Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
CAGL0A02794g5.433ON21621610831e-152
Suva_2.5395.433ON2272277491e-101
YDR367W (KEI1)5.433ON2212217401e-99
KNAG0C049205.433ON2172107331e-98
NCAS0F033705.433ON2112197094e-95
Skud_4.6365.433ON2342347055e-94
KAFR0E039305.433ON2112157026e-94
Smik_4.6335.433ON2212216975e-93
Kpol_1062.305.433ON2142096722e-89
TDEL0E019205.433ON2202176551e-86
TPHA0E017705.433ON2172006229e-82
SAKL0G02508g5.433ON2282236161e-80
ZYRO0F10010g5.433ON2082105732e-74
Kwal_55.214325.433ON2072065523e-71
NDAI0B056605.433ON1611655344e-69
TBLA0A065205.433ON2062145263e-67
TBLA0G020105.433ON2131985021e-63
KLTH0F16082g5.433ON2062054881e-61
AER256C5.433ON2392164824e-60
Ecym_47625.433ON2212244752e-59
KLLA0E21099g5.433ON2242204459e-55
SAKL0G16236g4.285ON67570657.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0A02794g
         (216 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0A02794g Chr1 (295534..295563,295751..296371) [651 bp, 216 a...   421   e-152
Suva_2.539 Chr2 (963328..963357,963470..964123) [684 bp, 227 aa]...   293   e-101
YDR367W Chr4 (1212848..1212877,1212979..1213614) [666 bp, 221 aa...   289   1e-99
KNAG0C04920 Chr3 complement(950839..951462,951584..951613) [654 ...   286   1e-98
NCAS0F03370 Chr6 (681041..681070,681141..681746) [636 bp, 211 aa...   277   4e-95
Skud_4.636 Chr4 (1135660..1135689,1135789..1136463) [705 bp, 234...   276   5e-94
KAFR0E03930 Chr5 (777060..777089,777170..777775) [636 bp, 211 aa...   275   6e-94
Smik_4.633 Chr4 (1132870..1132899,1133000..1133635) [666 bp, 221...   273   5e-93
Kpol_1062.30 s1062 complement(66657..67301) [645 bp, 214 aa] {ON...   263   2e-89
TDEL0E01920 Chr5 complement(363042..363665,363727..363765) [663 ...   256   1e-86
TPHA0E01770 Chr5 complement(356743..357396) [654 bp, 217 aa] {ON...   244   9e-82
SAKL0G02508g Chr7 (207823..207855,207940..208593) [687 bp, 228 a...   241   1e-80
ZYRO0F10010g Chr6 (812835..812861,812941..813540) [627 bp, 208 a...   225   2e-74
Kwal_55.21432 s55 complement(834129..834752) [624 bp, 207 aa] {O...   217   3e-71
NDAI0B05660 Chr2 (1382276..1382761) [486 bp, 161 aa] {ON} Anc_5....   210   4e-69
TBLA0A06520 Chr1 complement(1599308..1599928) [621 bp, 206 aa] {...   207   3e-67
TBLA0G02010 Chr7 (525436..526077) [642 bp, 213 aa] {ON} Anc_5.43...   197   1e-63
KLTH0F16082g Chr6 complement(1305673..1306293) [621 bp, 206 aa] ...   192   1e-61
AER256C Chr5 complement(1109526..1110152,1110213..1110305) [720 ...   190   4e-60
Ecym_4762 Chr4 complement(1482336..1482983,1483049..1483066) [66...   187   2e-59
KLLA0E21099g Chr5 complement(1885338..1885976,1886092..1886127) ...   176   9e-55
SAKL0G16236g Chr7 (1403769..1405796) [2028 bp, 675 aa] {ON} weak...    30   7.4  

>CAGL0A02794g Chr1 (295534..295563,295751..296371) [651 bp, 216 aa]
           {ON} highly similar to uniprot|Q06346 Saccharomyces
           cerevisiae YDR367w
          Length = 216

 Score =  421 bits (1083), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 203/216 (93%), Positives = 203/216 (93%)

Query: 1   MRLNKISFPKSFFGFLPLYLGVEIVLGITILNKCSGAYGILALFTGHPLDYMQWISYLWS 60
           MRLNKISFPKSFFGFLPLYLGVEIVLGITILNKCSGAYGILALFTGHPLDYMQWISYLWS
Sbjct: 1   MRLNKISFPKSFFGFLPLYLGVEIVLGITILNKCSGAYGILALFTGHPLDYMQWISYLWS 60

Query: 61  VFTLIVFSQGLFMIHKPKLIVFSQILVYFTADTVLTCFFTLWFSAQWFQSANEEKHETSA 120
           VFTLIVFSQGLFMIHKPKLIVFSQILVYFTADTVLTCFFTLWFSAQWFQSANEEKHETSA
Sbjct: 61  VFTLIVFSQGLFMIHKPKLIVFSQILVYFTADTVLTCFFTLWFSAQWFQSANEEKHETSA 120

Query: 121 PVGVSQNYRRSTDLASQGASERYEYXXXXXXXXXXXXXRMYFNFILASFVQELLRHPKYM 180
           PVGVSQNYRRSTDLASQGASERYEY             RMYFNFILASFVQELLRHPKYM
Sbjct: 121 PVGVSQNYRRSTDLASQGASERYEYTVTMLFTLVTLMFRMYFNFILASFVQELLRHPKYM 180

Query: 181 VDQDDVEQDLKNKSAIKRWWIKSQKFCYKLCRHTLQ 216
           VDQDDVEQDLKNKSAIKRWWIKSQKFCYKLCRHTLQ
Sbjct: 181 VDQDDVEQDLKNKSAIKRWWIKSQKFCYKLCRHTLQ 216

>Suva_2.539 Chr2 (963328..963357,963470..964123) [684 bp, 227 aa]
           {ON} YDR367W (REAL)
          Length = 227

