Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
CAGL0A02706g5.425ON36935714800.0
KAFR0E038705.425ON3962774553e-52
ZYRO0F09812g5.425ON4162644303e-48
SAKL0G02266g5.425ON4842653651e-38
KNAG0C049805.425ON3452523171e-32
Kwal_55.214685.425ON4652683123e-31
YDR363W (ESC2)5.425ON4561283097e-31
AER251W5.425ON4072503042e-30
Suva_2.5345.425ON4521283011e-29
KLTH0F16280g5.425ON4732673011e-29
NDAI0B056005.425ON4571332913e-28
Smik_4.6285.425ON4581282913e-28
NCAS0F033105.425ON4421272869e-28
Skud_4.6315.425ON4581282737e-26
TPHA0E018105.425ON4531252508e-23
TBLA0A037105.425ON4611302446e-22
KLLA0E21275g5.425ON3922712392e-21
Ecym_55245.425ON415772118e-18
Kpol_1027.265.425ON4431382064e-17
TDEL0E020005.425ON436811994e-16
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0A02706g
         (369 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0A02706g Chr1 (290595..291704) [1110 bp, 369 aa] {ON} simila...   574   0.0  
KAFR0E03870 Chr5 (768042..769232) [1191 bp, 396 aa] {ON} Anc_5.4...   179   3e-52
ZYRO0F09812g Chr6 (797169..798419) [1251 bp, 416 aa] {ON} weakly...   170   3e-48
SAKL0G02266g Chr7 (190967..192421) [1455 bp, 484 aa] {ON} some s...   145   1e-38
KNAG0C04980 Chr3 complement(958989..960026) [1038 bp, 345 aa] {O...   126   1e-32
Kwal_55.21468 s55 complement(851687..853084) [1398 bp, 465 aa] {...   124   3e-31
YDR363W Chr4 (1199183..1200553) [1371 bp, 456 aa] {ON}  ESC2Sumo...   123   7e-31
AER251W Chr5 (1099999..1101222) [1224 bp, 407 aa] {ON} Syntenic ...   121   2e-30
Suva_2.534 Chr2 (956062..957420) [1359 bp, 452 aa] {ON} YDR363W ...   120   1e-29
KLTH0F16280g Chr6 complement(1321305..1322726) [1422 bp, 473 aa]...   120   1e-29
NDAI0B05600 Chr2 (1369512..1370885) [1374 bp, 457 aa] {ON} Anc_5...   116   3e-28
Smik_4.628 Chr4 (1125627..1127003) [1377 bp, 458 aa] {ON} YDR363...   116   3e-28
NCAS0F03310 Chr6 (670533..671861) [1329 bp, 442 aa] {ON} Anc_5.4...   114   9e-28
Skud_4.631 Chr4 (1128086..1129462) [1377 bp, 458 aa] {ON} YDR363...   109   7e-26
TPHA0E01810 Chr5 complement(364173..365534) [1362 bp, 453 aa] {O...   100   8e-23
TBLA0A03710 Chr1 (928023..929408) [1386 bp, 461 aa] {ON} Anc_5.4...    99   6e-22
KLLA0E21275g Chr5 complement(1900927..1902105) [1179 bp, 392 aa]...    97   2e-21
Ecym_5524 Chr5 (1062240..1063487) [1248 bp, 415 aa] {ON} similar...    86   8e-18
Kpol_1027.26 s1027 complement(53549..54880) [1332 bp, 443 aa] {O...    84   4e-17
TDEL0E02000 Chr5 complement(379082..380392) [1311 bp, 436 aa] {O...    81   4e-16

>CAGL0A02706g Chr1 (290595..291704) [1110 bp, 369 aa] {ON} similar
           to uniprot|Q06340 Saccharomyces cerevisiae YDR363w ESC2
          Length = 369

 Score =  574 bits (1480), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/357 (82%), Positives = 294/357 (82%)

Query: 13  MGTSEDVEERLQQAMASRAPQAPNAEPAPVQXXXXXXXXXXXXXXXGPSQEQVRGQDVVV 72
           MGTSEDVEERLQQAMASRAPQAPNAEPAPVQ               GPSQEQVRGQDVVV
Sbjct: 13  MGTSEDVEERLQQAMASRAPQAPNAEPAPVQEPHAEAEAELEPEAEGPSQEQVRGQDVVV 72

Query: 73  IXXXXXXXXXXXXXXXXXXXXXXAQDTYRGDKEYEVRTRSGMKRARTVEDENDLFFQSIA 132
           I                      AQDTYRGDKEYEVRTRSGMKRARTVEDENDLFFQSIA
Sbjct: 73  IEGDTEGSGSEGSSDSEGSSDSGAQDTYRGDKEYEVRTRSGMKRARTVEDENDLFFQSIA 132

Query: 133 KRSQSLPVQDGSGAVRQDKVYYVQFISHVDGTKGKSVQVKALGSHPFSKLVAAALSGLMR 192
           KRSQSLPVQDGSGAVRQDKVYYVQFISHVDGTKGKSVQVKALGSHPFSKLVAAALSGLMR
Sbjct: 133 KRSQSLPVQDGSGAVRQDKVYYVQFISHVDGTKGKSVQVKALGSHPFSKLVAAALSGLMR 192

Query: 193 AHRLPSVMRPLYQPESVVSYWNRAKVLGFMTCDTLRVPQRYGSDYLEIQLVPVKEEAQYL 252
           AHRLPSVMRPLYQPESVVSYWNRAKVLGFMTCDTLRVPQRYGSDYLEIQLVPVKEEAQYL
Sbjct: 193 AHRLPSVMRPLYQPESVVSYWNRAKVLGFMTCDTLRVPQRYGSDYLEIQLVPVKEEAQYL 252

