Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
CAGL0A01199gna 1ON61361328610.0
Kpol_358.3na 1ON57556219760.0
NDAI0I02660na 1ON59456819780.0
NCAS0D02260na 1ON59756019450.0
TPHA0M00130singletonON61156619320.0
KNAG0L02460singletonON58856819250.0
SAKL0G14916gna 1ON58156119010.0
Skud_16.12na 1ON60756118830.0
Suva_16.40na 1ON60653618770.0
YPL265W (DIP5)na 1ON60853618750.0
TBLA0A07060na 1ON62553318760.0
Smik_6.473na 1ON60653618650.0
KAFR0B06430singletonON59356218510.0
KLTH0B01166gna 1ON57753617220.0
Kwal_33.15545na 1ON57653616850.0
KNAG0L02470singletonON63855216760.0
KLLA0E16281gna 1ON60553316690.0
Ecym_2480na 1ON58654416380.0
ACL135Wna 1ON58855015620.0
ZYRO0D17908gna 1ON5185278791e-110
CAGL0E05632g7.44ON5985578801e-110
SAKL0B10956g7.44ON5725558761e-109
YOR348C (PUT4)7.44ON6275568801e-109
Smik_5.241.83ON5905348751e-109
Kwal_23.4026singletonON5345318701e-109
Suva_5.41.83ON5905408681e-108
SAKL0C02662g1.83ON5485328631e-108
Kwal_26.69407.44ON5705568651e-108
YNL268W (LYP1)1.84ON6115418651e-107
TBLA0A054601.84ON6085478611e-107
CAGL0J08184g1.83ON5725208581e-107
TDEL0H040707.44ON5775578571e-106
TDEL0C061701.84ON5735338571e-106
KLTH0D01474g7.44ON6245158591e-106
TPHA0B044801.83ON6035018561e-106
Skud_5.261.83ON5905188551e-106
Kpol_2000.641.84ON6105468561e-106
SAKL0C02684gsingletonON5885148541e-106
YNL270C (ALP1)1.83ON5735198531e-106
Smik_15.5327.44ON6315568571e-106
Suva_14.751.84ON6115478561e-106
SAKL0C02640gsingletonON5485108481e-105
YEL063C (CAN1)1.83ON5905078521e-105
TBLA0A054501.83ON6064928511e-105
Ecym_80357.44ON5635348451e-105
Suva_8.4027.44ON6835688541e-105
KAFR0D039401.83ON5975468471e-105
Ecym_10881.84ON5675268441e-104
TDEL0A08030singletonON5145128381e-104
NDAI0A006101.83ON5655108421e-104
TPHA0H028507.44ON6015668431e-104
ZYRO0F16654g1.83ON5805188411e-104
KNAG0C05920singletonON5995148431e-104
Skud_14.711.84ON6125078431e-104
KLTH0F02398g1.83ON5555378371e-104
NCAS0B085701.83ON5325148351e-104
TDEL0C061801.83ON5835368371e-103
Ecym_10871.83ON5705328351e-103
Smik_14.671.83ON5735348351e-103
CAGL0J08162g1.84ON5975038361e-103
NDAI0F041901.84ON5995098351e-103
Skud_15.5157.44ON6265548361e-103
KNAG0F004801.84ON5975428311e-102
Kpol_2000.651.83ON5955018291e-102
Smik_14.681.84ON6115028301e-102
TPHA0B044701.84ON5995548281e-102
SAKL0F09790gsingletonON5585278241e-102
Skud_14.701.83ON5735188251e-102
NDAI0E038007.44ON6215338271e-101
KLLA0C02343g1.83ON5815078241e-101
KLLA0F23419g7.44ON5735758171e-101
KNAG0E003907.44ON5995738181e-100
NCAS0A006001.83ON5445418131e-100
SAKL0C02728g1.84ON5625168111e-100
NDAI0F042001.83ON5665378101e-100
NCAS0A006101.84ON6075058131e-100
NCAS0E022607.44ON5935918112e-99
Kpol_367.77.44ON5845538041e-98
Kwal_33.134011.83ON5595318021e-98
ZYRO0F16632g1.84ON6075008008e-98
Suva_14.731.83ON4974627901e-97
AFR667C1.84ON5635467952e-97
KAFR0D007001.83ON5745347943e-97
AFR156W7.44ON5585527915e-97
KLTH0F02420g1.84ON6215207912e-96
ZYRO0C18502g7.44ON5755427771e-94
Kwal_33.134111.84ON5605107707e-94
KNAG0C007901.83ON5795217701e-93
KLLA0C02365g1.84ON5794947701e-93
Smik_6.482na 2ON5585457637e-93
Kwal_8.590na 3ON6295687652e-92
Suva_13.517singletonON5475317573e-92
AFR668W1.83ON5564817481e-90
TBLA0C01240singletonON6295227512e-90
SAKL0F16544gsingletonON5675447462e-90
TDEL0E05750singletonON5485197357e-89
KLLA0B14685gna 4ON5715417262e-87
KLTH0B00154gna 3ON5565397234e-87
KLTH0F04048gsingletonON5835357203e-86
KLTH0A00308gsingletonON5415017131e-85
KAFR0C051607.44ON5845597133e-85
SAKL0C01232gsingletonON6135427102e-84
Ecym_60211.244ON6005247022e-83
KNAG0C02140singletonON5985326971e-82
KNAG0F002701.50ON6345536981e-82
CAGL0K05753g1.50ON6605566992e-82
Skud_16.2na 2ON4964856838e-82
Kwal_23.2817na 4ON5805236871e-81
TBLA0A051801.50ON6765666898e-81
YCL025C (AGP1)1.50ON6335656832e-80
KAFR0D04120na 5ON6485666842e-80
TDEL0D00200singletonON5675406773e-80
Smik_3.531.50ON6335646814e-80
KAFR0A011203.284ON5925376769e-80
NDAI0B052201.244ON6115796771e-79
Kpol_2000.921.50ON6375696762e-79
Skud_3.381.50ON6335656744e-79
SAKL0C01650g1.50ON6135426718e-79
CAGL0B01012g1.50ON6235516701e-78
Ecym_26643.285ON5755406643e-78
KAFR0C004003.284ON5825636644e-78
Suva_3.1891.50ON6335686674e-78
KAFR0D041401.50ON6375596675e-78
KAFR0D04130na 6ON6445316641e-77
SAKL0G14014g5.158ON6055306612e-77
Ecym_47895.158ON5885256602e-77
Skud_11.2751.244ON6025346602e-77
TDEL0C00930singletonON5955036593e-77
KLLA0C01606g1.50ON6205636604e-77
YBR068C (BAP2)3.284ON6095456561e-76
Suva_11.2731.244ON6015366551e-76
Suva_2.6881.50ON6615546563e-76
Skud_2.2603.397ON5985466523e-76
NCAS0B079001.244ON6195466533e-76
KLLA0A06886gsingletonON5875396505e-76
TPHA0E036601.50ON6475246537e-76
AGR040C3.285ON5735276488e-76
Kpol_526.103.397ON5805436443e-75
Smik_2.2723.397ON5975496445e-75
KLTH0B02046g5.158ON5895566435e-75
ZYRO0D03762g1.244ON6005176445e-75
KAFR0E018505.158ON5605246415e-75
KAFR0D00510na 6ON6175546447e-75
Suva_4.3813.397ON5905426428e-75
KLTH0F01584g1.50ON5965636428e-75
Kwal_27.126811.244ON5935516429e-75
NDAI0A074903.284ON5965516411e-74
NDAI0A056203.284ON5715466382e-74
TBLA0A05190na 5ON6675596442e-74
KLLA0A11770g5.158ON5815456382e-74
TPHA0A047005.158ON5694916363e-74
KAFR0D00520na 5ON5985566384e-74
TPHA0B010901.244ON6065146384e-74
SAKL0D02948gna 7ON5945296374e-74
SAKL0D02970g3.284ON6015496375e-74
AFR698C1.50ON6095266376e-74
YBR132C (AGP2)3.397ON5965276366e-74
CAGL0H08393g3.284ON6125426351e-73
YKR039W (GAP1)1.244ON6025266342e-73
CAGL0L03267g1.244ON5975346332e-73
TPHA0A002405.158ON6035306323e-73
Suva_2.2033.284ON6045486314e-73
Kwal_33.132041.50ON6075296314e-73
KLTH0F01606gna 5ON6045596314e-73
TDEL0C053403.397ON5755526285e-73
YDR508C (GNP1)1.50ON6635386345e-73
Smik_11.3021.244ON5534806266e-73
Kpol_1010.325.158ON5995346281e-72
KLLA0A10813g1.368ON5845986261e-72
SAKL0D02926g3.285ON5835516261e-72
Smik_16.1155.158ON6035576272e-72
NCAS0A106803.284ON5935446252e-72
Kwal_26.9612singletonON5435476222e-72
KAFR0D005001.50ON6175546262e-72
Kpol_1052.163.284ON6135456262e-72
TPHA0B047501.50ON6395516282e-72
Suva_2.716singletonON6035636252e-72
ZYRO0F13838g8.342ON8365766373e-72
KNAG0J022003.284ON6075546253e-72
NCAS0B085801.50ON6275396264e-72
AAR038W3.397ON5665386214e-72
YGR191W (HIP1)5.158ON6035406235e-72
SAKL0D00836gna 8ON6015166235e-72
Skud_7.5255.158ON6035556236e-72
NDAI0D021605.158ON5875556216e-72
Skud_4.7841.50ON6635886267e-72
Kpol_543.791.244ON6055436228e-72
KLTH0E15642g1.244ON5965276201e-71
Suva_4.3073.284ON6095186211e-71
AGR039Cna 7ON5865546182e-71
Smik_4.7901.50ON6635386204e-71
ZYRO0C17182g3.397ON5785206155e-71
CAGL0L07546g3.284ON6345386185e-71
NCAS0I015303.284ON5955566157e-71
TBLA0I020103.285ON6285326177e-71
Skud_2.1913.284ON6095476167e-71
Kwal_33.154075.158ON5875396131e-70
KLTH0C05170g3.284ON5985466122e-70
Ecym_42308.342ON8576236243e-70
KLTH0G11726g8.342ON8245566233e-70
SAKL0D04664g1.244ON5935146104e-70
NDAI0G060301.368ON5995336104e-70
Smik_2.2013.284ON6095456104e-70
ZYRO0F17446g1.50ON6335536107e-70
AGR038C3.284ON5805456077e-70
TBLA0I020003.284ON6645556119e-70
TPHA0A024503.397ON5835166069e-70
Ecym_10561.50ON6065496089e-70
CAGL0E01089g8.342ON8535926201e-69
NCAS0D018705.158ON5955156061e-69
SAKL0B08734g3.397ON5585176031e-69
NDAI0C029505.158ON6095116061e-69
Suva_7.4855.158ON6035376061e-69
NCAS0A071105.158ON5925016052e-69
TPHA0M012003.284ON6075576062e-69
KNAG0H011503.284ON6175526072e-69
NDAI0A006401.50ON6415656072e-69
NDAI0F043901.50ON6675276074e-69
Kpol_1052.143.285ON6025466034e-69
ADL272Wna 9ON5645446005e-69
KLLA0D16830g8.342ON8326016146e-69
NCAS0A089201.368ON5995286009e-69
YDR046C (BAP3)3.284ON6045645992e-68
Kwal_27.105383.284ON6026005982e-68
Kpol_534.221.368ON5925825972e-68
SAKL0H15092g8.342ON8505746102e-68