 Score =  293 bits (749), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 140/227 (61%), Positives = 165/227 (72%), Gaps = 11/227 (4%)

Query: 1   MRLNKISFPKSFFGFLPLYLGVEIVLGITILNKCSGAYGILALFTGHPLDYMQWISYLWS 60
           MR + ++ PKSF GF+PLYL VEIVLGI+ILNKCSGAYGILALFTGHPLD+MQW++YLWS
Sbjct: 1   MRSSLVALPKSFLGFMPLYLAVEIVLGISILNKCSGAYGILALFTGHPLDFMQWVAYLWS 60

Query: 61  VFTLIVFSQGLFMIHKPKLIVFSQILVYFTADTVLTCFFTLWFSAQWF-----------Q 109
           VFTLIVF+QGL++IHKP L+VFSQI V +T DT+ TCFFTLWF+ QWF            
Sbjct: 61  VFTLIVFAQGLYLIHKPNLLVFSQICVLYTVDTICTCFFTLWFTTQWFTLEGNASIVADA 120

Query: 110 SANEEKHETSAPVGVSQNYRRSTDLASQGASERYEYXXXXXXXXXXXXXRMYFNFILASF 169
           S+   +     P+   +   RSTD + QGASE YEY             R YFNFILASF
Sbjct: 121 SSTATQTINYNPIATGKLTARSTDTSGQGASESYEYSITILITLVSLIFRFYFNFILASF 180

Query: 170 VQELLRHPKYMVDQDDVEQDLKNKSAIKRWWIKSQKFCYKLCRHTLQ 216
           VQELL HPKY+VD+DDVEQDLKNK   KR W KSQK CYKLC++ L+
Sbjct: 181 VQELLHHPKYLVDRDDVEQDLKNKPIWKRLWAKSQKGCYKLCKNLLE 227

>YDR367W Chr4 (1212848..1212877,1212979..1213614) [666 bp, 221 aa]
           {ON}  KEI1Component of inositol phosphorylceramide (IPC)
           synthase; forms a complex with Aur1p and regulates its
           activity; required for IPC synthase complex localization
           to the Golgi; post-translationally processed by Kex2p;
           KEI1 is an essential gene
          Length = 221

 Score =  289 bits (740), Expect = 1e-99,   Method: Compositional matrix adjust.
 Identities = 139/221 (62%), Positives = 166/221 (75%), Gaps = 5/221 (2%)

Query: 1   MRLNKISFPKSFFGFLPLYLGVEIVLGITILNKCSGAYGILALFTGHPLDYMQWISYLWS 60
           MR + ++ PKSF GF+PLYL VEIVLGI+ILNKCSGAYGILALFTGHPLD+MQWI+YLWS
Sbjct: 1   MRSSLLTLPKSFLGFMPLYLAVEIVLGISILNKCSGAYGILALFTGHPLDFMQWIAYLWS 60

Query: 61  VFTLIVFSQGLFMIHKPKLIVFSQILVYFTADTVLTCFFTLWFSAQWF---QSANEEKHE 117
           VFTLIVFSQGL++IHKP L+VFSQI V +T DT+ TCFFTLWF+ QWF    +AN + + 
Sbjct: 61  VFTLIVFSQGLYLIHKPNLLVFSQICVLYTIDTISTCFFTLWFTTQWFTLEDTANIDGNN 120

Query: 118 T--SAPVGVSQNYRRSTDLASQGASERYEYXXXXXXXXXXXXXRMYFNFILASFVQELLR 175
              S P+   +   R  D++ Q A+E YEY             R YFNFILASFVQELL 
Sbjct: 121 ALQSNPISTGKLTERGIDISKQSATESYEYTMTILITLVSLIFRFYFNFILASFVQELLH 180

Query: 176 HPKYMVDQDDVEQDLKNKSAIKRWWIKSQKFCYKLCRHTLQ 216
           HPKY+VD+DDVEQ+LKNK   KR W KSQK CYKLC++ L+
Sbjct: 181 HPKYLVDRDDVEQNLKNKPIWKRLWAKSQKGCYKLCKNLLE 221

>KNAG0C04920 Chr3 complement(950839..951462,951584..951613) [654 bp,
           217 aa] {ON} Anc_5.433 YDR367W
          Length = 217

 Score =  286 bits (733), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 129/210 (61%), Positives = 162/210 (77%), Gaps = 1/210 (0%)

Query: 7   SFPKSFFGFLPLYLGVEIVLGITILNKCSGAYGILALFTGHPLDYMQWISYLWSVFTLIV 66
           S PK+FFG  PLY+GVEIVLG+T+LNKCSGA+GILALFTGHPLD MQW SYLWSVFTL+V
Sbjct: 7   SLPKTFFGIFPLYIGVEIVLGVTLLNKCSGAFGILALFTGHPLDLMQWASYLWSVFTLVV 66

Query: 67  FSQGLFMIHKPKLIVFSQILVYFTADTVLTCFFTLWFSAQWF-QSANEEKHETSAPVGVS 125
           ++QGL+ IHKPKL+ FSQI+V F+ DTVLTC FTLWF+  WF + +N +    +A   V+
Sbjct: 67  YAQGLYQIHKPKLLTFSQIVVVFSIDTVLTCLFTLWFTGVWFAEESNTDAAMGTAASAVA 126

Query: 126 QNYRRSTDLASQGASERYEYXXXXXXXXXXXXXRMYFNFILASFVQELLRHPKYMVDQDD 185
           +  +R  ++ +QGA+E YEY             R+YFNF+LASFVQELLRHP+Y+VDQDD
Sbjct: 127 RLVKRGAEIDTQGATESYEYVFTIIITMVSLVFRLYFNFLLASFVQELLRHPQYLVDQDD 186