Query: 253 EQEVFXXXXXXXXXXXXXXXXXXXXXXXXXXVRAPVVDLESEEVLRVALQGQDNKKVYVN 312
           EQEVF                          VRAPVVDLESEEVLRVALQGQDNKKVYVN
Sbjct: 253 EQEVFEEPERAPTPEEDAEEEFERELRDAKEVRAPVVDLESEEVLRVALQGQDNKKVYVN 312

Query: 313 VKPTTTFARMIEYYRTQKQLPRSTQITLALDDEPLDPHATVKSQDIEDEDMLEVRLS 369
           VKPTTTFARMIEYYRTQKQLPRSTQITLALDDEPLDPHATVKSQDIEDEDMLEVRLS
Sbjct: 313 VKPTTTFARMIEYYRTQKQLPRSTQITLALDDEPLDPHATVKSQDIEDEDMLEVRLS 369

>KAFR0E03870 Chr5 (768042..769232) [1191 bp, 396 aa] {ON} Anc_5.425
           YDR363W
          Length = 396

 Score =  179 bits (455), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 98/277 (35%), Positives = 154/277 (55%), Gaps = 19/277 (6%)

Query: 109 RTRSGMKRARTVEDENDLFFQSIAKRSQSLPVQDG-SGAVRQDKVYYVQFISHVDGTKGK 167
           R +S +       DEND FF+ +A  +Q   V    S A R  ++Y ++FIS +DG+  K
Sbjct: 117 RQKSFISETAEDSDENDDFFKELATVAQKKSVTGTESAAKRPKRIYNIRFISKLDGSINK 176

Query: 168 SVQVKALGSHPFSKLVAAALSGLMRAHRLPSVMRPLYQPESVVSYWNRAKVLGFMTCDTL 227
           SV+VK LG  PFSK++ AAL GL+ A+++PS+M  +Y  E+V  YWN AK+L FMTCD+L
Sbjct: 177 SVKVKVLGKFPFSKILPAALKGLIDAYKIPSIMSEIYDVENVGLYWNNAKLLNFMTCDSL 236

Query: 228 RVPQRYGSDYLEIQLVPVK----EEAQYLEQEVFXXXXXXXXXXXXXXXXXXXXXXXXXX 283
            +P  + ++   + ++ V     E+ + L+Q                             
Sbjct: 237 SIPLAFENEISNVDILIVSKEFGEKLEKLDQMKTLQEEAKLERQEEIKDVDEGDDFVLKE 296

Query: 284 VRAPVVDL--------------ESEEVLRVALQGQDNKKVYVNVKPTTTFARMIEYYRTQ 329
             A + D+              +SE ++++AL GQDNKK+YVNV+ +T  ++++EYY+ Q
Sbjct: 297 FEAELRDVAPSNANLSLDTDGEDSEPLMKLALMGQDNKKIYVNVRSSTQISKLVEYYKKQ 356

Query: 330 KQLPRSTQITLALDDEPLDPHATVKSQDIEDEDMLEV 366
           K L R+ ++ L  D + LD + TV  QD+EDEDM++V
Sbjct: 357 KNLARNVKVKLLFDHDELDLNETVGDQDMEDEDMIDV 393

>ZYRO0F09812g Chr6 (797169..798419) [1251 bp, 416 aa] {ON} weakly
           similar to uniprot|Q06340 YDR363W Saccharomyces
           cerevisiae ESC2 Protein involved in mating- type locus
           silencing interacts with Sir2p
          Length = 416

 Score =  170 bits (430), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 88/264 (33%), Positives = 150/264 (56%), Gaps = 19/264 (7%)

Query: 122 DENDLFFQSIAKRSQSLPVQDGSGAVRQDK-VYYVQFISHVDGTKGKSVQVKALGSHPFS 180
           DEND FF+ IAK     P+        Q + +Y V+F+S +DG+  K+VQ+K LG + F+
Sbjct: 150 DENDEFFKQIAKDFNHTPLGTRETTPEQPRRIYNVRFLSKLDGSIDKAVQIKVLGKYDFA 209

Query: 181 KLVAAALSGLMRAHRLPSVMRPLYQPESVVSYWNRAKVLGFMTCDTLRVPQRYGSDY--L 238
            ++ + L+G +R +++P+VM+ +Y  E+V  YW  AK+L FMTC++L++PQ + ++   +
Sbjct: 210 SMLPSVLNGFIREYKIPNVMKKIYSQENVTLYWKTAKLLNFMTCNSLKIPQAFENEISDI 269

Query: 239 EIQLVPVKEEAQY--------LEQE-----VFXXXXXXXXXXXXXXXXXXXXXXXXXXVR 285
           +I ++P ++E ++        LE E                                   
Sbjct: 270 DITVIPKEKENEFEQMINSRLLEDEQNPPDTAETGNLDARVEEFEKELKNVDNSTTNHET 329

Query: 286 APVVDLESE---EVLRVALQGQDNKKVYVNVKPTTTFARMIEYYRTQKQLPRSTQITLAL 342
             ++DLE E   +++++AL G+DNKK++VNV+ TT   ++ EYYR +K+LP+   I L  
Sbjct: 330 TELIDLEDEGDTDLMKIALVGEDNKKIFVNVRNTTILTKVAEYYRIKKKLPKDINIKLIF 389

Query: 343 DDEPLDPHATVKSQDIEDEDMLEV 366
           D E L+ + ++  QD+EDEDM+EV
Sbjct: 390 DHEELNLNESIGDQDMEDEDMIEV 413

>SAKL0G02266g Chr7 (190967..192421) [1455 bp, 484 aa] {ON} some
           similarities with uniprot|Q06340 YDR363W Saccharomyces
           cerevisiae ESC2 Protein involved in mating- type locus
           silencing interacts with Sir2p
          Length = 484

 Score =  145 bits (365), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 82/265 (30%), Positives = 141/265 (53%), Gaps = 18/265 (6%)