Kpol_1065.133.284ON5965455972e-68
TBLA0C012101.368ON6005395973e-68
Ecym_27161.368ON5925405954e-68
AGR319W5.158ON6265395976e-68
KLLA0A06930g1.244ON5875105946e-68
KLTH0F11286g3.397ON5825385936e-68
Kpol_2002.441.50ON6275845959e-68
Kwal_33.14276na 8ON5965175931e-67
CAGL0B03773g5.158ON6055175931e-67
Smik_4.2843.284ON6045645931e-67
TDEL0C065101.50ON6425575951e-67
KNAG0B012703.397ON5925485912e-67
SAKL0C13992gsingletonON5525525873e-67
TBLA0B077605.158ON6585255933e-67
AEL030W1.368ON5825275883e-67
Skud_4.3003.284ON6045635895e-67
NCAS0A004201.50ON6795465918e-67
KNAG0C005901.50ON6345325881e-66
CAGL0C00539g3.397ON5935315851e-66
KLLA0C15873g3.397ON5685255832e-66
KAFR0K013603.397ON5825505813e-66
NCAS0J00140na 10ON5585615803e-66
TBLA0C025203.397ON5805345814e-66
Skud_2.1923.285ON6195095834e-66
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0A01199g
         (613 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0A01199g Chr1 (121067..122908) [1842 bp, 613 aa] {ON} simila...  1106   0.0  
Kpol_358.3 s358 (7369..9096) [1728 bp, 575 aa] {ON} (7369..9096)...   765   0.0  
NDAI0I02660 Chr9 complement(619959..621743) [1785 bp, 594 aa] {O...   766   0.0  
NCAS0D02260 Chr4 (421966..423759) [1794 bp, 597 aa] {ON}              753   0.0  
TPHA0M00130 Chr13 complement(25769..27604) [1836 bp, 611 aa] {ON}     748   0.0  
KNAG0L02460 Chr12 (437963..439729) [1767 bp, 588 aa] {ON}             746   0.0  
SAKL0G14916g Chr7 complement(1277225..1278970) [1746 bp, 581 aa]...   736   0.0  
Skud_16.12 Chr16 (20144..21967) [1824 bp, 607 aa] {ON} YPL265W (...   729   0.0  
Suva_16.40 Chr16 (56664..58484) [1821 bp, 606 aa] {ON} YPL265W (...   727   0.0  
YPL265W Chr16 (41043..42869) [1827 bp, 608 aa] {ON}  DIP5Dicarbo...   726   0.0  
TBLA0A07060 Chr1 complement(1737650..1739527) [1878 bp, 625 aa] ...   727   0.0  
Smik_6.473 Chr6 complement(778327..780147) [1821 bp, 606 aa] {ON...   723   0.0  
KAFR0B06430 Chr2 complement(1333415..1335196) [1782 bp, 593 aa] ...   717   0.0  
KLTH0B01166g Chr2 (102227..103960) [1734 bp, 577 aa] {ON} simila...   667   0.0  
Kwal_33.15545 s33 complement(1149997..1151727) [1731 bp, 576 aa]...   653   0.0  
KNAG0L02470 Chr12 (440549..442465) [1917 bp, 638 aa] {ON}             650   0.0  
KLLA0E16281g Chr5 (1455271..1457088) [1818 bp, 605 aa] {ON} simi...   647   0.0  
Ecym_2480 Chr2 complement(940315..942075) [1761 bp, 586 aa] {ON}...   635   0.0  
ACL135W Chr3 (115359..117125) [1767 bp, 588 aa] {ON} Non-synteni...   606   0.0  
ZYRO0D17908g Chr4 (1486514..1488070) [1557 bp, 518 aa] {ON} simi...   343   e-110
CAGL0E05632g Chr5 complement(556856..558652) [1797 bp, 598 aa] {...   343   e-110
SAKL0B10956g Chr2 complement(949900..951618) [1719 bp, 572 aa] {...   342   e-109
YOR348C Chr15 complement(986899..988782) [1884 bp, 627 aa] {ON} ...   343   e-109
Smik_5.24 Chr5 complement(34087..35859) [1773 bp, 590 aa] {ON} Y...   341   e-109
Kwal_23.4026 s23 (534468..536072) [1605 bp, 534 aa] {ON} YPL265W...   339   e-109
Suva_5.4 Chr5 complement(7388..9160) [1773 bp, 590 aa] {ON} YEL0...   338   e-108
SAKL0C02662g Chr3 complement(249789..251435) [1647 bp, 548 aa] {...   337   e-108
Kwal_26.6940 s26 (133377..135089) [1713 bp, 570 aa] {ON} YOR348C...   337   e-108
YNL268W Chr14 (138550..140385) [1836 bp, 611 aa] {ON}  LYP1Lysin...   337   e-107
TBLA0A05460 Chr1 (1348452..1350278) [1827 bp, 608 aa] {ON} Anc_1...   336   e-107
CAGL0J08184g Chr10 (806631..808349) [1719 bp, 572 aa] {ON} simil...   335   e-107
TDEL0H04070 Chr8 complement(698717..700450) [1734 bp, 577 aa] {O...   334   e-106
TDEL0C06170 Chr3 complement(1117792..1119513) [1722 bp, 573 aa] ...   334   e-106
KLTH0D01474g Chr4 (139116..140990) [1875 bp, 624 aa] {ON} simila...   335   e-106
TPHA0B04480 Chr2 (1050173..1051984) [1812 bp, 603 aa] {ON} Anc_1...   334   e-106
Skud_5.26 Chr5 complement(30850..32622) [1773 bp, 590 aa] {ON} Y...   333   e-106
Kpol_2000.64 s2000 complement(130912..132744) [1833 bp, 610 aa] ...   334   e-106
SAKL0C02684g Chr3 complement(251988..253754) [1767 bp, 588 aa] {...   333   e-106
YNL270C Chr14 complement(135940..137661) [1722 bp, 573 aa] {ON} ...   333   e-106
Smik_15.532 Chr15 complement(932437..934332) [1896 bp, 631 aa] {...   334   e-106
Suva_14.75 Chr14 (133164..134999) [1836 bp, 611 aa] {ON} YEL063C...   334   e-106
SAKL0C02640g Chr3 complement(247651..249297) [1647 bp, 548 aa] {...   331   e-105
YEL063C Chr5 complement(31694..33466) [1773 bp, 590 aa] {ON}  CA...   332   e-105
TBLA0A05450 Chr1 complement(1345808..1347628) [1821 bp, 606 aa] ...   332   e-105
Ecym_8035 Chr8 (81434..83125) [1692 bp, 563 aa] {ON} similar to ...   330   e-105
Suva_8.402 Chr8 complement(722727..724778) [2052 bp, 683 aa] {ON...   333   e-105
KAFR0D03940 Chr4 complement(767673..769466) [1794 bp, 597 aa] {O...   330   e-105
Ecym_1088 Chr1 (184038..185741) [1704 bp, 567 aa] {ON} similar t...   329   e-104
TDEL0A08030 Chr1 (1405718..1407262) [1545 bp, 514 aa] {ON}            327   e-104
NDAI0A00610 Chr1 complement(113913..115610) [1698 bp, 565 aa] {O...   328   e-104
TPHA0H02850 Chr8 complement(676524..678329) [1806 bp, 601 aa] {O...   329   e-104
ZYRO0F16654g Chr6 (1374093..1375835) [1743 bp, 580 aa] {ON} simi...   328   e-104
KNAG0C05920 Chr3 (1157993..1159792) [1800 bp, 599 aa] {ON}            329   e-104
Skud_14.71 Chr14 (127310..129148) [1839 bp, 612 aa] {ON} YEL063C...   329   e-104
KLTH0F02398g Chr6 complement(202746..204413) [1668 bp, 555 aa] {...   327   e-104
NCAS0B08570 Chr2 (1644264..1645862) [1599 bp, 532 aa] {ON}            326   e-104
TDEL0C06180 Chr3 (1120158..1121909) [1752 bp, 583 aa] {ON} Anc_1...   327   e-103
Ecym_1087 Chr1 complement(180832..182544) [1713 bp, 570 aa] {ON}...   326   e-103
Smik_14.67 Chr14 complement(114969..116690) [1722 bp, 573 aa] {O...   326   e-103
CAGL0J08162g Chr10 complement(803679..805472) [1794 bp, 597 aa] ...   326   e-103
NDAI0F04190 Chr6 complement(1012142..1013941) [1800 bp, 599 aa] ...   326   e-103
Skud_15.515 Chr15 complement(924662..926542) [1881 bp, 626 aa] {...   326   e-103
KNAG0F00480 Chr6 (73545..75338) [1794 bp, 597 aa] {ON}                324   e-102
Kpol_2000.65 s2000 (134897..136684) [1788 bp, 595 aa] {ON} (1348...   323   e-102
Smik_14.68 Chr14 (117603..119438) [1836 bp, 611 aa] {ON} YEL063C...   324   e-102
TPHA0B04470 Chr2 complement(1047097..1048896) [1800 bp, 599 aa] ...   323   e-102
SAKL0F09790g Chr6 (750158..751834) [1677 bp, 558 aa] {ON} simila...   322   e-102
Skud_14.70 Chr14 complement(124390..126111) [1722 bp, 573 aa] {O...   322   e-102
NDAI0E03800 Chr5 (829594..831459) [1866 bp, 621 aa] {ON} Anc_7.44     323   e-101
KLLA0C02343g Chr3 complement(203552..205297) [1746 bp, 581 aa] {...   322   e-101
KLLA0F23419g Chr6 complement(2187386..2189107) [1722 bp, 573 aa]...   319   e-101
KNAG0E00390 Chr5 (61730..63529) [1800 bp, 599 aa] {ON} Anc_7.44 ...   319   e-100
NCAS0A00600 Chr1 complement(109246..110880) [1635 bp, 544 aa] {O...   317   e-100
SAKL0C02728g Chr3 (255022..256710) [1689 bp, 562 aa] {ON} simila...   317   e-100
NDAI0F04200 Chr6 (1016214..1017914) [1701 bp, 566 aa] {ON}            316   e-100
NCAS0A00610 Chr1 (111522..113345) [1824 bp, 607 aa] {ON}              317   e-100
NCAS0E02260 Chr5 (437115..438896) [1782 bp, 593 aa] {ON} Anc_7.44     317   2e-99
Kpol_367.7 s367 (23929..25683) [1755 bp, 584 aa] {ON} (23929..25...   314   1e-98
Kwal_33.13401 s33 complement(206763..208442) [1680 bp, 559 aa] {...   313   1e-98
ZYRO0F16632g Chr6 complement(1371112..1372935) [1824 bp, 607 aa]...   312   8e-98
Suva_14.73 Chr14 complement(130474..131967) [1494 bp, 497 aa] {O...   308   1e-97