Query: 186 VEQDLKNKSAIKRWWIKSQKFCYKLCRHTL 215
           +EQDLKNK  ++RWW+ SQK  Y +CRH L
Sbjct: 187 IEQDLKNKFFLRRWWVVSQKSSYSICRHVL 216

>NCAS0F03370 Chr6 (681041..681070,681141..681746) [636 bp, 211 aa]
           {ON} Anc_5.433 YDR367W
          Length = 211

 Score =  277 bits (709), Expect = 4e-95,   Method: Compositional matrix adjust.
 Identities = 134/219 (61%), Positives = 162/219 (73%), Gaps = 13/219 (5%)

Query: 1   MRLNKISFPK---SFFGFLPLYLGVEIVLGITILNKCSGAYGILALFTGHPLDYMQWISY 57
           M  + I+ PK   SFFG +PLYLGVEIVLGITI NKCSGAYGILALFTGHPLD++QW+ Y
Sbjct: 1   MAHHSITLPKCFQSFFGIIPLYLGVEIVLGITIFNKCSGAYGILALFTGHPLDFVQWVFY 60

Query: 58  LWSVFTLIVFSQGLFMIHKPKLIVFSQILVYFTADTVLTCFFTLWFSAQWFQSANEEKHE 117
           LWS+FTLI+F+QGL+ IHKP L+ FSQILV+++ DT+ TC FTLWF++QWFQ        
Sbjct: 61  LWSIFTLIIFAQGLYEIHKPTLLTFSQILVFYSLDTICTCIFTLWFTSQWFQ-------- 112

Query: 118 TSAPVGVSQNY-RRSTDLASQGASERYEYXXXXXXXXXXXXXRMYFNFILASFVQELLRH 176
            + P G  +   RR+  L SQGA+E YEY             R+YFN +LA+FVQELL H
Sbjct: 113 -TEPTGTEEALQRRNESLESQGATEAYEYMMTIFITLVTLTFRLYFNCLLAAFVQELLHH 171

Query: 177 PKYMVDQDDVEQDLKNKSAIKRWWIKSQKFCYKLCRHTL 215
           PKY+VDQDDVEQDLKNK   KRWWIK+QK+ YK+C H L
Sbjct: 172 PKYLVDQDDVEQDLKNKPVWKRWWIKNQKWSYKVCSHLL 210

>Skud_4.636 Chr4 (1135660..1135689,1135789..1136463) [705 bp, 234
           aa] {ON} YDR367W (REAL)
          Length = 234

 Score =  276 bits (705), Expect = 5e-94,   Method: Compositional matrix adjust.
 Identities = 135/234 (57%), Positives = 161/234 (68%), Gaps = 18/234 (7%)

Query: 1   MRLNKISFPK----SFFGFLPLYLGVEIVLGITILNKCSGAYGILALFTGHPLDYMQWIS 56
           MR + ++ PK    SF GF+PLYL VEIVLGI+ILNKCSGAYGILALFTGHPLD+MQW++
Sbjct: 1   MRTSFLTLPKIFIKSFLGFMPLYLAVEIVLGISILNKCSGAYGILALFTGHPLDFMQWVA 60

Query: 57  YLWSVFTLIVFSQGLFMIHKPKLIVFSQILVYFTADTVLTCFFTLWFSAQWFQSANEEKH 116
           YLWSVFTLIVFSQGL++IHKP L+VFSQI + +T DT+ TCFFTLWF+ QWF   N    
Sbjct: 61  YLWSVFTLIVFSQGLYLIHKPNLLVFSQICILYTVDTIFTCFFTLWFTTQWFTLENPTDF 120

Query: 117 ETSA--------------PVGVSQNYRRSTDLASQGASERYEYXXXXXXXXXXXXXRMYF 162
            + A              P+   +   RS D + Q A+E YEY             R YF
Sbjct: 121 GSIANSTADTALRTNGLSPIMAGKLTARSADKSGQSATENYEYSITIFITLASLIFRFYF 180

Query: 163 NFILASFVQELLRHPKYMVDQDDVEQDLKNKSAIKRWWIKSQKFCYKLCRHTLQ 216
           N IL SFVQELL HPKY+VD+DDVEQDLKNK   KR W KSQK CY+LC++ L+
Sbjct: 181 NLILGSFVQELLHHPKYLVDRDDVEQDLKNKPIWKRLWAKSQKSCYRLCKNLLE 234

>KAFR0E03930 Chr5 (777060..777089,777170..777775) [636 bp, 211 aa]
           {ON} Anc_5.433 YDR367W
          Length = 211

 Score =  275 bits (702), Expect = 6e-94,   Method: Compositional matrix adjust.
 Identities = 133/215 (61%), Positives = 155/215 (72%), Gaps = 5/215 (2%)

Query: 1   MRLNKISFPKSFFGFLPLYLGVEIVLGITILNKCSGAYGILALFTGHPLDYMQWISYLWS 60
           MR    S PKSF G LPLYL VEIVLGIT  NK SGA+GILALFTGHPL +MQW+ YLWS
Sbjct: 1   MRTTSFSLPKSFLGVLPLYLAVEIVLGITAFNKVSGAFGILALFTGHPLAFMQWVFYLWS 60

Query: 61  VFTLIVFSQGLFMIHKPKLIVFSQILVYFTADTVLTCFFTLWFSAQWFQSANEEKHETSA 120
             TL VF+QGLF IHKP ++ FSQI V+++ DT+  CFFTLWF+  WF      + +T A
Sbjct: 61  TVTLFVFAQGLFEIHKPNILTFSQIFVFYSIDTLCNCFFTLWFTGDWFNV----ESQTEA 116

Query: 121 PVGVSQNYRRSTDLASQGASERYEYXXXXXXXXXXXXXRMYFNFILASFVQELLRHPKYM 180
            VG S   +R+ D++SQGAS+ YEY             R YFNFILASFVQELLRHPKYM
Sbjct: 117 AVG-STITKRTEDISSQGASQGYEYSMTIFITLTSLVFRFYFNFILASFVQELLRHPKYM 175