Query: 121 EDENDLFFQSIAKRSQ--SLPVQDGSGAVRQDKVYYVQFISHVDGTKGKSVQVKALGSHP 178
           ED+ D FF  I + +   S  +++ S  + + + Y + FIS + G+  K ++VKA G  P
Sbjct: 220 EDDTDAFFTEITRNANRTSTVIRESSPELDK-RTYKISFISKLKGSIDKKIEVKAWGKSP 278

Query: 179 FSKLVAAALSGLMRAHRLPSVMRPLYQPESVVSYWNRAKVLGFMTCDTLRVPQRYGSDYL 238
           F+K++ + L  +++A+R+P  ++ +Y+ ++V  YWN AK+L FMTC++LR+PQ YG +  
Sbjct: 279 FTKILPSTLDAIVKAYRIPKAIQNVYKMDNVTLYWNGAKILNFMTCNSLRIPQNYGDEIT 338

Query: 239 EIQLVPV------KEEAQY---LEQEVFXXXXXXXXXXXXXXXXXXXXXXXXXXVRAPVV 289
           ++ +  V      K EA++   +E E+                             A   
Sbjct: 339 DVDITLVSKEYEMKYEAEFKEMVENELSGSSVDVKNVKKDDFATNEYELQLEKSESAEPS 398

Query: 290 DLESEEVLR------VALQGQDNKKVYVNVKPTTTFARMIEYYRTQKQLPRSTQITLALD 343
            L+S E +R      +AL GQDNKK++V  + +T F ++ +YY+  K LP  T++ L  D
Sbjct: 399 LLKSSENIRDGSFIKLALVGQDNKKMFVKARSSTLFKKIADYYKDVKNLPSFTKLKLTFD 458

Query: 344 DEPLDPHATVKSQDIEDEDMLEVRL 368
              L     V+  ++EDEDM+EV +
Sbjct: 459 HVNLSLEDRVEDHEMEDEDMIEVAI 483

>KNAG0C04980 Chr3 complement(958989..960026) [1038 bp, 345 aa] {ON}
           Anc_5.425 YDR363W
          Length = 345

 Score =  126 bits (317), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 77/252 (30%), Positives = 130/252 (51%), Gaps = 4/252 (1%)

Query: 117 ARTVEDENDLFFQSIAK-RSQSL-PVQDGSGAVRQDKVYYVQFISHVDGTKGKSVQVKAL 174
           A +  D+ + FFQ + + R+QS+ P +  + +     VY V+F S ++GT GKSVQVK +
Sbjct: 94  AESGPDDEEQFFQELLRARTQSVEPAETATTSTVPSPVYRVRFQSQLEGTLGKSVQVKVI 153

Query: 175 GSHPFSKLVAAALSGLMRAHRLPSVMRPLYQPESVVSYWNRAKVLGFMTCDTLRVPQRYG 234
           G+ P   ++ + LS L+RA R+P V++  Y   +V  Y   A+VL FM C++L V Q + 
Sbjct: 154 GTRPLGTVLPSVLSALVRACRVPQVLQGGYTEGAVGMYRGGARVLPFMNCNSLGVVQEFE 213

Query: 235 SDYLEIQLVPVKEEAQYLEQEVFXXXXXXXXXXXXXXXXXXXXXXXXXXVRAPVVDLESE 294
           ++ LE+ +V      +    +V                             +P     + 
Sbjct: 214 NEVLEVDVVLRALNLETPASDVSGGQEATNGTEAAASVPVPVPAPATAASESP--GNPAP 271

Query: 295 EVLRVALQGQDNKKVYVNVKPTTTFARMIEYYRTQKQLPRSTQITLALDDEPLDPHATVK 354
            ++++AL   DN+++YV V   T  +R++EYYR ++ LP    + L LDDE + P   + 
Sbjct: 272 ALMKIALLSADNRRLYVKVHGGTPCSRLLEYYRMERGLPAGAPLQLRLDDEQVSPETHIS 331

Query: 355 SQDIEDEDMLEV 366
             D+ED D+LE+
Sbjct: 332 ELDLEDGDVLEI 343

>Kwal_55.21468 s55 complement(851687..853084) [1398 bp, 465 aa] {ON}
           YDR363W (ESC2) - establishes silent chromatin [contig
           130] FULL
          Length = 465

 Score =  124 bits (312), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 77/268 (28%), Positives = 131/268 (48%), Gaps = 27/268 (10%)

Query: 121 EDENDLFFQSI---AKRSQSLPVQDGSGAVRQDKVYYVQFISHVDGTKGKSVQVKALGSH 177
           ++E++ FF+ +   A R+ S  +++GS A  + +VY ++F+S+++G+    + VK  G H
Sbjct: 200 DNEDEKFFEELQREAGRTTST-LKEGSPATAK-RVYNIKFLSNLEGSLNDKINVKVKGKH 257

Query: 178 PFSKLVAAALSGLMRAHRLPSVMRPLYQPESVVSYWNRAKVLGFMTCDTLRVPQRYGSDY 237
            FS+++  AL  L++ +++   ++P YQPE+V  Y N  K+L FM C++L +P  Y  + 
Sbjct: 258 AFSEILPIALKTLIKEYKVSKDLKPFYQPENVSLYRNGLKILNFMNCNSLHIPLNYEGEV 317

Query: 238 LEIQLVPVKEEAQYLEQEVFXXXXXXXXXXXXXXXXXXXXXXXXXXVRAPVVDLESEE-- 295
            ++ +  V  +    EQE                            +     DLE  E  
Sbjct: 318 SDVSMTLVSRDR---EQEYVKTLEQSRHATPDLSREETSPKIPGFSIEEFEKDLEGFESG 374

Query: 296 -----------------VLRVALQGQDNKKVYVNVKPTTTFARMIEYYRTQKQLPRSTQI 338
                             +++AL  QDNKK+YVNV+ TTT A + E+YRT K L    + 
Sbjct: 375 ESNNLLEDTPQTENNHGTIKIALMAQDNKKIYVNVRQTTTIAMLGEHYRTTKNLSSIERF 434