AFR667C Chr6 complement(1657505..1659196) [1692 bp, 563 aa] {ON}...   310   2e-97
KAFR0D00700 Chr4 complement(120768..122492) [1725 bp, 574 aa] {O...   310   3e-97
AFR156W Chr6 (717642..719318) [1677 bp, 558 aa] {ON} Non-synteni...   309   5e-97
KLTH0F02420g Chr6 (205827..207692) [1866 bp, 621 aa] {ON} simila...   309   2e-96
ZYRO0C18502g Chr3 complement(1448075..1449802) [1728 bp, 575 aa]...   303   1e-94
Kwal_33.13411 s33 (210461..212143) [1683 bp, 560 aa] {ON} YNL268...   301   7e-94
KNAG0C00790 Chr3 (138911..140650) [1740 bp, 579 aa] {ON}              301   1e-93
KLLA0C02365g Chr3 (208462..210201) [1740 bp, 579 aa] {ON} simila...   301   1e-93
Smik_6.482 Chr6 complement(795927..797603) [1677 bp, 558 aa] {ON...   298   7e-93
Kwal_8.590 s8 complement(17220..19109) [1890 bp, 629 aa] {ON} YO...   299   2e-92
Suva_13.517 Chr13 (904704..906347) [1644 bp, 547 aa] {ON} YPL265...   296   3e-92
AFR668W Chr6 (1659910..1661580) [1671 bp, 556 aa] {ON} Syntenic ...   292   1e-90
TBLA0C01240 Chr3 (270186..272075) [1890 bp, 629 aa] {ON} Anc_1.3...   293   2e-90
SAKL0F16544g Chr6 complement(1364680..1366383) [1704 bp, 567 aa]...   291   2e-90
TDEL0E05750 Chr5 (1074448..1076094) [1647 bp, 548 aa] {ON}            287   7e-89
KLLA0B14685g Chr2 complement(1289025..1290740) [1716 bp, 571 aa]...   284   2e-87
KLTH0B00154g Chr2 complement(7385..9055) [1671 bp, 556 aa] {ON} ...   283   4e-87
KLTH0F04048g Chr6 (359492..361243) [1752 bp, 583 aa] {ON} weakly...   281   3e-86
KLTH0A00308g Chr1 (23428..25053) [1626 bp, 541 aa] {ON} weakly s...   279   1e-85
KAFR0C05160 Chr3 (1025799..1027553) [1755 bp, 584 aa] {ON} Anc_7...   279   3e-85
SAKL0C01232g Chr3 (110269..112110) [1842 bp, 613 aa] {ON} simila...   278   2e-84
Ecym_6021 Chr6 (37898..39700) [1803 bp, 600 aa] {ON} similar to ...   275   2e-83
KNAG0C02140 Chr3 complement(416347..418143) [1797 bp, 598 aa] {O...   273   1e-82
KNAG0F00270 Chr6 complement(27784..29688) [1905 bp, 634 aa] {ON}...   273   1e-82
CAGL0K05753g Chr11 (565111..567093) [1983 bp, 660 aa] {ON} highl...   273   2e-82
Skud_16.2 Chr16 complement(1584..3074) [1491 bp, 496 aa] {ON} YP...   267   8e-82
Kwal_23.2817 s23 complement(26637..28379) [1743 bp, 580 aa] {ON}...   269   1e-81
TBLA0A05180 Chr1 complement(1267962..1269992) [2031 bp, 676 aa] ...   270   8e-81
YCL025C Chr3 complement(76018..77919) [1902 bp, 633 aa] {ON}  AG...   267   2e-80
KAFR0D04120 Chr4 (816117..818063) [1947 bp, 648 aa] {ON} Anc_1.5...   268   2e-80
TDEL0D00200 Chr4 (32432..34135) [1704 bp, 567 aa] {ON}                265   3e-80
Smik_3.53 Chr3 complement(77146..79047) [1902 bp, 633 aa] {ON} Y...   266   4e-80
KAFR0A01120 Chr1 complement(216442..218220) [1779 bp, 592 aa] {O...   265   9e-80
NDAI0B05220 Chr2 (1278386..1280221) [1836 bp, 611 aa] {ON} Anc_1...   265   1e-79
Kpol_2000.92 s2000 (208509..210422) [1914 bp, 637 aa] {ON} (2085...   265   2e-79
Skud_3.38 Chr3 complement(63096..64997) [1902 bp, 633 aa] {ON} Y...   264   4e-79
SAKL0C01650g Chr3 complement(139480..141321) [1842 bp, 613 aa] {...   263   8e-79
CAGL0B01012g Chr2 (91330..93201) [1872 bp, 623 aa] {ON} similar ...   262   1e-78
Ecym_2664 Chr2 complement(1280994..1282721) [1728 bp, 575 aa] {O...   260   3e-78
KAFR0C00400 Chr3 (83280..85028) [1749 bp, 582 aa] {ON}                260   4e-78
Suva_3.189 Chr3 complement(285493..287394) [1902 bp, 633 aa] {ON...   261   4e-78
KAFR0D04140 Chr4 (821341..823254) [1914 bp, 637 aa] {ON}              261   5e-78
KAFR0D04130 Chr4 (818573..820507) [1935 bp, 644 aa] {ON}              260   1e-77
SAKL0G14014g Chr7 (1202476..1204293) [1818 bp, 605 aa] {ON} high...   259   2e-77
Ecym_4789 Chr4 complement(1531864..1533630) [1767 bp, 588 aa] {O...   258   2e-77
Skud_11.275 Chr11 (496787..498595) [1809 bp, 602 aa] {ON} YKR039...   258   2e-77
TDEL0C00930 Chr3 complement(147777..149564) [1788 bp, 595 aa] {O...   258   3e-77
KLLA0C01606g Chr3 complement(123485..125347) [1863 bp, 620 aa] {...   258   4e-77
YBR068C Chr2 complement(373861..375690) [1830 bp, 609 aa] {ON}  ...   257   1e-76
Suva_11.273 Chr11 (498611..500416) [1806 bp, 601 aa] {ON} YKR039...   256   1e-76
Suva_2.688 Chr2 complement(1219181..1221166) [1986 bp, 661 aa] {...   257   3e-76
Skud_2.260 Chr2 complement(467322..469118) [1797 bp, 598 aa] {ON...   255   3e-76
NCAS0B07900 Chr2 (1500061..1501920) [1860 bp, 619 aa] {ON} Anc_1...   256   3e-76
KLLA0A06886g Chr1 complement(621646..623409) [1764 bp, 587 aa] {...   254   5e-76
TPHA0E03660 Chr5 (775232..777175) [1944 bp, 647 aa] {ON} Anc_1.5...   256   7e-76
AGR040C Chr7 complement(782283..784004) [1722 bp, 573 aa] {ON} S...   254   8e-76
Kpol_526.10 s526 complement(18362..20104) [1743 bp, 580 aa] {ON}...   252   3e-75
Smik_2.272 Chr2 complement(484274..486067) [1794 bp, 597 aa] {ON...   252   5e-75
KLTH0B02046g Chr2 complement(163199..164968) [1770 bp, 589 aa] {...   252   5e-75
ZYRO0D03762g Chr4 complement(304207..306009) [1803 bp, 600 aa] {...   252   5e-75
KAFR0E01850 Chr5 (381160..382842) [1683 bp, 560 aa] {ON} Anc_5.1...   251   5e-75
KAFR0D00510 Chr4 complement(80174..82027) [1854 bp, 617 aa] {ON}      252   7e-75
Suva_4.381 Chr4 complement(668597..670369) [1773 bp, 590 aa] {ON...   251   8e-75
KLTH0F01584g Chr6 complement(120227..122017) [1791 bp, 596 aa] {...   251   8e-75
Kwal_27.12681 s27 (1332647..1334428) [1782 bp, 593 aa] {ON} YKR0...   251   9e-75
NDAI0A07490 Chr1 complement(1713048..1714838) [1791 bp, 596 aa] ...   251   1e-74
NDAI0A05620 Chr1 (1268907..1270622) [1716 bp, 571 aa] {ON}            250   2e-74
TBLA0A05190 Chr1 complement(1271605..1273608) [2004 bp, 667 aa] ...   252   2e-74
KLLA0A11770g Chr1 (1014918..1016663) [1746 bp, 581 aa] {ON} simi...   250   2e-74
TPHA0A04700 Chr1 (1064463..1066172) [1710 bp, 569 aa] {ON} Anc_5...   249   3e-74
KAFR0D00520 Chr4 complement(82977..84773) [1797 bp, 598 aa] {ON}...   250   4e-74
TPHA0B01090 Chr2 complement(246708..248528) [1821 bp, 606 aa] {O...   250   4e-74
SAKL0D02948g Chr4 (243064..244848) [1785 bp, 594 aa] {ON} simila...   249   4e-74
SAKL0D02970g Chr4 (245449..247254) [1806 bp, 601 aa] {ON} unipro...   249   5e-74
AFR698C Chr6 complement(1726387..1728216) [1830 bp, 609 aa] {ON}...   249   6e-74
YBR132C Chr2 complement(499652..501442) [1791 bp, 596 aa] {ON}  ...   249   6e-74
CAGL0H08393g Chr8 (821998..823836) [1839 bp, 612 aa] {ON} highly...   249   1e-73
YKR039W Chr11 (515063..516871) [1809 bp, 602 aa] {ON}  GAP1Gener...   248   2e-73
CAGL0L03267g Chr12 (374784..376577) [1794 bp, 597 aa] {ON} highl...   248   2e-73
TPHA0A00240 Chr1 complement(28756..30567) [1812 bp, 603 aa] {ON}...   248   3e-73
Suva_2.203 Chr2 complement(347891..349705) [1815 bp, 604 aa] {ON...   247   4e-73
Kwal_33.13204 s33 complement(120622..122445) [1824 bp, 607 aa] {...   247   4e-73
KLTH0F01606g Chr6 complement(122821..124635) [1815 bp, 604 aa] {...   247   4e-73
TDEL0C05340 Chr3 complement(951770..953497) [1728 bp, 575 aa] {O...   246   5e-73
YDR508C Chr4 complement(1466453..1468444) [1992 bp, 663 aa] {ON}...   248   5e-73
Smik_11.302 Chr11 (505026..506684) [1659 bp, 553 aa] {ON} YKR039...   245   6e-73
Kpol_1010.32 s1010 (82500..84299) [1800 bp, 599 aa] {ON} (82500....   246   1e-72
KLLA0A10813g Chr1 complement(936126..937880) [1755 bp, 584 aa] {...   245   1e-72
SAKL0D02926g Chr4 (240708..242459) [1752 bp, 583 aa] {ON} unipro...   245   1e-72
Smik_16.115 Chr16 complement(214120..215931) [1812 bp, 603 aa] {...   246   2e-72
NCAS0A10680 Chr1 complement(2127039..2128820) [1782 bp, 593 aa] ...   245   2e-72