Query: 181 VDQDDVEQDLKNKSAIKRWWIKSQKFCYKLCRHTL 215
            DQDD+EQDLKNKS  KRWW+K QK CYKLC++ L
Sbjct: 176 FDQDDIEQDLKNKSIWKRWWLKCQKSCYKLCKNLL 210

>Smik_4.633 Chr4 (1132870..1132899,1133000..1133635) [666 bp, 221
           aa] {ON} YDR367W (REAL)
          Length = 221

 Score =  273 bits (697), Expect = 5e-93,   Method: Compositional matrix adjust.
 Identities = 130/221 (58%), Positives = 159/221 (71%), Gaps = 5/221 (2%)

Query: 1   MRLNKISFPKSFFGFLPLYLGVEIVLGITILNKCSGAYGILALFTGHPLDYMQWISYLWS 60
           MR   ++ PKSF GF+PLYL VEIVLGI+ILNKCSG YGILALFTGHPLD+MQW++YLWS
Sbjct: 1   MRSFLLTLPKSFLGFMPLYLAVEIVLGISILNKCSGVYGILALFTGHPLDFMQWVAYLWS 60

Query: 61  VFTLIVFSQGLFMIHKPKLIVFSQILVYFTADTVLTCFFTLWFSAQWFQSAN-----EEK 115
           VFTLI+FSQGL++IHKP L++FSQI   +T DT+ TCFFTLWF+ QWF   +       +
Sbjct: 61  VFTLIIFSQGLYLIHKPNLLLFSQICALYTLDTLFTCFFTLWFTTQWFTLEDTAGGVASQ 120

Query: 116 HETSAPVGVSQNYRRSTDLASQGASERYEYXXXXXXXXXXXXXRMYFNFILASFVQELLR 175
              S  +   +   R+TD++ Q A+E YEY             R YFN ILASFVQELL 
Sbjct: 121 SNNSNLISTERLTVRNTDISKQSATESYEYSITILITLVSLIFRFYFNLILASFVQELLH 180

Query: 176 HPKYMVDQDDVEQDLKNKSAIKRWWIKSQKFCYKLCRHTLQ 216
           HPKY+VD+DDVEQ+LKNK   KR + KSQK CYKLC++ L 
Sbjct: 181 HPKYLVDRDDVEQNLKNKPIWKRLYAKSQKGCYKLCKNLLN 221

>Kpol_1062.30 s1062 complement(66657..67301) [645 bp, 214 aa] {ON}
           complement(66657..67301) [645 nt, 215 aa]
          Length = 214

 Score =  263 bits (672), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 128/209 (61%), Positives = 146/209 (69%), Gaps = 11/209 (5%)

Query: 7   SFPKSFFGFLPLYLGVEIVLGITILNKCSGAYGILALFTGHPLDYMQWISYLWSVFTLIV 66
           + P+SFFGFLPLY+GVE VLGITILNKCSGAYGILALFTGHPL+  QW+SYLWSVFTLI+
Sbjct: 16  NLPRSFFGFLPLYIGVETVLGITILNKCSGAYGILALFTGHPLNVFQWVSYLWSVFTLII 75

Query: 67  FSQGLFMIHKPKLIVFSQILVYFTADTVLTCFFTLWFSAQWFQSANEEKHETSAPVGVSQ 126
           +SQGLF +H P L+ +SQI V F+ DT LTC FT+ FS+QWF        + S       
Sbjct: 76  YSQGLFQVHTPSLLTYSQIFVVFSFDTFLTCVFTMIFSSQWFTETGSGMSDGSG------ 129

Query: 127 NYRRSTDLASQGASERYEYXXXXXXXXXXXXXRMYFNFILASFVQELLRHPKYMVDQDDV 186
                 D   QGASE YEY             RMYFNFILA+F QEL  HPKYMVD DDV
Sbjct: 130 -----VDEYGQGASETYEYTFTILITVVALVSRMYFNFILAAFNQELFLHPKYMVDFDDV 184

Query: 187 EQDLKNKSAIKRWWIKSQKFCYKLCRHTL 215
           EQDLKNK+ I +WWIKS+K CY L RH L
Sbjct: 185 EQDLKNKNKIVQWWIKSKKSCYNLARHIL 213

>TDEL0E01920 Chr5 complement(363042..363665,363727..363765) [663 bp,
           220 aa] {ON} Anc_5.433 YDR367W
          Length = 220

 Score =  256 bits (655), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 123/217 (56%), Positives = 155/217 (71%), Gaps = 5/217 (2%)

Query: 2   RLNKISFPKSFFGFLPLYLGVEIVLGITILNKCSGAYGILALFTGHPLDYMQWISYLWSV 61
           R   +  PKSF GF+PLY+GVEI LGI+I+NKCSGAYGILALFTGHPLD MQW+ Y+WS+
Sbjct: 5   RSKSMGLPKSFLGFVPLYIGVEIALGISIINKCSGAYGILALFTGHPLDSMQWVLYIWSI 64

Query: 62  FTLIVFSQGLFMIHKPKLIVFSQILVYFTADTVLTCFFTLWFSAQWFQ---SANEEKHET 118
           FTLI+  QGL+ IHKP ++ FS I + F  DT+ T FFTLWF+AQW+    ++N  K   
Sbjct: 65  FTLIICVQGLYQIHKPNVLTFSHIFITFIIDTLFTSFFTLWFTAQWYNLEGNSNNVKDTK 124

Query: 119 SAPVGVSQNYRRSTDLASQGASERYEYXXXXXXXXXXXXXRMYFNFILASFVQELLRHPK 178
           S+      +Y  S+ +A QGASE +EY             ++YF FI+ASFVQELL HP+
Sbjct: 125 SSYSDAPVDY--SSKIAHQGASEGFEYGVTMFITILSLAGKLYFTFIIASFVQELLLHPR 182