Query: 339 TLALDDEPLDPHATVKSQDIEDEDMLEV 366
               D+E L     +   D+ED D++EV
Sbjct: 435 KFVFDNEDLQLSTKIDDLDMEDGDIIEV 462

>YDR363W Chr4 (1199183..1200553) [1371 bp, 456 aa] {ON}
           ESC2Sumo-like domain protein; prevents accumulation of
           toxic intermediates during replication-associated
           recombinational repair; roles in silencing, lifespan,
           chromatid cohesion and the intra-S-phase DNA damage
           checkpoint; RENi family member
          Length = 456

 Score =  123 bits (309), Expect = 7e-31,   Method: Compositional matrix adjust.
 Identities = 54/128 (42%), Positives = 90/128 (70%), Gaps = 1/128 (0%)

Query: 122 DENDLFFQSIAKRSQ-SLPVQDGSGAVRQDKVYYVQFISHVDGTKGKSVQVKALGSHPFS 180
           DEND FF+ +AK ++ S  +   S   ++ +VY ++F+S ++GT  K+VQVK LG + FS
Sbjct: 168 DENDDFFKELAKEAKKSTTISKESTPDQRKRVYNIKFLSKLEGTINKAVQVKVLGKYEFS 227

Query: 181 KLVAAALSGLMRAHRLPSVMRPLYQPESVVSYWNRAKVLGFMTCDTLRVPQRYGSDYLEI 240
           K++ AAL GLM+++++P VM+ +Y+ E+V  YWN AK+L FMTC++L +PQ + ++  +I
Sbjct: 228 KILPAALDGLMKSYKIPKVMKDIYKVENVTLYWNNAKLLTFMTCNSLHIPQDFENEVSDI 287

Query: 241 QLVPVKEE 248
            +  V +E
Sbjct: 288 DVTIVSKE 295

 Score = 89.4 bits (220), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 39/73 (53%), Positives = 57/73 (78%)

Query: 294 EEVLRVALQGQDNKKVYVNVKPTTTFARMIEYYRTQKQLPRSTQITLALDDEPLDPHATV 353
           EEV+R+AL GQDNKK+YV+V+ +T F+++ EYYR QKQLP+ T++ L  D + LD +  +
Sbjct: 381 EEVMRIALMGQDNKKIYVHVRRSTPFSKIAEYYRIQKQLPQKTRVKLLFDHDELDMNECI 440

Query: 354 KSQDIEDEDMLEV 366
             QD+EDEDM++V
Sbjct: 441 ADQDMEDEDMVDV 453

>AER251W Chr5 (1099999..1101222) [1224 bp, 407 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR363W (ESC2)
          Length = 407

 Score =  121 bits (304), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 74/250 (29%), Positives = 117/250 (46%), Gaps = 26/250 (10%)

Query: 143 GSGAVRQD-KVYYVQFISHVDGTKGKSVQVKALGSHPFSKLVAAALSGLMRAHRLPSVMR 201
           G G    D +VY V FIS ++G++ + V VK  G   F+  +A AL+   + H +   ++
Sbjct: 155 GKGGRDTDARVYNVGFISRIEGSRNRRVNVKVTGQKQFATFLAIALAAFSKQHNIRKSLK 214

Query: 202 PLYQPESVVSYWNRAKVLGFMTCDTLRVPQRYGSDY--LEIQLVPVKEEAQY-------- 251
           P YQ + V  Y    +V  FMTCD+  + + Y +    +E+ +VPV E   +        
Sbjct: 215 PKYQADQVKIYREGVEVFKFMTCDSFNIEEPYNASATDIEVYIVPVDEATAFEQEWKRKF 274

Query: 252 ------LEQEVFXXXXXXX---------XXXXXXXXXXXXXXXXXXXVRAPVVDLESEEV 296
                 L    F                                   VR      ES ++
Sbjct: 275 EERVRMLSNSSFLEVMDDIEDDNDDFLVNEYEKALVNARSLNETELAVREGTPADESSQL 334

Query: 297 LRVALQGQDNKKVYVNVKPTTTFARMIEYYRTQKQLPRSTQITLALDDEPLDPHATVKSQ 356
           L++ L G DNKKV+++V+PTTT  ++ E+YR  K+LP + Q++L  D E +D   T+ + 
Sbjct: 335 LKIVLLGSDNKKVFIHVRPTTTLLKVAEHYRVAKELPPTVQLSLMFDHEEIDLDDTICNI 394

Query: 357 DIEDEDMLEV 366
           DIED D++EV
Sbjct: 395 DIEDGDIIEV 404

>Suva_2.534 Chr2 (956062..957420) [1359 bp, 452 aa] {ON} YDR363W
           (REAL)
          Length = 452

 Score =  120 bits (301), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 52/128 (40%), Positives = 88/128 (68%), Gaps = 1/128 (0%)

Query: 122 DENDLFFQSIAKRSQ-SLPVQDGSGAVRQDKVYYVQFISHVDGTKGKSVQVKALGSHPFS 180
           DEND FF+ +AK ++ +  +   S   +  +VY ++F S ++GT  K+VQVK LG + FS
Sbjct: 164 DENDDFFKELAKEAKKTTSISKESTPDQPKRVYNIKFFSKLEGTINKAVQVKVLGKYEFS 223

Query: 181 KLVAAALSGLMRAHRLPSVMRPLYQPESVVSYWNRAKVLGFMTCDTLRVPQRYGSDYLEI 240
           +++ AAL GLM+++++P VM+ +Y+ E+V  YWN AK+L FMTC++L +PQ + ++  +I
Sbjct: 224 RILPAALDGLMKSYKIPKVMKDIYKEENVTLYWNNAKLLKFMTCNSLHIPQDFENEISDI 283

Query: 241 QLVPVKEE 248
            +  V +E
Sbjct: 284 DITIVSKE 291

 Score = 85.5 bits (210), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 37/74 (50%), Positives = 56/74 (75%)

