137C PSO2 Required for a post-incision step in the
           repair of DNA single and double-strand breaks that
           result from interstrand crosslinks produced by a variety
           of mono- and bi-functional psoralen derivatives induced
           by UV- irradiation
          Length = 595

 Score = 32.7 bits (73), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 36/70 (51%), Gaps = 4/70 (5%)

Query: 735 LFVVDDDFEDSQDVGHLLNKADTTEPPQQLQDHEDTM--NDGPGSTTPVRNKRNRGKVSV 792
           LFV D+D ED+ +   ++  +D T+P  + QD    +  N       PVR ++N    S+
Sbjct: 65  LFVADEDQEDNSEAVEVI--SDVTKPSPKAQDLRLALSGNQNDAKPKPVRKQKNSFTESL 122

Query: 793 TNGGNRVRSV 802
           T  G ++ SV
Sbjct: 123 TTVGQKLVSV 132

>TPHA0B04670 Chr2 (1098809..1100185) [1377 bp, 458 aa] {ON} Anc_1.61
           YDR501W
          Length = 458

 Score = 32.0 bits (71), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 20/74 (27%), Positives = 37/74 (50%), Gaps = 12/74 (16%)

Query: 24  QNVQYTIGRSSKN-NLVIKNDKSISRQHVSLKWSSSKNCIELTNTGKLTKSSEKYLGSNE 82
           +N +  IGR SK  N+V+   K+ISR+H  + ++   +C+ +           + LG+N 
Sbjct: 106 ENQKIVIGRQSKECNVVLPKRKNISRKHAVVSYNKDLDCVRI-----------QCLGTNG 154

Query: 83  LITYSADETQIEML 96
           LI     + Q  ++
Sbjct: 155 LIVNFPAKIQFNLV 168

>Smik_7.162 Chr7 (291286..293301) [2016 bp, 671 aa] {ON} YGL113W
           (REAL)
          Length = 671

 Score = 32.3 bits (72), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 32/53 (60%), Gaps = 2/53 (3%)

Query: 305 QSMERKPIYDLEDETTNAI-IPQKRSLANTSQPTDTSLESTKKKRVRRHKVEP 356
           QS+   P+ +L+D+T   I I QK +  + S  T+TSLES  K+RVRR    P
Sbjct: 617 QSIIESPL-NLKDDTHEEIGISQKHTSLSVSVSTNTSLESKPKRRVRRRLFAP 668

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.312    0.130    0.361 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 93,254,989
Number of extensions: 4531792
Number of successful extensions: 18168
Number of sequences better than 10.0: 464
Number of HSP's gapped: 19048
Number of HSP's successfully gapped: 509
Length of query: 828
Length of database: 53,481,399
Length adjustment: 118
Effective length of query: 710
Effective length of database: 39,950,811
Effective search space: 28365075810
Effective search space used: 28365075810
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 70 (31.6 bits)