Query: 179 YMVDQDDVEQDLKNKSAIKRWWIKSQKFCYKLCRHTL 215
           YM+DQDDVEQDLK++S  KRWWIKSQK CYK+ +  L
Sbjct: 183 YMLDQDDVEQDLKHQSFWKRWWIKSQKSCYKMSKSLL 219

>TPHA0E01770 Chr5 complement(356743..357396) [654 bp, 217 aa] {ON}
           Anc_5.433 YDR367W
          Length = 217

 Score =  244 bits (622), Expect = 9e-82,   Method: Compositional matrix adjust.
 Identities = 117/200 (58%), Positives = 143/200 (71%), Gaps = 8/200 (4%)

Query: 9   PKSFFGFLPLYLGVEIVLGITILNKCSGAYGILALFTGHPLDYMQWISYLWSVFTLIVFS 68
           PKSFFGFLPLY+GVE VLGITI NKCSG YGILALFTGHPL  +QW+SYLWS FTL++++
Sbjct: 18  PKSFFGFLPLYIGVETVLGITIFNKCSGIYGILALFTGHPLTAIQWVSYLWSSFTLLIYA 77

Query: 69  QGLFMIHKPKLIVFSQILVYFTADTVLTCFFTLWFSAQWFQSANEEKHETSAPVGVSQNY 128
           QGLF +H P L+ + QIL+ ++ DT+ TCFFT++F + WF    EE +      G + N 
Sbjct: 78  QGLFQVHHPNLLTYCQILITYSFDTICTCFFTIYFCSHWF---TEESN-----AGDNINS 129

Query: 129 RRSTDLASQGASERYEYXXXXXXXXXXXXXRMYFNFILASFVQELLRHPKYMVDQDDVEQ 188
             + D  +QGASE  E+             R YFNFILASF Q+L  HPKYM+DQDDVEQ
Sbjct: 130 STTVDKYNQGASESKEFFWTMTLTLIALVSRFYFNFILASFTQQLFLHPKYMIDQDDVEQ 189

Query: 189 DLKNKSAIKRWWIKSQKFCY 208
           DLKNKS I +WWIKS+K CY
Sbjct: 190 DLKNKSIIVQWWIKSKKRCY 209

>SAKL0G02508g Chr7 (207823..207855,207940..208593) [687 bp, 228 aa]
           {ON} similar to uniprot|Q06999 Saccharomyces cerevisiae
           YDR367W Protein of unknown function green fluorescent
           protein (GFP)-fusion protein localizes to the cytoplasm
           in a punctate pattern
          Length = 228

 Score =  241 bits (616), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 122/223 (54%), Positives = 149/223 (66%), Gaps = 15/223 (6%)

Query: 6   ISFPKSFFGFLPLYLGVEIVLGITILNKCSGAYGILALFTGHPLDYMQWISYLWSVFTLI 65
           +  PKSF GFLPLY+GVE+ LGI+I NK SG YGILALFTGHPLD+MQW  Y  SV TL+
Sbjct: 7   VHLPKSFLGFLPLYIGVELGLGISIFNKFSGFYGILALFTGHPLDFMQWCFYSLSVLTLL 66

Query: 66  VFSQGLFMIHKPKLIVFSQILVYFTADTVLTCFFTLWFSAQWFQSANEEKHETSAPVGVS 125
           V+  GL+ I KP  + +S +LV FT DT+L CFFT+WFSAQWF  + EE  +    VG S
Sbjct: 67  VYLSGLWQIRKPNPLTYSLVLVVFTIDTLLNCFFTIWFSAQWF--SIEENDDNKGAVGTS 124

Query: 126 -------------QNYRRSTDLASQGASERYEYXXXXXXXXXXXXXRMYFNFILASFVQE 172
                        +  RR+  LASQ AS+ YEY             R YFNFILA+FVQ+
Sbjct: 125 KLQSAGRALGPAKELNRRNNSLASQSASQGYEYTMTMLFTVLTLAVRFYFNFILAAFVQQ 184

Query: 173 LLRHPKYMVDQDDVEQDLKNKSAIKRWWIKSQKFCYKLCRHTL 215
           +LRHPKY+VD+DDVEQDLKNKS  +R  IKS+K+CY  C+  L
Sbjct: 185 MLRHPKYIVDKDDVEQDLKNKSLFRRLCIKSEKWCYNACQRAL 227

>ZYRO0F10010g Chr6 (812835..812861,812941..813540) [627 bp, 208 aa]
           {ON} similar to uniprot|Q06999 Saccharomyces cerevisiae
           YDR367W Protein of unknown function green fluorescent
           protein (GFP)-fusion protein localizes to the cytoplasm
           in a punctate pattern
          Length = 208

 Score =  225 bits (573), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 103/210 (49%), Positives = 140/210 (66%), Gaps = 7/210 (3%)

Query: 6   ISFPKSFFGFLPLYLGVEIVLGITILNKCSGAYGILALFTGHPLDYMQWISYLWSVFTLI 65
           ++ PK F GFLPLY+GVE+ LG+TILNKCSG +GILALFTGHPL+++QW+ YLWS+F+ +
Sbjct: 5   LNLPKRFLGFLPLYIGVEVALGVTILNKCSGLFGILALFTGHPLEFLQWVLYLWSIFSFV 64

Query: 66  VFSQGLFMIHKPKLIVFSQILVYFTADTVLTCFFTLWFSAQWFQSANEEKHETSAPVGVS 125
           V++QGLF   KP L+VFSQI + F+ DT LTC FTLWF+ QW+   +    + S      
Sbjct: 65  VYAQGLFTYSKPSLLVFSQIFIAFSIDTFLTCLFTLWFTNQWYTLEDNTPTQKSIAAAAM 124