Query: 293 SEEVLRVALQGQDNKKVYVNVKPTTTFARMIEYYRTQKQLPRSTQITLALDDEPLDPHAT 352
           +E+V+++AL GQDNKK+YVNV+ +T F ++ EYYR QKQLP+  +I L  D + L+ +  
Sbjct: 376 NEKVMKIALMGQDNKKIYVNVRNSTPFFKVAEYYRIQKQLPQKARIKLLFDHDELNLNEC 435

Query: 353 VKSQDIEDEDMLEV 366
           +  QD+EDEDM++V
Sbjct: 436 IADQDMEDEDMVDV 449

>KLTH0F16280g Chr6 complement(1321305..1322726) [1422 bp, 473 aa]
           {ON} some similarities with uniprot|Q06340 YDR363W
           Saccharomyces cerevisiae ESC2 Protein involved in
           mating- type locus silencing interacts with Sir2p
          Length = 473

 Score =  120 bits (301), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 74/267 (27%), Positives = 133/267 (49%), Gaps = 26/267 (9%)

Query: 122 DENDLFFQSI---AKRSQSLPVQDGSGAVRQDKVYYVQFISHVDGTKGKSVQVKALGSHP 178
           DE+D FF+ +   A R+ S  V++ S AV Q ++Y ++FIS ++G+ G+ + VK  G   
Sbjct: 206 DEDDKFFEELEREASRTAST-VKESSPAVAQ-RIYNIKFISDLEGSAGRRINVKVKGKQS 263

Query: 179 FSKLVAAALSGLMRAHRLPSVMRPLYQPESVVSYWNRAKVLGFMTCDTLRVPQRYGSDYL 238
           F +++  AL  +++ +++P  + P+Y+ + V  Y +  K+L FM C++L++P  +  +  
Sbjct: 264 FDQILPVALKTIIKEYKIPDALHPIYETDKVTLYRDGVKILNFMNCNSLQIPLEFKGEVS 323

Query: 239 EIQLVPVKE------EAQYLEQEVFXXXXXXXXXXXXXXXXXXXXXXXXXXVRAPVVDLE 292
           ++ L  + +      EA Y + +                            +R   VD  
Sbjct: 324 DVCLTIISKGQEQNFEALYEQSKHSNHELVPAFIEPGTETPDFTVEEYEKELRN--VDFN 381

Query: 293 S-------------EEVLRVALQGQDNKKVYVNVKPTTTFARMIEYYRTQKQLPRSTQIT 339
                         ++ +R+AL  QDNKK+ V  +P TTFA + E+Y+    LP   Q+ 
Sbjct: 382 KNTSVQNQPPPQSVDDNIRIALMSQDNKKIIVTARPETTFAALAEHYQKLTSLPPQQQVL 441

Query: 340 LALDDEPLDPHATVKSQDIEDEDMLEV 366
           L  D+E L   + V   D+ED+D++EV
Sbjct: 442 LFFDNEELHLDSKVSDADVEDDDIVEV 468

>NDAI0B05600 Chr2 (1369512..1370885) [1374 bp, 457 aa] {ON}
           Anc_5.425 YDR363W
          Length = 457

 Score =  116 bits (291), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 53/133 (39%), Positives = 89/133 (66%), Gaps = 4/133 (3%)

Query: 122 DENDLFFQSIAKRSQSLP--VQDGSGAVRQDKVYYVQFISHVDGTKGKSVQVKALGSHPF 179
           DEND FF+ IAK ++ +P   ++ +      ++Y ++FIS +DGT  K VQVK LG   F
Sbjct: 165 DENDEFFKEIAKEAKKIPSLTKESTPDKLPKRIYNIRFISKLDGTMNKCVQVKVLGKFQF 224

Query: 180 SKLVAAALSGLMRAHRLPSVMRPLYQPESVVSYWNRAKVLGFMTCDTLRVPQRYGSDY-- 237
            K++ AAL+GL++A+ +PSV++  Y  ++V  YWN AK+L FMTC++L +PQ + ++   
Sbjct: 225 QKILPAALTGLIKAYSIPSVLQKYYSVDNVSLYWNHAKLLDFMTCNSLNIPQAFENEVTN 284

Query: 238 LEIQLVPVKEEAQ 250
           ++I+L+   +E +
Sbjct: 285 VDIELISKDDEIE 297

 Score = 68.2 bits (165), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 30/58 (51%), Positives = 44/58 (75%)

Query: 295 EVLRVALQGQDNKKVYVNVKPTTTFARMIEYYRTQKQLPRSTQITLALDDEPLDPHAT 352
           +V+++AL GQDNKK++VNV+ TT F+++ EYYR QKQLP++ +I L  D E L  + T
Sbjct: 383 DVMKIALVGQDNKKIHVNVRGTTPFSKVAEYYRIQKQLPQNAKIKLVFDHEELSLYET 440

>Smik_4.628 Chr4 (1125627..1127003) [1377 bp, 458 aa] {ON} YDR363W
           (REAL)
          Length = 458

 Score =  116 bits (291), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 51/128 (39%), Positives = 88/128 (68%), Gaps = 1/128 (0%)

Query: 122 DENDLFFQSIAKRSQ-SLPVQDGSGAVRQDKVYYVQFISHVDGTKGKSVQVKALGSHPFS 180
           DEND FF+ +AK ++ +  V   S   ++ +VY ++F+S ++GT  K+VQVK LG + FS
Sbjct: 170 DENDDFFKELAKEAKKTTSVSKESTPDQRKRVYNIKFLSKLEGTINKAVQVKVLGKYEFS 229

Query: 181 KLVAAALSGLMRAHRLPSVMRPLYQPESVVSYWNRAKVLGFMTCDTLRVPQRYGSDYLEI 240
           +++ AAL GL +++++P VM+ +Y+ E+V  YW  AK+L FMTC++L +PQ + ++  +I
Sbjct: 230 RILPAALDGLTKSYKIPKVMKDIYKVENVTLYWKNAKLLDFMTCNSLHIPQDFENEVSDI 289