Kwal_26.9612 s26 complement(1291552..1293183) [1632 bp, 543 aa] ...   244   2e-72
KAFR0D00500 Chr4 complement(77541..79394) [1854 bp, 617 aa] {ON}      245   2e-72
Kpol_1052.16 s1052 (44303..46144) [1842 bp, 613 aa] {ON} (44303....   245   2e-72
TPHA0B04750 Chr2 (1119282..1121201) [1920 bp, 639 aa] {ON} Anc_1...   246   2e-72
Suva_2.716 Chr2 complement(1256781..1258592) [1812 bp, 603 aa] {...   245   2e-72
ZYRO0F13838g Chr6 (1139293..1141803) [2511 bp, 836 aa] {ON} simi...   249   3e-72
KNAG0J02200 Chr10 complement(407267..409090) [1824 bp, 607 aa] {...   245   3e-72
NCAS0B08580 Chr2 complement(1646220..1648103) [1884 bp, 627 aa] ...   245   4e-72
AAR038W Chr1 (409071..410771) [1701 bp, 566 aa] {ON} Syntenic ho...   243   4e-72
YGR191W Chr7 (880420..882231) [1812 bp, 603 aa] {ON}  HIP1High-a...   244   5e-72
SAKL0D00836g Chr4 complement(65731..67536) [1806 bp, 601 aa] {ON...   244   5e-72
Skud_7.525 Chr7 (856072..857883) [1812 bp, 603 aa] {ON} YGR191W ...   244   6e-72
NDAI0D02160 Chr4 (505202..506965) [1764 bp, 587 aa] {ON} Anc_5.158    243   6e-72
Skud_4.784 Chr4 complement(1386623..1388614) [1992 bp, 663 aa] {...   245   7e-72
Kpol_543.79 s543 (197876..199693) [1818 bp, 605 aa] {ON} (197876...   244   8e-72
KLTH0E15642g Chr5 (1389937..1391727) [1791 bp, 596 aa] {ON} simi...   243   1e-71
Suva_4.307 Chr4 complement(540768..542597) [1830 bp, 609 aa] {ON...   243   1e-71
AGR039C Chr7 complement(779720..781480) [1761 bp, 586 aa] {ON} S...   242   2e-71
Smik_4.790 Chr4 complement(1389278..1391269) [1992 bp, 663 aa] {...   243   4e-71
ZYRO0C17182g Chr3 complement(1334883..1336619) [1737 bp, 578 aa]...   241   5e-71
CAGL0L07546g Chr12 complement(833821..835725) [1905 bp, 634 aa] ...   242   5e-71
NCAS0I01530 Chr9 (286882..288669) [1788 bp, 595 aa] {ON}              241   7e-71
TBLA0I02010 Chr9 complement(455681..457567) [1887 bp, 628 aa] {O...   242   7e-71
Skud_2.191 Chr2 complement(342307..344136) [1830 bp, 609 aa] {ON...   241   7e-71
Kwal_33.15407 s33 (1092383..1094146) [1764 bp, 587 aa] {ON} YGR1...   240   1e-70
KLTH0C05170g Chr3 (449510..451306) [1797 bp, 598 aa] {ON} simila...   240   2e-70
Ecym_4230 Chr4 complement(478376..480949) [2574 bp, 857 aa] {ON}...   244   3e-70
KLTH0G11726g Chr7 complement(986837..989311) [2475 bp, 824 aa] {...   244   3e-70
SAKL0D04664g Chr4 complement(365852..367633) [1782 bp, 593 aa] {...   239   4e-70
NDAI0G06030 Chr7 complement(1489584..1491383) [1800 bp, 599 aa] ...   239   4e-70
Smik_2.201 Chr2 complement(355785..357614) [1830 bp, 609 aa] {ON...   239   4e-70
ZYRO0F17446g Chr6 (1451431..1453332) [1902 bp, 633 aa] {ON} simi...   239   7e-70
AGR038C Chr7 complement(777529..779271) [1743 bp, 580 aa] {ON} S...   238   7e-70
TBLA0I02000 Chr9 complement(452716..454710) [1995 bp, 664 aa] {O...   239   9e-70
TPHA0A02450 Chr1 (522439..524190) [1752 bp, 583 aa] {ON} Anc_3.3...   238   9e-70
Ecym_1056 Chr1 (102260..104080) [1821 bp, 606 aa] {ON} similar t...   238   9e-70
CAGL0E01089g Chr5 complement(96819..99380) [2562 bp, 853 aa] {ON...   243   1e-69
NCAS0D01870 Chr4 complement(343416..345203) [1788 bp, 595 aa] {O...   238   1e-69
SAKL0B08734g Chr2 complement(743379..745055) [1677 bp, 558 aa] {...   236   1e-69
NDAI0C02950 Chr3 (676753..678582) [1830 bp, 609 aa] {ON} Anc_5.158    238   1e-69
Suva_7.485 Chr7 (836820..838631) [1812 bp, 603 aa] {ON} YGR191W ...   238   1e-69
NCAS0A07110 Chr1 (1408106..1409884) [1779 bp, 592 aa] {ON} Anc_5...   237   2e-69
TPHA0M01200 Chr13 complement(244556..246379) [1824 bp, 607 aa] {...   238   2e-69
KNAG0H01150 Chr8 (193585..195438) [1854 bp, 617 aa] {ON}              238   2e-69
NDAI0A00640 Chr1 complement(118100..120025) [1926 bp, 641 aa] {O...   238   2e-69
NDAI0F04390 Chr6 (1073373..1075376) [2004 bp, 667 aa] {ON} Anc_1...   238   4e-69
Kpol_1052.14 s1052 (39793..41601) [1809 bp, 602 aa] {ON} (39793....   236   4e-69
ADL272W Chr4 (227414..229108) [1695 bp, 564 aa] {ON} Non-synteni...   235   5e-69
KLLA0D16830g Chr4 (1426856..1429354) [2499 bp, 832 aa] {ON} simi...   241   6e-69
NCAS0A08920 Chr1 (1765699..1767498) [1800 bp, 599 aa] {ON} Anc_1...   235   9e-69
YDR046C Chr4 complement(548762..550576) [1815 bp, 604 aa] {ON}  ...   235   2e-68
Kwal_27.10538 s27 (380769..382577) [1809 bp, 602 aa] {ON} YBR068...   234   2e-68
Kpol_534.22 s534 (50849..52627) [1779 bp, 592 aa] {ON} (50849..5...   234   2e-68
SAKL0H15092g Chr8 complement(1306212..1308764) [2553 bp, 850 aa]...   239   2e-68
Kpol_1065.13 s1065 (28709..30499) [1791 bp, 596 aa] {ON} (28709....   234   2e-68
TBLA0C01210 Chr3 complement(260786..262588) [1803 bp, 600 aa] {O...   234   3e-68
Ecym_2716 Chr2 (1386630..1388408) [1779 bp, 592 aa] {ON} similar...   233   4e-68
AGR319W Chr7 (1328425..1330305) [1881 bp, 626 aa] {ON} Syntenic ...   234   6e-68
KLLA0A06930g Chr1 complement(625498..627261) [1764 bp, 587 aa] {...   233   6e-68
KLTH0F11286g Chr6 (959314..961062) [1749 bp, 582 aa] {ON} simila...   233   6e-68
Kpol_2002.44 s2002 complement(89144..90370,90372..91028) [1884 b...   233   9e-68
Kwal_33.14276 s33 complement(596760..598550) [1791 bp, 596 aa] {...   233   1e-67
CAGL0B03773g Chr2 (373956..375773) [1818 bp, 605 aa] {ON} highly...   233   1e-67
Smik_4.284 Chr4 complement(515341..517155) [1815 bp, 604 aa] {ON...   233   1e-67
TDEL0C06510 Chr3 (1196039..1197967) [1929 bp, 642 aa] {ON} Anc_1...   233   1e-67
KNAG0B01270 Chr2 (240862..242640) [1779 bp, 592 aa] {ON} Anc_3.3...   232   2e-67
SAKL0C13992g Chr3 complement(1242080..1243738) [1659 bp, 552 aa]...   230   3e-67
TBLA0B07760 Chr2 complement(1834605..1836581) [1977 bp, 658 aa] ...   233   3e-67
AEL030W Chr5 (577803..579551) [1749 bp, 582 aa] {ON} Syntenic ho...   231   3e-67
Skud_4.300 Chr4 complement(525086..526900) [1815 bp, 604 aa] {ON...   231   5e-67
NCAS0A00420 Chr1 complement(62649..64688) [2040 bp, 679 aa] {ON}...   232   8e-67
KNAG0C00590 Chr3 complement(100801..102705) [1905 bp, 634 aa] {O...   231   1e-66
CAGL0C00539g Chr3 (57175..57177,57724..59502) [1782 bp, 593 aa] ...   229   1e-66
KLLA0C15873g Chr3 (1381699..1383405) [1707 bp, 568 aa] {ON} simi...   229   2e-66
KAFR0K01360 Chr11 complement(279140..280888) [1749 bp, 582 aa] {...   228   3e-66
NCAS0J00140 Chr10 complement(8478..10154) [1677 bp, 558 aa] {ON}      228   3e-66
TBLA0C02520 Chr3 (595918..597660) [1743 bp, 580 aa] {ON} Anc_3.3...   228   4e-66
Skud_2.192 Chr2 complement(344951..346810) [1860 bp, 619 aa] {ON...   229   4e-66
Sklu_YGOB_Anc_1.368 Chr4 complement(849414..850103,850105..85104...   227   4e-66
CAGL0D02178g Chr4 (222597..224330) [1734 bp, 577 aa] {ON} highly...   228   5e-66
SAKL0H10890g Chr8 complement(940629..943046) [2418 bp, 805 aa] {...   231   8e-66
YOL020W Chr15 (286172..287950) [1779 bp, 592 aa] {ON}  TAT2High ...   227   9e-66
TDEL0F04660 Chr6 (877951..880473) [2523 bp, 840 aa] {ON} Anc_8.3...   232   1e-65
Ecym_2663 Chr2 complement(1278309..1280078) [1770 bp, 589 aa] {O...   227   1e-65
NCAS0I00850 Chr9 (156277..158031) [1755 bp, 584 aa] {ON} Anc_3.3...   226   1e-65
Kwal_23.3847 s23 (457732..459471) [1740 bp, 579 aa] {ON} YBR132C...   226   2e-65
Kwal_33.13215 s33 complement(123154..124950) [1797 bp, 598 aa] {...   226   2e-65
KLTH0H13398g Chr8 complement(1169665..1171428) [1764 bp, 587 aa]...   226   2e-65
Kwal_34.16254 s34 (264235..265677) [1443 bp, 481 aa] {OFF} YOL02...   223   3e-65
Kwal_YGOB_34.16254 s34 (264235..265707) [1473 bp, 491 aa] {ON} A...   223   4e-65
KNAG0G00900 Chr7 complement(170122..171963) [1842 bp, 613 aa] {O...   226   4e-65
AFR230C Chr6 complement(855413..857227) [1815 bp, 604 aa] {ON} N...   226   5e-65