Query: 126 QNYRRSTDLASQGASERYEYXXXXXXXXXXXXXRMYFNFILASFVQELLRHPKYMVDQDD 185
           Q         +QGAS+ +E+             R+YFNF+LASFVQ LL+HP+YMVD  D
Sbjct: 125 QE-------PNQGASQSFEFVMTIFITLASLIARLYFNFVLASFVQGLLQHPRYMVDYVD 177

Query: 186 VEQDLKNKSAIKRWWIKSQKFCYKLCRHTL 215
           VEQ+L+ +   KR W ++Q  C +  +  L
Sbjct: 178 VEQELRTQPVWKRVWTRTQIRCLRYSKQLL 207

>Kwal_55.21432 s55 complement(834129..834752) [624 bp, 207 aa] {ON}
           YDR367W - Protein required for cell viability [contig
           130] FULL
          Length = 207

 Score =  217 bits (552), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 106/206 (51%), Positives = 137/206 (66%), Gaps = 10/206 (4%)

Query: 20  LGVEIVLGITILNKCSGAYGILALFTGHPLDYMQWISYLWSVFTLIVFSQGLFMIHKPKL 79
           +GVEI LGIT+LNKCSG YGIL L TGH LD+MQW+ YL S+ T+IV+S GL  I+KP +
Sbjct: 1   MGVEIGLGITVLNKCSGFYGILGLLTGHHLDFMQWVLYLTSIITVIVYSVGLSSIYKPSV 60

Query: 80  IVFSQILVYFTADTVLTCFFTLWFSAQWFQSANEE---KHETSAPVGVSQN-------YR 129
           + +S IL+ FT DT++TCFFTLWFS QWF + N E    + T+       N        +
Sbjct: 61  LSYSLILLTFTTDTLVTCFFTLWFSGQWFSAKNSELTDPNSTTLQSSAGNNSPSGNLISK 120

Query: 130 RSTDLASQGASERYEYXXXXXXXXXXXXXRMYFNFILASFVQELLRHPKYMVDQDDVEQD 189
           R   L+SQ AS+  EY             R YFNFI+ +FVQ LLRHPKY+VDQDDVEQD
Sbjct: 121 RGDTLSSQSASQGTEYFFTILVTIFALATRFYFNFIIMAFVQRLLRHPKYVVDQDDVEQD 180

Query: 190 LKNKSAIKRWWIKSQKFCYKLCRHTL 215
           LK++  ++RWWI+++   YK+CR  L
Sbjct: 181 LKHRGFLRRWWIRAETHSYKICRRYL 206

>NDAI0B05660 Chr2 (1382276..1382761) [486 bp, 161 aa] {ON} Anc_5.433
           YDR367W
          Length = 161

 Score =  210 bits (534), Expect = 4e-69,   Method: Compositional matrix adjust.
 Identities = 100/165 (60%), Positives = 121/165 (73%), Gaps = 6/165 (3%)

Query: 52  MQWISYLWSVFTLIVFSQGLFMIHKPKLIVFSQILVYFTADTVLTCFFTLWFSAQWFQ-S 110
           MQW++YLWS+F LI+F+QGL+ IHKP L+ FSQI V+FT DT+ TCFFTLWF+AQWFQ S
Sbjct: 1   MQWVAYLWSIFCLIIFAQGLYQIHKPTLLTFSQITVFFTLDTLFTCFFTLWFTAQWFQGS 60

Query: 111 ANEEKHETSAPVGVSQNYRRSTDLASQGASERYEYXXXXXXXXXXXXXRMYFNFILASFV 170
             E   +TS  V      +R T LASQGA+  YEY             R YFN ILASFV
Sbjct: 61  EGESAVQTSTGVQ-----KRDTSLASQGATAGYEYFVTMLITFITLTFRFYFNCILASFV 115

Query: 171 QELLRHPKYMVDQDDVEQDLKNKSAIKRWWIKSQKFCYKLCRHTL 215
           QELL +PK+M+DQDDVEQDLKNKS +KRWWIK++KFCY+LC+  L
Sbjct: 116 QELLSNPKFMIDQDDVEQDLKNKSMVKRWWIKNEKFCYRLCKSVL 160

>TBLA0A06520 Chr1 complement(1599308..1599928) [621 bp, 206 aa] {ON}
           Anc_5.433 YDR367W
          Length = 206

 Score =  207 bits (526), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 96/214 (44%), Positives = 136/214 (63%), Gaps = 17/214 (7%)

Query: 3   LNKISFPKSFFGFLPLYLGVEIVLGITILNKCSGAYGILALFTGHPLDYMQWISYLWSVF 62
           + +   PK F G  PLYLGVE+VLGITI NKC GAYGILALF GHPL++ QW+ Y WS+ 
Sbjct: 10  VKRFILPKRFCGVAPLYLGVELVLGITIFNKCGGAYGILALFNGHPLEFAQWVLYTWSIV 69

Query: 63  TLIVFSQGLFMIHKPKLIVFSQILVYFTADTVLTCFFTLWFSAQWFQSANEEKHETSAPV 122
            L +++QGL  +H+P L  FSQ+ ++F+ DT+LTC FT++F+ +WF +     + T+ P 
Sbjct: 70  CLAIYAQGLAKVHRPTLYTFSQVFIFFSVDTLLTCAFTVYFTHEWFAA-----NTTTRPP 124

Query: 123 GVSQNYRRSTDLASQGASERYEYXXXXXXXXXXXXXRMYFNFILASFVQELLRHPKYMVD 182
                       A+QGAS+ YEY             R+YFNFI+ SF+QEL   P Y +D
Sbjct: 125 ------------AAQGASDAYEYSVSLLVTLASLVSRLYFNFIVGSFLQELFFRPAYTLD 172