Query: 241 QLVPVKEE 248
            +  V +E
Sbjct: 290 DVTIVSKE 297

 Score = 93.6 bits (231), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 40/75 (53%), Positives = 59/75 (78%)

Query: 292 ESEEVLRVALQGQDNKKVYVNVKPTTTFARMIEYYRTQKQLPRSTQITLALDDEPLDPHA 351
           +SE+V+++AL+GQDNKK+YVNV+ +T F+++ EYYR QKQLP+  +I L  D + LD H 
Sbjct: 381 DSEKVMKIALRGQDNKKIYVNVRRSTPFSKVAEYYRIQKQLPQKARIKLLFDHDKLDMHE 440

Query: 352 TVKSQDIEDEDMLEV 366
            +  QD+EDEDM++V
Sbjct: 441 CIADQDMEDEDMIDV 455

>NCAS0F03310 Chr6 (670533..671861) [1329 bp, 442 aa] {ON} Anc_5.425
           YDR363W
          Length = 442

 Score =  114 bits (286), Expect = 9e-28,   Method: Compositional matrix adjust.
 Identities = 51/127 (40%), Positives = 82/127 (64%), Gaps = 5/127 (3%)

Query: 122 DENDLFFQSIAKRSQSLP-VQDGSGAVRQDK----VYYVQFISHVDGTKGKSVQVKALGS 176
           DEND FF+ IAK ++ LP + D S     DK    VY ++F+S +DGT  K+VQVK LG 
Sbjct: 148 DENDEFFKEIAKEAKKLPSITDRSKEATPDKQPKRVYSIRFLSQLDGTINKTVQVKVLGK 207

Query: 177 HPFSKLVAAALSGLMRAHRLPSVMRPLYQPESVVSYWNRAKVLGFMTCDTLRVPQRYGSD 236
             F K++   L GL++++ +P+V++  Y+ ++V  YWN  K+L FMTC++L +PQ + ++
Sbjct: 208 FQFVKILPPTLEGLIKSYSIPTVLQKFYKVDNVTLYWNNTKLLNFMTCNSLNIPQAFENE 267

Query: 237 YLEIQLV 243
              + +V
Sbjct: 268 VTNVDIV 274

 Score = 87.4 bits (215), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 39/77 (50%), Positives = 56/77 (72%)

Query: 290 DLESEEVLRVALQGQDNKKVYVNVKPTTTFARMIEYYRTQKQLPRSTQITLALDDEPLDP 349
           D E   ++++AL G DNKK+YVNV+ +T F+++ EYYR QKQLP++ +I L  D + L+ 
Sbjct: 363 DNEKSSIMKIALVGHDNKKIYVNVRNSTPFSKLAEYYRLQKQLPQAAKIQLMFDHDELNL 422

Query: 350 HATVKSQDIEDEDMLEV 366
             TV  QD+EDEDM+EV
Sbjct: 423 EETVGDQDMEDEDMIEV 439

>Skud_4.631 Chr4 (1128086..1129462) [1377 bp, 458 aa] {ON} YDR363W
           (REAL)
          Length = 458

 Score =  109 bits (273), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 50/128 (39%), Positives = 84/128 (65%), Gaps = 1/128 (0%)

Query: 122 DENDLFFQSIAKRSQSLPVQDGSGAVRQDK-VYYVQFISHVDGTKGKSVQVKALGSHPFS 180
           DEND FF+ +AK ++ +          Q K VY ++F+S ++GT  K+VQVK LG + FS
Sbjct: 170 DENDDFFKELAKEAKKITTISKEPTPEQPKRVYNIKFLSKLEGTINKAVQVKVLGKYEFS 229

Query: 181 KLVAAALSGLMRAHRLPSVMRPLYQPESVVSYWNRAKVLGFMTCDTLRVPQRYGSDYLEI 240
           +++ AAL GL++++++P VM  +Y+  +V  YWN AK+L FMTC++L + Q + ++  +I
Sbjct: 230 RILPAALDGLVKSYKIPKVMISIYKVGNVTLYWNNAKLLNFMTCNSLNISQDFENEISDI 289

Query: 241 QLVPVKEE 248
            +  V +E
Sbjct: 290 DVTIVSKE 297

 Score = 78.2 bits (191), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 35/75 (46%), Positives = 55/75 (73%)

Query: 292 ESEEVLRVALQGQDNKKVYVNVKPTTTFARMIEYYRTQKQLPRSTQITLALDDEPLDPHA 351
           ++E+V+++AL GQDNKK++VNV+ +T   ++ EYYR QK+LP+  +I L  D + L+   
Sbjct: 381 DTEKVIKLALMGQDNKKIHVNVRNSTPLFKVAEYYRIQKRLPQKARIRLLFDHDELNMSE 440

Query: 352 TVKSQDIEDEDMLEV 366
            V  QD+EDEDM++V
Sbjct: 441 CVADQDMEDEDMIDV 455

>TPHA0E01810 Chr5 complement(364173..365534) [1362 bp, 453 aa] {ON}
           Anc_5.425 YDR363W
          Length = 453

 Score =  100 bits (250), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 41/125 (32%), Positives = 82/125 (65%), Gaps = 1/125 (0%)

Query: 122 DENDLFFQSIAKRSQSLPVQDGSGAVR-QDKVYYVQFISHVDGTKGKSVQVKALGSHPFS 180
           D +D FF++I + S+       SG     ++ Y + +IS ++G++ + +Q K LG+  F+
Sbjct: 152 DADDEFFKAIREASKRPSTLSNSGTPEILNRKYNIMYISKLNGSEERRIQAKVLGTQTFA 211