SAKL0H08184g Chr8 (704748..706544) [1797 bp, 598 aa] {ON} simila...   225   6e-65
TDEL0F02830 Chr6 complement(513358..515043) [1686 bp, 561 aa] {O...   224   6e-65
Suva_4.308 Chr4 complement(543427..545283) [1857 bp, 618 aa] {ON...   225   7e-65
Skud_4.418 Chr4 (745597..748152) [2556 bp, 851 aa] {ON} YDR160W ...   229   7e-65
Smik_2.202 Chr2 complement(358478..360331) [1854 bp, 617 aa] {ON...   225   9e-65
Ecym_2662 Chr2 complement(1275924..1277693) [1770 bp, 589 aa] {O...   224   2e-64
YDR160W Chr4 (776163..778721) [2559 bp, 852 aa] {ON}  SSY1Compon...   228   2e-64
Skud_15.138 Chr15 (245592..247370) [1779 bp, 592 aa] {ON} YOL020...   223   2e-64
Suva_2.323 Chr2 (570119..572674) [2556 bp, 851 aa] {ON} YDR160W ...   228   2e-64
Ecym_3430 Chr3 (807979..809658) [1680 bp, 559 aa] {ON} similar t...   223   2e-64
Ecym_8297 Chr8 complement(602984..604693) [1710 bp, 569 aa] {ON}...   222   5e-64
YFL055W Chr6 (17004..18680) [1677 bp, 558 aa] {ON}  AGP3Low-affi...   221   5e-64
NDAI0A08190 Chr1 complement(1875783..1877543) [1761 bp, 586 aa] ...   222   7e-64
KLLA0F27093g Chr6 (2501049..2502740) [1692 bp, 563 aa] {ON} simi...   221   1e-63
Smik_4.404 Chr4 (734205..736763) [2559 bp, 852 aa] {ON} YDR160W ...   225   3e-63
Kwal_53.19461 s53 complement(2918..4615) [1698 bp, 565 aa] {ON} ...   219   4e-63
Suva_15.148 Chr15 (258987..260765) [1779 bp, 592 aa] {ON} YOL020...   220   4e-63
KNAG0J02210 Chr10 complement(409847..411592) [1746 bp, 581 aa] {...   219   6e-63
TPHA0A03960 Chr1 (877702..879549) [1848 bp, 615 aa] {ON}              219   9e-63
NDAI0J00870 Chr10 complement(191679..194192) [2514 bp, 837 aa] {...   223   1e-62
Smik_15.146 Chr15 (252586..254367) [1782 bp, 593 aa] {ON} YOL020...   219   1e-62
TBLA0F03240 Chr6 complement(790069..791826) [1758 bp, 585 aa] {O...   218   2e-62
CAGL0M00154g Chr13 (22039..23691) [1653 bp, 550 aa] {ON} similar...   216   6e-62
KNAG0L00110 Chr12 complement(8543..10258) [1716 bp, 571 aa] {ON}...   216   7e-62
KNAG0A05040 Chr1 complement(733928..736432) [2505 bp, 834 aa] {O...   221   1e-61
Skud_6.2 Chr6 (1506..3182) [1677 bp, 558 aa] {ON} YFL055W (REAL)      214   3e-61
ZYRO0G12342g Chr7 complement(976302..978164) [1863 bp, 620 aa] {...   215   4e-61
TDEL0E05700 Chr5 complement(1059079..1060833) [1755 bp, 584 aa] ...   214   8e-61
NDAI0A01340 Chr1 (296616..298280) [1665 bp, 554 aa] {ON}              213   8e-61
Kpol_543.78 s543 (193316..195133) [1818 bp, 605 aa] {ON} (193316...   213   1e-60
KLTH0E11792g Chr5 (1047925..1050339) [2415 bp, 804 aa] {ON} simi...   216   2e-60
KAFR0F04410 Chr6 (865219..866961) [1743 bp, 580 aa] {ON}              212   2e-60
ZYRO0A00308g Chr1 complement(16982..18676) [1695 bp, 564 aa] {ON...   211   3e-60
Smik_13.1 Chr13 (1838..3409) [1572 bp, 523 aa] {ON} YFL055W (REAL)    210   4e-60
ZYRO0G07172g Chr7 complement(565863..567566) [1704 bp, 567 aa] {...   211   7e-60
YBR069C Chr2 complement(376574..378433) [1860 bp, 619 aa] {ON}  ...   211   9e-60
AGL171W Chr7 (377256..379811) [2556 bp, 851 aa] {ON} Syntenic ho...   214   2e-59
TPHA0A02500 Chr1 (533688..535460) [1773 bp, 590 aa] {ON} Anc_1.3...   209   4e-59
KLTH0C08052g Chr3 (685805..687604) [1800 bp, 599 aa] {ON} simila...   208   1e-58
NCAS0B03380 Chr2 complement(589351..591888) [2538 bp, 845 aa] {O...   212   1e-58
YLL061W Chr12 (17956..19707) [1752 bp, 583 aa] {ON}  MMP1High-af...   207   2e-58
SAKL0A09724g Chr1 complement(855698..857353) [1656 bp, 551 aa] {...   206   2e-58
Kwal_YGOB_27.11900 s27 (994323..996518,996909..997118) [2406 bp,...   210   5e-58
TDEL0H04510 Chr8 complement(813321..815075) [1755 bp, 584 aa] {O...   206   6e-58
KAFR0F02250 Chr6 (439217..440881) [1665 bp, 554 aa] {ON}              202   8e-57
KLLA0F01012g Chr6 complement(90772..92442) [1671 bp, 556 aa] {ON...   201   1e-56
TBLA0G03120 Chr7 (825095..827116) [2022 bp, 673 aa] {ON}              204   2e-56
KLLA0B09922g Chr2 complement(867748..870141) [2394 bp, 797 aa] {...   203   1e-55
Suva_16.31 Chr16 (39282..41042) [1761 bp, 586 aa] {ON} YLL061W (...   199   2e-55
SAKL0D04048g Chr4 (328883..330643) [1761 bp, 586 aa] {ON} simila...   197   1e-54
KLLA0B06776g Chr2 (594172..595938) [1767 bp, 588 aa] {ON} simila...   197   1e-54
Smik_12.2 Chr12 (2207..3958) [1752 bp, 583 aa] {ON} YLL061W (REAL)    196   2e-54
TDEL0E00250 Chr5 (41958..43721) [1764 bp, 587 aa] {ON}                196   3e-54
YPL274W Chr16 (22938..24701) [1764 bp, 587 aa] {ON}  SAM3High-af...   196   3e-54
TDEL0B00130 Chr2 (20136..21890) [1755 bp, 584 aa] {ON}                195   7e-54
Suva_16.18 Chr16 (17108..18859) [1752 bp, 583 aa] {ON} YLL061W (...   192   4e-53
KLTH0D07128g Chr4 complement(624863..626494) [1632 bp, 543 aa] {...   191   7e-53
AER405C Chr5 complement(1413790..1415283) [1494 bp, 497 aa] {ON}...   189   1e-52
NCAS0I01520 Chr9 (284348..286192) [1845 bp, 614 aa] {ON}              189   1e-51
Smik_6.483 Chr6 (798526..800298) [1773 bp, 590 aa] {ON} YPL274W ...   188   2e-51
KAFR0B00220 Chr2 complement(52244..54001) [1758 bp, 585 aa] {ON}      185   2e-50
Kwal_26.8097 s26 (643310..644944) [1635 bp, 544 aa] {ON} YNL270C...   183   4e-50
Kwal_27.11900 s27 (994323..996500) [2178 bp, 726 aa] {OFF} YDR16...   186   8e-50
Kwal_56.22951 s56 complement(345097..346887) [1791 bp, 596 aa] {...   181   1e-48
TPHA0G03770 Chr7 complement(797508..799322) [1815 bp, 604 aa] {O...   179   5e-48
NDAI0A07500 Chr1 complement(1715826..1717685) [1860 bp, 619 aa] ...   179   6e-48
ZYRO0D17952g Chr4 complement(1489975..1491732) [1758 bp, 585 aa]...   177   2e-47
Ecym_4758 Chr4 (1474661..1476424) [1764 bp, 587 aa] {ON} similar...   176   5e-47
ZYRO0D09086g Chr4 complement(780326..781966) [1641 bp, 546 aa] {...   172   7e-46
SAKL0B04554g Chr2 complement(401845..403461) [1617 bp, 538 aa] {...   167   2e-44
Skud_7.4 Chr7 (9030..10079) [1050 bp, 349 aa] {ON} YKR039W (REAL)     162   3e-44
Skud_51.1 Chr51 (364..1407) [1044 bp, 348 aa] {ON} YKR039W (REAL)     162   5e-44
KLTH0E00550g Chr5 (57109..58680) [1572 bp, 523 aa] {ON} similar ...   162   8e-43
Skud_30.1 Chr30 (3097..3933) [837 bp, 279 aa] {ON} YPL274W (REAL)     110   3e-26
Suva_84.1 Chr84 (1..639) [639 bp, 213 aa] {ON} YPL274W (REAL)         107   6e-26
Skud_16.3 Chr16 (4274..5350) [1077 bp, 358 aa] {ON} YPL274W (REAL)    110   1e-25
Skud_47.1 Chr47 (1..987) [987 bp, 328 aa] {ON} YPL274W (REAL)          97   2e-21
Suva_78.1 Chr78 complement(3..695) [693 bp, 231 aa] {ON} YPL274W...    95   3e-21
Skud_7.5 Chr7 (10082..10387) [306 bp, 102 aa] {ON} YKR039W (REAL)      75   1e-15
TDEL0C00100 Chr3 complement(1863..2399) [537 bp, 178 aa] {ON}          61   3e-10
NCAS0E01810 Chr5 complement(354074..354589) [516 bp, 171 aa] {ON...    51   8e-07
Suva_13.516 Chr13 complement(902560..903123,903176..903289) [678...    52   1e-06
NDAI0F04210 Chr6 (1018256..1018768) [513 bp, 170 aa] {ON}              49   4e-06
Skud_7.6 Chr7 (10388..10840) [453 bp, 150 aa] {ON} YKR039W (REAL)      47   2e-05
Kwal_55.19721 s55 complement(95893..97626) [1734 bp, 577 aa] {ON...    40   0.024
KLLA0E12959g Chr5 complement(1146299..1148038) [1740 bp, 579 aa]...    35   0.48 
Suva_11.49 Chr11 complement(105256..107115) [1860 bp, 619 aa] {O...    34   1.0  
Smik_6.7 Chr6 (9124..9204,9208..9294,9405..9470,9474..9617,9624....    33   2.3  
AFL081W Chr6 (286339..287967) [1629 bp, 542 aa] {ON} Syntenic ho...    32   4.1  
YKL174C Chr11 complement(120380..122236) [1857 bp, 618 aa] {ON} ...    32   5.7  
CAGL0M08272g Chr13 complement(823019..824884) [1866 bp, 621 aa] ...    32   6.0  
ZYRO0F00242g Chr6 (26301..27908) [1608 bp, 535 aa] {ON} similar ...    31   9.4  