Query: 183 QDDVEQDLKNKSAIKRWWIKSQKFCYKLCRHTLQ 216
            D+VE +L++ S ++R W+++Q +CY L R  L 
Sbjct: 173 TDEVETELRHSSLLRRLWLQNQHYCYILSRRILS 206

>TBLA0G02010 Chr7 (525436..526077) [642 bp, 213 aa] {ON} Anc_5.433
           YDR367W
          Length = 213

 Score =  197 bits (502), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 96/198 (48%), Positives = 131/198 (66%), Gaps = 5/198 (2%)

Query: 9   PKSFFGFLPLYLGVEIVLGITILNKCSGAYGILALFTGHPLDYMQWISYLWSVFTLIVFS 68
           P SFF   PLYLGVE++LGI ILNKCSG YGILALFTGHPL  +QW++Y+WS+FTL++++
Sbjct: 14  PNSFFILFPLYLGVELILGICILNKCSGFYGILALFTGHPLSIVQWLTYIWSIFTLLIYT 73

Query: 69  QGLFMIHKPKLIVFSQILVYFTADTVLTCFFTLWFSAQWFQSANEEKHETSAPVGVSQNY 128
           QG+F I KP + +FSQI   F+ DT+ T F TL+F+  WF S +  K   ++     Q  
Sbjct: 74  QGMFHIKKPNVYLFSQIFTIFSLDTIFTLFLTLYFALDWFSSDHSNKQSENSL----QRT 129

Query: 129 RRSTDLA-SQGASERYEYXXXXXXXXXXXXXRMYFNFILASFVQELLRHPKYMVDQDDVE 187
            +  +L+  QGAS  YE              R Y+N +LASF+ +L  +PK+++DQDDVE
Sbjct: 130 EKDIELSQKQGASSTYELFLIVIVTLFTLISRCYYNLVLASFLHKLFINPKFIIDQDDVE 189

Query: 188 QDLKNKSAIKRWWIKSQK 205
            DLKNKS  K++   S+K
Sbjct: 190 TDLKNKSFFKKFGGISKK 207

>KLTH0F16082g Chr6 complement(1305673..1306293) [621 bp, 206 aa]
           {ON} similar to uniprot|Q06999 Saccharomyces cerevisiae
           YDR367W Protein of unknown function green fluorescent
           protein (GFP)-fusion protein localizes to the cytoplasm
           in a punctate pattern
          Length = 206

 Score =  192 bits (488), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 106/205 (51%), Positives = 138/205 (67%), Gaps = 9/205 (4%)

Query: 20  LGVEIVLGITILNKCSGAYGILALFTGHPLDYMQWISYLWSVFTLIVFSQGLFMIHKPKL 79
           +GVEI LGITILNKCSG YGIL L TGH LD+MQW+ YL SVFTL+V+S GL  ++KPKL
Sbjct: 1   MGVEIGLGITILNKCSGFYGILGLLTGHQLDFMQWVLYLTSVFTLVVYSLGLTTVYKPKL 60

Query: 80  IVFSQILVYFTADTVLTCFFTLWFSAQWFQSANEEKHETSAPV-----GVSQNYR----R 130
             ++ +L+ FTADT++TCFFTLWFS  WF +   E  + S+       G+S   +    R
Sbjct: 61  QTYAFVLLTFTADTLITCFFTLWFSGMWFAAKESELSDPSSATQQTSGGISSGSKLLTAR 120

Query: 131 STDLASQGASERYEYXXXXXXXXXXXXXRMYFNFILASFVQELLRHPKYMVDQDDVEQDL 190
              L+SQ AS+  EY             R YFNFI+ +FVQ L RHPKY+VDQDDV+QDL
Sbjct: 121 GETLSSQSASQATEYFFTILVSLIALVSRFYFNFIILAFVQRLFRHPKYLVDQDDVDQDL 180

Query: 191 KNKSAIKRWWIKSQKFCYKLCRHTL 215
           K+K   +RWWI+++ + Y++C H L
Sbjct: 181 KHKKLWQRWWIRAENWSYRVCHHYL 205

>AER256C Chr5 complement(1109526..1110152,1110213..1110305) [720 bp,
           239 aa] {ON} Syntenic homolog of Saccharomyces
           cerevisiae YDR367W; 1-intron
          Length = 239

 Score =  190 bits (482), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 97/216 (44%), Positives = 129/216 (59%), Gaps = 5/216 (2%)

Query: 4   NKISFPKSFFGFLPLYLGVEIVLGITILNKCSGAYGILALFTGHPLDYMQWISYLWSVFT 63
           N    PKSFFG LPLY+GVE+ LGI I NK  G +G+LALFTGHPLD +QW+ YLWS  T
Sbjct: 25  NMNHLPKSFFG-LPLYIGVELSLGIAIFNKFCGLFGLLALFTGHPLDILQWLFYLWSFVT 83

Query: 64  LIVFSQGLFMIHKPKLIVFSQILVYFTADTVLTCFFTLWFSAQWFQSAN----EEKHETS 119
           L+V+  GL  I++P+L  +  +LV ++ DT+LTC +TLWF+  WF   +        E  
Sbjct: 84  LLVYLHGLMQIYQPRLAAYCLVLVVYSTDTILTCLYTLWFTRGWFIDGDVGVTATAKEDD 143

Query: 120 APVGVSQNYRRSTDLASQGASERYEYXXXXXXXXXXXXXRMYFNFILASFVQELLRHPKY 179
           A          +  ++ Q AS+ YEY             R Y NF++ASFVQ + +H K+
Sbjct: 144 ADATQGSVTVENEPVSHQSASKSYEYAFTMAFTLFALSLRFYSNFLIASFVQRMFQHNKF 203

Query: 180 MVDQDDVEQDLKNKSAIKRWWIKSQKFCYKLCRHTL 215
               DDVEQDLK+KS   R + K Q++CY LCR  L
Sbjct: 204 AAGCDDVEQDLKHKSVAYRAYAKMQRWCYFLCRRYL 239