Query: 181 KLVAAALSGLMRAHRLPSVMRPLYQPESVVSYWNRAKVLGFMTCDTLRVPQRYGSDYLEI 240
           K++   L+ L++ +++PS +R LY+ E+V  YWN++K+L FM CD+L++PQ Y ++  E+
Sbjct: 212 KVLPPILNTLLKVNKIPSKLRSLYKAENVTLYWNKSKLLNFMNCDSLKIPQTYQNEISEL 271

Query: 241 QLVPV 245
           +++ +
Sbjct: 272 EIILI 276

 Score = 59.3 bits (142), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 46/71 (64%)

Query: 296 VLRVALQGQDNKKVYVNVKPTTTFARMIEYYRTQKQLPRSTQITLALDDEPLDPHATVKS 355
           V++++L   DNKK++VNV+ +T   ++++Y++  K L  + +I +  D + L   + +  
Sbjct: 380 VIKISLMSNDNKKIFVNVRSSTKIQKLVDYFKKCKNLTSNQRIKVIFDHDVLSLDSMIGD 439

Query: 356 QDIEDEDMLEV 366
            DIEDED++E+
Sbjct: 440 NDIEDEDIVEM 450

>TBLA0A03710 Chr1 (928023..929408) [1386 bp, 461 aa] {ON} Anc_5.425
           YDR363W
          Length = 461

 Score = 98.6 bits (244), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 45/130 (34%), Positives = 79/130 (60%), Gaps = 15/130 (11%)

Query: 127 FFQSIAKRSQSLPVQDGSGAVRQD-----------KVYYVQFISHVDGTKGKSVQVKALG 175
           FF+++ K S S+P    S  ++ D           ++Y V+FIS ++GT  K VQVK LG
Sbjct: 185 FFKAL-KHSSSVP---PSSTMKSDIKTTKDQGNPKRIYNVRFISKIEGTLDKKVQVKVLG 240

Query: 176 SHPFSKLVAAALSGLMRAHRLPSVMRPLYQPESVVSYWNRAKVLGFMTCDTLRVPQRYGS 235
             PFSK++  AL      +++P+V++  Y+  +V  YWN +K+L FMTC++L +PQ Y +
Sbjct: 241 KFPFSKILPPALKAFSEEYKIPNVLKQYYRVNNVTLYWNDSKLLNFMTCNSLNIPQIYEN 300

Query: 236 DYLEIQLVPV 245
           +  +++++ +
Sbjct: 301 EISDVEIIVI 310

 Score = 83.2 bits (204), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 40/83 (48%), Positives = 58/83 (69%)

Query: 286 APVVDLESEEVLRVALQGQDNKKVYVNVKPTTTFARMIEYYRTQKQLPRSTQITLALDDE 345
           A + D+ +E  +++AL  QDNKK+YV V+ +T F+ ++ Y+R QKQL  + QI L  D+E
Sbjct: 378 ANIDDIPNESHIKIALLTQDNKKLYVKVRNSTPFSELVNYFREQKQLGETQQIKLIFDNE 437

Query: 346 PLDPHATVKSQDIEDEDMLEVRL 368
            LD + TV  QD+EDEDM+EV L
Sbjct: 438 ELDLNETVGDQDMEDEDMIEVVL 460

>KLLA0E21275g Chr5 complement(1900927..1902105) [1179 bp, 392 aa]
           {ON} some similarities with uniprot|Q06340 YDR363W
           Saccharomyces cerevisiae ESC2 Protein involved in
           mating- type locus silencing interacts with Sir2p
          Length = 392

 Score = 96.7 bits (239), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 65/271 (23%), Positives = 122/271 (45%), Gaps = 31/271 (11%)

Query: 127 FFQSIAKRSQSLPVQDGSGAVRQDKVYYVQFISHVDGTKGKSVQVKALGSHPFSKLVAAA 186
           F + +   +++      +G V + ++Y + FIS ++G++ K V VK  G+  F  ++   
Sbjct: 125 FLKEVTSNAKNHADTHNNGKVTK-RIYNINFISTLEGSQDKRVNVKVTGNKTFESILPIT 183

Query: 187 LSGLMRAHRLPSVMRPLYQPESVVSYWNRAKVLGFMTCDTLRVPQ--------------- 231
           +   ++++++P  +R  Y P  +V +    +VL F  CD+LR+P+               
Sbjct: 184 IRTFIQSYKIPRRLRIFYTPAELVLFRAGVEVLPFSNCDSLRIPKTVSEYETTVDLVIVH 243

Query: 232 -----RYGSDYLEI---QLVPVKEEAQYLEQEVFXXXXXXXXXXXXXXXXXXXXXXXXXX 283
                 Y ++Y  I   +L    +E+   EQ+                            
Sbjct: 244 SADANNYKTEYKRIRESRLQSFLDESNIEEQDPLEQPARDEKFKLFEKELESAPKLAERT 303

Query: 284 VRAPVVDL-----ESEEVLRVALQGQDNKKVYVNVKPTTTFARMIEYYRTQKQLPRSTQI 338
               V+DL     ES   +R+ L  + NK+  ++V P TTF  +   Y+T   L     +
Sbjct: 304 --DDVIDLLDSDIESSNSIRLTLIDKANKRTSISVWPNTTFTEIANRYKTISSLSEDANV 361

Query: 339 TLALDDEPLDPHATVKSQDIEDEDMLEVRLS 369
            L  D+E L+P ATV S+ +E++D+LE+++S
Sbjct: 362 LLIFDNEELNPAATVLSEGLEEDDILEIKIS 392

>Ecym_5524 Chr5 (1062240..1063487) [1248 bp, 415 aa] {ON} similar to
           Ashbya gossypii AER251W
          Length = 415

 Score = 85.9 bits (211), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 38/77 (49%), Positives = 57/77 (74%)