>CAGL0A01199g Chr1 (121067..122908) [1842 bp, 613 aa] {ON} similar
           to uniprot|P53388 Saccharomyces cerevisiae YPL265w DIP5
           dicarboxylic amino acid permease
          Length = 613

 Score = 1106 bits (2861), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 549/613 (89%), Positives = 549/613 (89%)

Query: 1   MTTTLSVPPVFSENHSMVSLGASDSRGXXXXXXXXXXXXXXXXXXDKKDGLDINDMDNLS 60
           MTTTLSVPPVFSENHSMVSLGASDSRG                  DKKDGLDINDMDNLS
Sbjct: 1   MTTTLSVPPVFSENHSMVSLGASDSRGHHLTEHTHHEHHVNHVNHDKKDGLDINDMDNLS 60

Query: 61  TVSSRLEDSEKQDDYMDDGKDEHTRLRKDLKARHISMIAXXXXXXXXXXXXXXXXXYTAG 120
           TVSSRLEDSEKQDDYMDDGKDEHTRLRKDLKARHISMIA                 YTAG
Sbjct: 61  TVSSRLEDSEKQDDYMDDGKDEHTRLRKDLKARHISMIAIGGSIGTGLLIGTGNSLYTAG 120

Query: 121 PMSMFIAYAFVGVLVFFTMAALGEMASYIPLDGFTSYASRYCDPALGFAVGYAYLCKYLI 180
           PMSMFIAYAFVGVLVFFTMAALGEMASYIPLDGFTSYASRYCDPALGFAVGYAYLCKYLI
Sbjct: 121 PMSMFIAYAFVGVLVFFTMAALGEMASYIPLDGFTSYASRYCDPALGFAVGYAYLCKYLI 180

Query: 181 LPPNQLTAAALVIQYWLDREQVNPGVWITIFLVIIVAMNFIGVKFFGEFEFWLSTFKVIV 240
           LPPNQLTAAALVIQYWLDREQVNPGVWITIFLVIIVAMNFIGVKFFGEFEFWLSTFKVIV
Sbjct: 181 LPPNQLTAAALVIQYWLDREQVNPGVWITIFLVIIVAMNFIGVKFFGEFEFWLSTFKVIV 240

Query: 241 MIGLIILLFVIMLGGGPTHDRLGFRFYDHPGAFKPYSKSIDGSKGKXXXXXXXXXXXXXX 300
           MIGLIILLFVIMLGGGPTHDRLGFRFYDHPGAFKPYSKSIDGSKGK              
Sbjct: 241 MIGLIILLFVIMLGGGPTHDRLGFRFYDHPGAFKPYSKSIDGSKGKFVAFVAVLVYALFA 300

Query: 301 XXGIELTGIVAAEAANPRKSIPKAIKLTMYRIIVFYLVTIFLLGMCVAYDDPLLXXXXXX 360
             GIELTGIVAAEAANPRKSIPKAIKLTMYRIIVFYLVTIFLLGMCVAYDDPLL      
Sbjct: 301 YLGIELTGIVAAEAANPRKSIPKAIKLTMYRIIVFYLVTIFLLGMCVAYDDPLLKKAKTS 360

Query: 361 XXXXXXXPYVVAIINSGIKALPHIFNACVLMFVFSACNSDLYVASRTLYGLAIDNKAPKI 420
                  PYVVAIINSGIKALPHIFNACVLMFVFSACNSDLYVASRTLYGLAIDNKAPKI
Sbjct: 361 GTGAAASPYVVAIINSGIKALPHIFNACVLMFVFSACNSDLYVASRTLYGLAIDNKAPKI 420

Query: 421 FAVTNRWGVPYYSLLMSSCFCLLAYMSVSSGSAKIFNYFVNVVSIFGLLSWISILITYLC 480
           FAVTNRWGVPYYSLLMSSCFCLLAYMSVSSGSAKIFNYFVNVVSIFGLLSWISILITYLC
Sbjct: 421 FAVTNRWGVPYYSLLMSSCFCLLAYMSVSSGSAKIFNYFVNVVSIFGLLSWISILITYLC 480

Query: 481 FFRAVKAQNVDRSRFAYRAPFQPYGSYFTLAFCILIAFIKNFTVFLNHHFDYKNFITGYI 540
           FFRAVKAQNVDRSRFAYRAPFQPYGSYFTLAFCILIAFIKNFTVFLNHHFDYKNFITGYI
Sbjct: 481 FFRAVKAQNVDRSRFAYRAPFQPYGSYFTLAFCILIAFIKNFTVFLNHHFDYKNFITGYI 540

Query: 541 GIPVFVISYFGYKFVKKTKIWKPEEVDLYTFKAAIDEEEEQGKIADAERRERLKNSKTKG 600
           GIPVFVISYFGYKFVKKTKIWKPEEVDLYTFKAAIDEEEEQGKIADAERRERLKNSKTKG
Sbjct: 541 GIPVFVISYFGYKFVKKTKIWKPEEVDLYTFKAAIDEEEEQGKIADAERRERLKNSKTKG 600

Query: 601 WDWFYEKVLGNIF 613
           WDWFYEKVLGNIF
Sbjct: 601 WDWFYEKVLGNIF 613

>Kpol_358.3 s358 (7369..9096) [1728 bp, 575 aa] {ON} (7369..9096)
           [1728 nt, 576 aa]
          Length = 575

 Score =  765 bits (1976), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 376/562 (66%), Positives = 441/562 (78%), Gaps = 2/562 (0%)

Query: 52  DINDMDNLSTVSSRLEDSEKQDDYMDDGKDEHTRLRKDLKARHISMIAXXXXXXXXXXXX 111
           DI D++  +T S    + E   + + DGK++  RL+K+LKARHISMIA            
Sbjct: 16  DIIDLEKNTTSSLNSFEQEDDSNKISDGKEDGVRLKKELKARHISMIAIGGSLGTGLLIG 75

Query: 112 XXXXXYTAGPMSMFIAYAFVGVLVFFTMAALGEMASYIPLDGFTSYASRYCDPALGFAVG 171
                 T GP S+ IAY+FVG+LVFF MA LGEMA+YIPLDGFTSYA+RYCDPALGFAVG
Sbjct: 76  TGTALRTGGPASILIAYSFVGILVFFVMACLGEMATYIPLDGFTSYATRYCDPALGFAVG 135

Query: 172 YAYLCKYLILPPNQLTAAALVIQYWLDREQVNPGVWITIFLVIIVAMNFIGVKFFGEFEF 231
           Y YL KY I+ PNQLTA ALVIQYW+DRE VNPGVWITIFLV+IV +N +GV++FGEFEF
Sbjct: 136 YCYLFKYFIITPNQLTAGALVIQYWIDRETVNPGVWITIFLVVIVIINTVGVRYFGEFEF 195

Query: 232 WLSTFKVIVMIGLIILLFVIMLGGGPTHDRLGFRFYDHPGAFKPYSKSIDGSKGKXXXXX 291
           WLS+FK++VM G+I+ LF+IMLGGGP HDRLGFR++ +PGAFKPYS+SI GSKGK     
Sbjct: 196 WLSSFKIMVMFGVILFLFIIMLGGGPNHDRLGFRYWKNPGAFKPYSESITGSKGKFVSFV 255

Query: 292 XXXXXXXXXXXGIELTGIVAAEAANPRKSIPKAIKLTMYRIIVFYLVTIFLLGMCVAYDD 351
                      GIELTGIVAAEA NPR++IP+AIKLTMYRII+FY+VTIFLLGMCVAY+D
Sbjct: 256 AVFVYALFAYLGIELTGIVAAEAENPRRNIPRAIKLTMYRIILFYIVTIFLLGMCVAYND 315

Query: 352 PLLXXXXXXXXXXXXXPYVVAIINSGIKALPHIFNACVLMFVFSACNSDLYVASRTLYGL 411
           P L             P+VVAI NSG++ALPHIFN CVL+FVFSACNSDLYV +R+LY L
Sbjct: 316 PRLLAAAHASTSAAASPFVVAIQNSGVRALPHIFNVCVLIFVFSACNSDLYVGTRSLYSL 375

Query: 412 AIDNKAPKIFAVTNRWGVPYYSLLMSSCFCLLAYMSVSSGSAKIFNYFVNVVSIFGLLSW 471
           AID KAPK+FA TNRWGVPY +L     FCLLAYM+VSSGSA+IFNYFVNVVSIFG+LSW
Sbjct: 376 AIDGKAPKLFAKTNRWGVPYNALFGCFLFCLLAYMNVSSGSAQIFNYFVNVVSIFGILSW 435

Query: 472 ISILITYLCFFRAVKAQNVDRSRFAYRAPFQPYGSYFTLAFCILIAFIKNFTVFLNHHFD 531
           ISILITY+ F+RA  AQNVDR+ FAYRAPFQPYG+Y TL FC+LIAFIKNFTVF+   FD
Sbjct: 436 ISILITYIFFYRACIAQNVDRNSFAYRAPFQPYGAYITLFFCVLIAFIKNFTVFIG-EFD 494

Query: 532 YKNFITGYIGIPVFVISYFGYKFVKKTKIWKPEEVDLYTFKAAIDEEEEQGKIADAERRE 591
           YK+FITGYIG+P++VI YFGYK + KTK+ K EE DLY+FK AID EE +GKI +AE +E
Sbjct: 495 YKSFITGYIGLPLYVIFYFGYKIIYKTKLVKAEEADLYSFKEAIDREEAEGKIKEAEAKE 554

Query: 592 RLKNSKTKGWDWFYEKVLGNIF 613
           RLKNSK K   WFYEK LG IF
Sbjct: 555 RLKNSK-KSLKWFYEKYLGYIF 575

>NDAI0I02660 Chr9 complement(619959..621743) [1785 bp, 594 aa] {ON} 
          Length = 594

 Score =  766 bits (1978), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 393/568 (69%), Positives = 458/568 (80%), Gaps = 6/568 (1%)

Query: 47  KKDGLDINDMD-NLSTVSSRLEDSEKQDDYMDDGKDEHTRLRKDLKARHISMIAXXXXXX 105
           +++ L  +D++ N+S+ SS+ E+    D Y  DGK E TRL+K LKARH+SMIA      
Sbjct: 32  QEEELINDDLERNISSASSQDEN----DSYNIDGKTEGTRLKKALKARHVSMIAIGGSLG 87

Query: 106 XXXXXXXXXXXYTAGPMSMFIAYAFVGVLVFFTMAALGEMASYIPLDGFTSYASRYCDPA 165
                        AGP+S  IAYAFVG+LVFFTMA LGEMA+YIPLDGFTSYASRYCDPA
Sbjct: 88  TGLLIGTGTSLALAGPVSTLIAYAFVGLLVFFTMACLGEMATYIPLDGFTSYASRYCDPA 147

Query: 166 LGFAVGYAYLCKYLILPPNQLTAAALVIQYWLDREQVNPGVWITIFLVIIVAMNFIGVKF 225
           LGFAVGYAYL KY ILPPNQLTAAALVIQYW+D+E+VNPGVW+TIFLV+IV++N  GV+F
Sbjct: 148 LGFAVGYAYLFKYFILPPNQLTAAALVIQYWVDKEKVNPGVWVTIFLVVIVSINVFGVRF 207