>Ecym_4762 Chr4 complement(1482336..1482983,1483049..1483066) [666
           bp, 221 aa] {ON} similar to Ashbya gossypii AER256C
           1-intron
          Length = 221

 Score =  187 bits (475), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 99/224 (44%), Positives = 136/224 (60%), Gaps = 18/224 (8%)

Query: 6   ISFPKSFFGFLPLYLGVEIVLGITILNKCSGAYGILALFTGHPLDYMQWISYLWSVFTLI 65
           +  P+SFFG LPLY+GVE+ LG+ I NK  G YGILALFTG PLD +QW  Y+WS   L+
Sbjct: 2   VYLPQSFFG-LPLYIGVELSLGVAIFNKFCGLYGILALFTGRPLDLIQWGFYVWSFAALL 60

Query: 66  VFSQGLFMIHKPKLIVFSQILVYFTADTVLTCFFTLWFSAQWFQSANEEKHETSAPV--- 122
           VF++GL  ++KPKL+ +  +L  ++ DTVL CFF + F+  WF  + E+    S PV   
Sbjct: 61  VFTKGLSQVYKPKLMTYCMVLTVYSLDTVLACFFAVLFTGDWF--SKEDTSSGSNPVSGK 118

Query: 123 --GV-------SQN--YRRSTDLASQGASERYEYXXXXXXXXXXXXXRMYFNFILASFVQ 171
             GV       +QN  YRR+ D  +Q AS  YEY             R Y NFI+ASFV+
Sbjct: 119 GIGVVDVGKSGTQNFAYRRTVD-DTQSASTHYEYSSTILLTLIVSALRFYSNFIIASFVR 177

Query: 172 ELLRHPKYMVDQDDVEQDLKNKSAIKRWWIKSQKFCYKLCRHTL 215
            +++  +Y+ + DDVE DLKN S   R ++ +Q++CY  CR  L
Sbjct: 178 RMMKQNRYITEPDDVEYDLKNTSVAYRAYVSTQRWCYYFCRRYL 221

>KLLA0E21099g Chr5 complement(1885338..1885976,1886092..1886127)
           [675 bp, 224 aa] {ON} similar to uniprot|Q06999
           Saccharomyces cerevisiae YDR367W Protein of unknown
           function green fluorescent protein (GFP)-fusion protein
           localizes to the cytoplasm in a punctate pattern
          Length = 224

 Score =  176 bits (445), Expect = 9e-55,   Method: Compositional matrix adjust.
 Identities = 83/220 (37%), Positives = 132/220 (60%), Gaps = 9/220 (4%)

Query: 4   NKISFPKSFFGFLPLYLGVEIVLGITILNKCSGAYGILALFTGHPLDYMQWISYLWSVFT 63
           N +  P++F  + PLY+GVE+ LG+   NK SG YG+LALFTGHPLD++QW  Y+WS+F 
Sbjct: 6   NMVHLPQTFLSY-PLYIGVEVALGVLTFNKFSGMYGVLALFTGHPLDFVQWTFYIWSIFC 64

Query: 64  LIVFSQGLFMIHKPKLIVFSQILVYFTADTVLTCFFTLWFSAQWF--QSANEEKHETSAP 121
           L+VF  G+  ++KP +++ S +   F+ DT+++C + LWF+A WF  + + +     SA 
Sbjct: 65  LVVFISGIRQVYKPNILLMSTVTFVFSVDTIVSCIYCLWFTAVWFSQEGSTDVTDLKSAG 124

Query: 122 VGVSQNYRRSTDL------ASQGASERYEYXXXXXXXXXXXXXRMYFNFILASFVQELLR 175
             +   +  +T         S+ AS  YE+             R YFNFI+ +F Q+LLR
Sbjct: 125 TALGPAHEGTTSTISTKVDTSKSASSGYEFFLIILLTLVPLAVRFYFNFIIIAFQQQLLR 184

Query: 176 HPKYMVDQDDVEQDLKNKSAIKRWWIKSQKFCYKLCRHTL 215
             K+  DQ+D+E +L N++ + +W  K +K+C+ LC+  L
Sbjct: 185 SGKFTFDQNDIEVNLHNRNILFKWRYKFEKWCFYLCKRYL 224

>SAKL0G16236g Chr7 (1403769..1405796) [2028 bp, 675 aa] {ON} weakly
           similar to uniprot|P34231 Saccharomyces cerevisiae
           YKL187C and weakly similar to uniprot|Q06689
           Saccharomyces cerevisiae YLR413W
          Length = 675

 Score = 29.6 bits (65), Expect = 7.4,   Method: Composition-based stats.
 Identities = 24/70 (34%), Positives = 37/70 (52%), Gaps = 6/70 (8%)

Query: 2   RLNKISFPKSFFGFLPLYLGVEIVLGITILNKCSGA----YGILALFTGHPLDYMQWISY 57
           RL  IS   S   FL   LG  IV  +T + K SG+    YG++    G P + + W ++
Sbjct: 558 RLLLISRILSILVFLFAILGAAIVAALTHIIK-SGSKDDDYGVI-YKAGSPYNGLVWTAF 615

Query: 58  LWSVFTLIVF 67
           + S+FT+I+ 
Sbjct: 616 VLSLFTMILL 625

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.328    0.139    0.446 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 21,228,868
Number of extensions: 793831
Number of successful extensions: 2471
Number of sequences better than 10.0: 26
Number of HSP's gapped: 2484
Number of HSP's successfully gapped: 26
Length of query: 216
Length of database: 53,481,399
Length adjustment: 105
Effective length of query: 111
Effective length of database: 41,441,469
Effective search space: 4600003059
Effective search space used: 4600003059
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 63 (28.9 bits)