Query: 292 ESEEVLRVALQGQDNKKVYVNVKPTTTFARMIEYYRTQKQLPRSTQITLALDDEPLDPHA 351
           +  E+++V L G DNKKVYVNVKPTTTF ++ E+YR  K+LP +T++ L+ D + +DP  
Sbjct: 338 DGNELIKVVLLGSDNKKVYVNVKPTTTFEKLAEHYRRIKKLPPTTKLILSFDHDDIDPSN 397

Query: 352 TVKSQDIEDEDMLEVRL 368
           T+ S  IED+D++EV +
Sbjct: 398 TIFSAAIEDDDIVEVSV 414

 Score = 67.0 bits (162), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 42/148 (28%), Positives = 77/148 (52%), Gaps = 14/148 (9%)

Query: 115 KRARTVE---DENDL--FFQSI---AKRSQSL----PVQDGSGAVRQ--DKVYYVQFISH 160
           KR+R VE   +E+D   F   I   A+R+ SL     +++GS   ++    +Y V FIS 
Sbjct: 119 KRSRNVEHSQEESDTNKFLAEIEQEAERASSLHNNGSLKNGSSNNKEIGTNIYNVGFISK 178

Query: 161 VDGTKGKSVQVKALGSHPFSKLVAAALSGLMRAHRLPSVMRPLYQPESVVSYWNRAKVLG 220
           ++G+  K + V+  G   FS  +  AL   ++ +++ + +   YQ ++V  Y    ++  
Sbjct: 179 LEGSTNKRINVRITGKKKFSAFLPIALKTFVKEYKIAASLHDKYQIDNVKIYREGVEIFK 238

Query: 221 FMTCDTLRVPQRYGSDYLEIQLVPVKEE 248
           FMTCD+  + + Y S  ++I++  V  E
Sbjct: 239 FMTCDSFNIAEAYASSSIDIEVYIVPNE 266

>Kpol_1027.26 s1027 complement(53549..54880) [1332 bp, 443 aa] {ON}
           complement(53549..54880) [1332 nt, 444 aa]
          Length = 443

 Score = 84.0 bits (206), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 43/138 (31%), Positives = 79/138 (57%), Gaps = 2/138 (1%)

Query: 121 EDENDLFFQSIAKRSQSLP-VQDGSGAVRQDKVYYVQFISHVDGTKGKSVQVKALGSHPF 179
           E+END F ++I   S +L  V   +  +  +++Y + F S +DG+  K +Q + LG   F
Sbjct: 147 EEENDDFSKAIRMNSNTLTNVPSPTSDMAPNRIYNITFTSKLDGSVDKKLQARVLGKQQF 206

Query: 180 SKLVAAALSGLMRAHRLPSVMRPLYQPESVVSYWNRAKVLGFMTCDTLRVPQRYGSDYLE 239
           S+++   L    + +++  V +  Y+ + V  YW+RAK+L FMTC++L++P  + S+   
Sbjct: 207 SEIMQPILDSYSKIYKVSRVKKRNYKTDLVTVYWDRAKLLPFMTCNSLKIPLEFQSEISH 266

Query: 240 IQLVPV-KEEAQYLEQEV 256
           I+L  + KE  Q  E ++
Sbjct: 267 IELTIISKENEQQFEADI 284

 Score = 82.4 bits (202), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 34/71 (47%), Positives = 53/71 (74%)

Query: 296 VLRVALQGQDNKKVYVNVKPTTTFARMIEYYRTQKQLPRSTQITLALDDEPLDPHATVKS 355
           ++++AL G DNKK++VN + TT F ++ EYY   ++LP+ST++ L  DDE +D  + VK 
Sbjct: 369 IVKLALVGNDNKKIFVNARETTRFFKLAEYYILHRKLPKSTKVKLIFDDEQIDLDSMVKD 428

Query: 356 QDIEDEDMLEV 366
           QD+ED+DM+EV
Sbjct: 429 QDVEDDDMIEV 439

>TDEL0E02000 Chr5 complement(379082..380392) [1311 bp, 436 aa] {ON}
           Anc_5.425 YDR363W
          Length = 436

 Score = 81.3 bits (199), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 41/81 (50%), Positives = 57/81 (70%), Gaps = 3/81 (3%)

Query: 289 VDLESE---EVLRVALQGQDNKKVYVNVKPTTTFARMIEYYRTQKQLPRSTQITLALDDE 345
           VDLE E   EV+++AL GQDN ++YVNV+ +T F+++ EYY+  K LP   ++ L  D E
Sbjct: 354 VDLEDEDELEVIKLALVGQDNARLYVNVRRSTPFSKVAEYYKLHKPLPMEVKLNLYFDHE 413

Query: 346 PLDPHATVKSQDIEDEDMLEV 366
            LD + TV  Q++EDEDMLEV
Sbjct: 414 KLDLNETVGDQELEDEDMLEV 434

 Score = 70.5 bits (171), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 29/103 (28%), Positives = 60/103 (58%)

Query: 143 GSGAVRQDKVYYVQFISHVDGTKGKSVQVKALGSHPFSKLVAAALSGLMRAHRLPSVMRP 202
             G   + K++ + F+S ++GT  +++Q+K LG + F+ ++ + L  ++   ++P  +  
Sbjct: 181 AKGTKARQKIFNLMFLSKLEGTVDRAIQLKVLGKYDFASILESVLERVVEEFKIPYPVMH 240

Query: 203 LYQPESVVSYWNRAKVLGFMTCDTLRVPQRYGSDYLEIQLVPV 245
            Y  ++V  YWN  K+L FMTCD+L++     ++  EI++  V
Sbjct: 241 QYTVDNVTLYWNGGKLLKFMTCDSLKISNIDNNEVTEIEVTMV 283

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.130    0.362 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 29,350,070
Number of extensions: 1038974
Number of successful extensions: 2616
Number of sequences better than 10.0: 24
Number of HSP's gapped: 2654
Number of HSP's successfully gapped: 43
Length of query: 369
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 258
Effective length of database: 40,753,473
Effective search space: 10514396034
Effective search space used: 10514396034
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 66 (30.0 bits)