Query: 226 FGEFEFWLSTFKVIVMIGLIILLFVIMLGGGPTHDRLGFRFYDHPGAFKPYSKSIDGSKG 285
           FGEFEFWLS+FKV+VM+GL++LLF++MLGGGP HDRLGFR++ HPG+FK YS++I G  G
Sbjct: 208 FGEFEFWLSSFKVLVMLGLMLLLFILMLGGGPDHDRLGFRYWRHPGSFKEYSETITGDTG 267

Query: 286 KXXXXXXXXXXXXXXXXGIELTGIVAAEAANPRKSIPKAIKLTMYRIIVFYLVTIFLLGM 345
           +                GIELTGIVAAEA NPRKSIPKAIKLTMYRI++FYL++IFLLGM
Sbjct: 268 RFVAFVSVFVYATYAYLGIELTGIVAAEAQNPRKSIPKAIKLTMYRIVIFYLISIFLLGM 327

Query: 346 CVAYDDPLLXXXXXXXXXXXXXPYVVAIINSGIKALPHIFNACVLMFVFSACNSDLYVAS 405
           CVAYDDPLL             P+VVAIINSGI ALPHI NACVL+FVFSACNSDLYV+S
Sbjct: 328 CVAYDDPLLIKAKNSSTSAAASPFVVAIINSGINALPHIINACVLVFVFSACNSDLYVSS 387

Query: 406 RTLYGLAIDNKAPKIFAVTNRWGVPYYSLLMSSCFCLLAYMSVSSGSAKIFNYFVNVVSI 465
           R+LY LAIDNKAPKIFA TNRWG+PYY+L +S  FCLLAYM VSS SAKIFNYFVNVVSI
Sbjct: 388 RSLYSLAIDNKAPKIFAKTNRWGIPYYALSVSVLFCLLAYMCVSSASAKIFNYFVNVVSI 447

Query: 466 FGLLSWISILITYLCFFRAVKAQNVDRSRFAYRAPFQPYGSYFTLAFCILIAFIKNFTVF 525
           FG+LSWISILITY+CF RAV+AQ VD+S FAY APFQPYG++F+L FC LIA IKNFTVF
Sbjct: 448 FGILSWISILITYICFDRAVRAQGVDKSTFAYVAPFQPYGAWFSLFFCCLIALIKNFTVF 507

Query: 526 LNHHFDYKNFITGYIGIPVFVISYFGYKFVKKTKIWKPEEVDLYTFKAAIDEEEEQGKIA 585
           LNH FDYKNFITGYIG+PVF   YFGYKF  KTK+  P +VDLYTFKAAID+EEE GK+A
Sbjct: 508 LNHQFDYKNFITGYIGLPVFFFCYFGYKFTYKTKVIDPLKVDLYTFKAAIDQEEEDGKMA 567

Query: 586 DAERRERLKNSKTKGWDWFYEKVLGNIF 613
           DAE+ ER+K +  K ++WFY+K LGNIF
Sbjct: 568 DAEKAERIKQNG-KNFEWFYDKFLGNIF 594

>NCAS0D02260 Chr4 (421966..423759) [1794 bp, 597 aa] {ON} 
          Length = 597

 Score =  753 bits (1945), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 383/560 (68%), Positives = 436/560 (77%), Gaps = 3/560 (0%)

Query: 54  NDMDNLSTVSSRLEDSEKQDDYMDDGKDEHTRLRKDLKARHISMIAXXXXXXXXXXXXXX 113
           +D++N  ++S+  ED  + D Y  DGK E TRL+K L+ R +SM+A              
Sbjct: 41  DDLENNISLSTSAED--QNDSYNVDGKTEGTRLKKVLEGRVVSMVAIGGSLGTGLLIGTG 98

Query: 114 XXXYTAGPMSMFIAYAFVGVLVFFTMAALGEMASYIPLDGFTSYASRYCDPALGFAVGYA 173
               TAGP+SM IAYAFVG+LVFFTMA+LGEMASYIPLDGFTSYA+RY DPALGFAVGY 
Sbjct: 99  NSLATAGPVSMLIAYAFVGLLVFFTMASLGEMASYIPLDGFTSYATRYADPALGFAVGYC 158

Query: 174 YLCKYLILPPNQLTAAALVIQYWLDREQVNPGVWITIFLVIIVAMNFIGVKFFGEFEFWL 233
           YL KY ILPPNQLTAAALVIQYW+ RE+VNPGVWITIFLV+IVA+N +GV+FFGEFEFWL
Sbjct: 159 YLFKYFILPPNQLTAAALVIQYWIPREKVNPGVWITIFLVVIVAINTLGVQFFGEFEFWL 218

Query: 234 STFKVIVMIGLIILLFVIMLGGGPTHDRLGFRFYDHPGAFKPYSKSIDGSKGKXXXXXXX 293
           S+FKV+VM  LIILLF++MLGGGP HDRLGFR + HPGAF  YS +I G  GK       
Sbjct: 219 SSFKVLVMFALIILLFILMLGGGPNHDRLGFRHWKHPGAFNNYSPAITGDTGKFVAFVSV 278

Query: 294 XXXXXXXXXGIELTGIVAAEAANPRKSIPKAIKLTMYRIIVFYLVTIFLLGMCVAYDDPL 353
                    G EL GIV  EA NPRKS+PKAIKLTMYRII+FYL++I LLGMCV YDDPL
Sbjct: 279 FVYATFAYLGTELVGIVVGEARNPRKSVPKAIKLTMYRIIIFYLISILLLGMCVGYDDPL 338

Query: 354 LXXXXXXXXXXXXXPYVVAIINSGIKALPHIFNACVLMFVFSACNSDLYVASRTLYGLAI 413
           L             P+VVAI+NSGIK LPHIFNACVL+FVFSACNSDLYVASR+LY LAI
Sbjct: 339 LLEAKTKSTSAAASPFVVAIVNSGIKVLPHIFNACVLVFVFSACNSDLYVASRSLYSLAI 398

Query: 414 DNKAPKIFAVTNRWGVPYYSLLMSSCFCLLAYMSVSSGSAKIFNYFVNVVSIFGLLSWIS 473
           DNKAPKIFA TNRWG+PYYSL +S  FCLLAYMSVSSGSAKIFNYFVNVVSIFGLLSWI 
Sbjct: 399 DNKAPKIFARTNRWGIPYYSLGLSVLFCLLAYMSVSSGSAKIFNYFVNVVSIFGLLSWIC 458

Query: 474 ILITYLCFFRAVKAQNVDRSRFAYRAPFQPYGSYFTLAFCILIAFIKNFTVFLNHHFDYK 533
           IL+TYL F RAV+AQ +D+S F+Y AP Q YG+YF L FC LIA IKNFTVFL H FDYK
Sbjct: 459 ILVTYLAFDRAVRAQGIDKSTFSYVAPGQRYGAYFALFFCSLIALIKNFTVFLGHQFDYK 518

Query: 534 NFITGYIGIPVFVISYFGYKFVKKTKIWKPEEVDLYTFKAAIDEEEEQGKIADAERRERL 593
            FITGYIGIPVF ISYFGYK + KTKI  P EVDLYTFKAAID+EEE GK+ D  R+ER+
Sbjct: 519 TFITGYIGIPVFFISYFGYKLIYKTKIIDPLEVDLYTFKAAIDQEEEDGKLEDIARKERI 578

Query: 594 KNSKTKGWDWFYEKVLGNIF 613
           K +  + ++WFY+K L NIF
Sbjct: 579 K-ANGRNFEWFYDKFLSNIF 597

>TPHA0M00130 Chr13 complement(25769..27604) [1836 bp, 611 aa] {ON} 
          Length = 611

 Score =  748 bits (1932), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 372/566 (65%), Positives = 435/566 (76%), Gaps = 5/566 (0%)

Query: 51  LDINDMDNLSTVSSRLEDSEKQDDYMDDGKDEHTRLRKDLKARHISMIAXXXXXXXXXXX 110
           L++ND    +T+           + MD GKD+ TRL+KDLKARHISMIA           
Sbjct: 48  LEVNDQTRQNTLDDDASADSDGYNVMD-GKDDGTRLKKDLKARHISMIAIGGSLGTGLLI 106

Query: 111 XXXXXXYTAGPMSMFIAYAFVGVLVFFTMAALGEMASYIPLDGFTSYASRYCDPALGFAV 170
                  TAGP S+ IAY FVG LVFFTMAALGEMA+YIPLDGFTSYASRYCDPALGFAV
Sbjct: 107 GTGTALRTAGPASILIAYTFVGTLVFFTMAALGEMAAYIPLDGFTSYASRYCDPALGFAV 166

Query: 171 GYAYLCKYLILPPNQLTAAALVIQYWLDREQVNPGVWITIFLVIIVAMNFIGVKFFGEFE 230
           GY+YL KY I+ PNQLTAAALVIQYW+DR+ VNPGVWITIFLV+I+A+N IGVK+FGEFE
Sbjct: 167 GYSYLFKYFIITPNQLTAAALVIQYWVDRDTVNPGVWITIFLVVIIAINTIGVKYFGEFE 226

Query: 231 FWLSTFKVIVMIGLIILLFVIMLGGGPTHDRLGFRFYDHPGAFKPYSKS---IDGSKGKX 287
           FWLS+FK++VMIG++I LFVIMLGGGP HDRLGFR++  PGAFKPYS S   I+GS GK 
Sbjct: 227 FWLSSFKIMVMIGVMIFLFVIMLGGGPNHDRLGFRYWKTPGAFKPYSSSVVNIEGSTGKF 286

Query: 288 XXXXXXXXXXXXXXXGIELTGIVAAEAANPRKSIPKAIKLTMYRIIVFYLVTIFLLGMCV 347
                          GIELTGIVAAEA NPR++IP+AIKLT++RI+ FY+ TIFLLGMCV
Sbjct: 287 VAFVNVFVYALFAYLGIELTGIVAAEAENPRRNIPRAIKLTVWRILFFYVATIFLLGMCV 346

Query: 348 AYDDPLLXXXXXXXXXXXXXPYVVAIINSGIKALPHIFNACVLMFVFSACNSDLYVASRT 407
           AYDDPLL             P+VVAI NSG+  LPHIFN CVLMFVFSACNSDLYV +R+
Sbjct: 347 AYDDPLLLAAANAQTSAAASPFVVAIQNSGVDVLPHIFNVCVLMFVFSACNSDLYVGTRS 406

Query: 408 LYGLAIDNKAPKIFAVTNRWGVPYYSLLMSSCFCLLAYMSVSSGSAKIFNYFVNVVSIFG 467
           LY LA+D KAPKIFA TNRWGVPY ++     FCLLAYM+VSSGSA+IFNYFVNVVSIFG
Sbjct: 407 LYSLAVDGKAPKIFAKTNRWGVPYNAMGGCVLFCLLAYMNVSSGSAEIFNYFVNVVSIFG 466

Query: 468 LLSWISILITYLCFFRAVKAQNVDRSRFAYRAPFQPYGSYFTLAFCILIAFIKNFTVFLN 527
           +LSW SILIT++ F RAV+AQ +DRS FAY APFQPYGSYF L FC+L+A IKNF+VFL 
Sbjct: 467 VLSWSSILITFIYFDRAVRAQGIDRSTFAYVAPFQPYGSYFALFFCVLLALIKNFSVFLG 526

Query: 528 HHFDYKNFITGYIGIPVFVISYFGYKFVKKTKIWKPEEVDLYTFKAAIDEEEEQGKIADA 587
           + FDYK FITGYIG+PV+  S+ GYK   KTK  KP E DL ++KAA+D EEE+GKI +A
Sbjct: 527 NEFDYKTFITGYIGLPVYAFSFIGYKLYYKTKTVKPHEADLNSYKAAVDREEEEGKIKEA 586

Query: 588 ERRERLKNSKTKGWDWFYEKVLGNIF 613
           ER+ERLK+ K K  +WFYEK + +IF
Sbjct: 587 ERKERLKHGK-KDLEWFYEKYISSIF 611

>KNAG0L02460 Chr12 (437963..439729) [1767 bp, 588 aa] {ON} 
          Length = 588

 Score =  746 bits (1925), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 392/568 (69%), Positives = 451/568 (79%), Gaps = 6/568 (1%)

Query: 46  DKKDGLDINDMDNLSTVSSRLEDSEKQDDYMDDGKDEHTRLRKDLKARHISMIAXXXXXX 105
           +KK+   I D++  ST S  L+D+ +Q D    GK    RL+KDLKARH+SMIA      
Sbjct: 27  NKKEPFQI-DIEKESTESVALDDTNEQFD----GKCSDQRLKKDLKARHVSMIAIGGSLG 81

Query: 106 XXXXXXXXXXXYTAGPMSMFIAYAFVGVLVFFTMAALGEMASYIPLDGFTSYASRYCDPA 165
                        AGP+SM I+Y+FVGVLVFF M+ +GEMA+YIPLDGFTSYASRYCDPA
Sbjct: 82  TGLLIGTGNSLAVAGPVSMLISYSFVGVLVFFVMSCIGEMAAYIPLDGFTSYASRYCDPA 141

Query: 166 LGFAVGYAYLCKYLILPPNQLTAAALVIQYWLDREQVNPGVWITIFLVIIVAMNFIGVKF 225
           LGFAVGYAYL KY ILPPNQLTAAALVIQYW+ RE+VNPGVWITI LV+IV +N  GVKF
Sbjct: 142 LGFAVGYAYLVKYFILPPNQLTAAALVIQYWIPREKVNPGVWITIVLVVIVVINTFGVKF 201

Query: 226 FGEFEFWLSTFKVIVMIGLIILLFVIMLGGGPTHDRLGFRFYDHPGAFKPYSKSIDGSKG 285
           FGEFEFWLS+FKVIVM+GLIIL+F+IMLGG PTHDRLGFR++ HPGAFK YSKSI G  G
Sbjct: 202 FGEFEFWLSSFKVIVMLGLIILMFIIMLGGTPTHDRLGFRYWKHPGAFKEYSKSIHGDIG 261

Query: 286 KXXXXXXXXXXXXXXXXGIELTGIVAAEAANPRKSIPKAIKLTMYRIIVFYLVTIFLLGM 345
           +                GIELTGIVAAEA NPRK+IPKAIKLTM+RII+FY++TIFLLGM
Sbjct: 262 RFVSFVSCFVYGLFCYLGIELTGIVAAEAENPRKNIPKAIKLTMWRIIIFYIITIFLLGM 321

Query: 346 CVAYDDPLLXXXXXXXXXXXXXPYVVAIINSGIKALPHIFNACVLMFVFSACNSDLYVAS 405
           CV+ +DPLL             P+VVAI+NSGI+ALPHIFNACVLMFVFSACNSDLYVAS
Sbjct: 322 CVSSNDPLLLEAKTKSTSAAASPFVVAIVNSGIEALPHIFNACVLMFVFSACNSDLYVAS 381

Query: 406 RTLYGLAIDNKAPKIFAVTNRWGVPYYSLLMSSCFCLLAYMSVSSGSAKIFNYFVNVVSI 465
           R LY LAIDNKAPKIFA TNR+G+PY SL ++  FCLLAYMSVSSGSAKIFNYFVNVVSI
Sbjct: 382 RNLYSLAIDNKAPKIFAKTNRFGIPYNSLGVAVLFCLLAYMSVSSGSAKIFNYFVNVVSI 441

Query: 466 FGLLSWISILITYLCFFRAVKAQNVDRSRFAYRAPFQPYGSYFTLAFCILIAFIKNFTVF 525
            G+L+WISILITY+CF RAV+AQ +D+S FAY AP QPYG+YF+L FC L+A IKNFTVF
Sbjct: 442 TGVLTWISILITYICFDRAVRAQGIDKSTFAYVAPLQPYGAYFSLFFCCLLALIKNFTVF 501

Query: 526 LNHHFDYKNFITGYIGIPVFVISYFGYKFVKKTKIWKPEEVDLYTFKAAIDEEEEQGKIA 585
           LNH FDY+NFITGYIG+P+F I YFGYKFVKKTKI KPEEVDL++FKAAID+EEE G+I 
Sbjct: 502 LNHKFDYRNFITGYIGLPLFFICYFGYKFVKKTKIRKPEEVDLFSFKAAIDQEEEDGRIK 561

Query: 586 DAERRERLKNSKTKGWDWFYEKVLGNIF 613
           DA   ER+K +  K W+WFYE  LG IF
Sbjct: 562 DAATAERIKKN-GKNWEWFYETYLGKIF 588

>SAKL0G14916g Chr7 complement(1277225..1278970) [1746 bp, 581 aa]
           {ON} uniprot|Q875Q9 Saccharomyces kluyveri DIP5
          Length = 581

 Score =  736 bits (1901), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 369/561 (65%), Positives = 438/561 (78%), Gaps = 4/561 (0%)

Query: 54  NDMDNLSTVSSRLEDSEKQDDYMD-DGKDEHTRLRKDLKARHISMIAXXXXXXXXXXXXX 112
            D++NL    S  +D   Q+ +++ DGK +  RL+K+L+ARH+SMIA             
Sbjct: 24  KDVENLDL--SNQDDISSQESHLNIDGKHDGIRLKKELEARHVSMIAIGGSLGTGLLIGT 81

Query: 113 XXXXYTAGPMSMFIAYAFVGVLVFFTMAALGEMASYIPLDGFTSYASRYCDPALGFAVGY 172
                 AGP+S+ IAY+FVG LV+  M  LGEMA+YIPLDGFTSYASRYCDPALGFAVGY
Sbjct: 82  GTSLSLAGPVSILIAYSFVGFLVYIVMTCLGEMATYIPLDGFTSYASRYCDPALGFAVGY 141

Query: 173 AYLCKYLILPPNQLTAAALVIQYWLDREQVNPGVWITIFLVIIVAMNFIGVKFFGEFEFW 232
           +YL KYLI+ PNQLTAAALV+QYW+ RE+VNPGVWITIFLVIIV +N +GVKFFGEFEFW
Sbjct: 142 SYLFKYLIITPNQLTAAALVLQYWVSREKVNPGVWITIFLVIIVTINVVGVKFFGEFEFW 201

Query: 233 LSTFKVIVMIGLIILLFVIMLGGGPTHDRLGFRFYDHPGAFKPYSKSIDGSKGKXXXXXX 292
           LS+FKV+VM+ LI+LLFVIMLGGGP+HDRLGFRFY  PGAF+PYS++I GSKGK      
Sbjct: 202 LSSFKVLVMLCLIVLLFVIMLGGGPSHDRLGFRFYKDPGAFRPYSEAISGSKGKFVSFVA 261

Query: 293 XXXXXXXXXXGIELTGIVAAEAANPRKSIPKAIKLTMYRIIVFYLVTIFLLGMCVAYDDP 352
                     G EL GIVAAE  NPR+++P+AIKLT+YRI+VFYLVTIFLLGM VAY+DP
Sbjct: 262 VFVYALFAYLGTELCGIVAAECKNPRRNVPRAIKLTLYRIVVFYLVTIFLLGMTVAYNDP 321

Query: 353 LLXXXXXXXXXXXXXPYVVAIINSGIKALPHIFNACVLMFVFSACNSDLYVASRTLYGLA 412
           LL             P+VVAI N+GI  LPHIFNACVLMFVFSACNSDLYVASR+LYGLA
Sbjct: 322 LLLQAKKKSTSAAASPFVVAIKNAGIPVLPHIFNACVLMFVFSACNSDLYVASRSLYGLA 381

Query: 413 IDNKAPKIFAVTNRWGVPYYSLLMSSCFCLLAYMSVSSGSAKIFNYFVNVVSIFGLLSWI 472
           IDNKAPKIFA TN+WGVPY SL++   FCLLAYM+VSSGSA++FNYFVNVVSIFGL+SWI
Sbjct: 382 IDNKAPKIFAKTNKWGVPYNSLILCILFCLLAYMNVSSGSAQVFNYFVNVVSIFGLMSWI 441

Query: 473 SILITYLCFFRAVKAQNVDRSRFAYRAPFQPYGSYFTLAFCILIAFIKNFTVFLNHHFDY 532
           +ILITY+ F RA++AQ VD+S  AY AP    G+YF L FC LIA IKNFTVFL H FDY
Sbjct: 442 AILITYIYFDRALRAQGVDKSTLAYAAPLASKGAYFALFFCCLIALIKNFTVFLGHKFDY 501

Query: 533 KNFITGYIGIPVFVISYFGYKFVKKTKIWKPEEVDLYTFKAAIDEEEEQGKIADAERRER 592
           KNFITGYIGIPVF+I +FGYK+++ TK  KPEE DLYTFK  ID EEE+GK+ DA ++E+
Sbjct: 502 KNFITGYIGIPVFIICFFGYKYIRGTKFVKPEEADLYTFKELIDLEEEEGKLWDAAQKEK 561

Query: 593 LKNSKTKGWDWFYEKVLGNIF 613
           +++S  K + WFYEK LG IF
Sbjct: 562 MESSP-KNFKWFYEKFLGWIF 581

>Skud_16.12 Chr16 (20144..21967) [1824 bp, 607 aa] {ON} YPL265W
           (REAL)
          Length = 607

 Score =  729 bits (1883), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 376/561 (67%), Positives = 434/561 (77%), Gaps = 3/561 (0%)

Query: 55  DMDNLSTVSSRLEDSEKQDDY--MDDGKDEHTRLRKDLKARHISMIAXXXXXXXXXXXXX 112
           + +N+S+ SS       +DD   + DGKDE TRLRKDLKARHISMIA             
Sbjct: 48  EENNVSSRSSTFTSPSARDDSFAVPDGKDETTRLRKDLKARHISMIAIGGSLGTGLLIGT 107

Query: 113 XXXXYTAGPMSMFIAYAFVGVLVFFTMAALGEMASYIPLDGFTSYASRYCDPALGFAVGY 172
                T GP++M IAYAFVG+LVFFTMA LGEMASYIPLDGFTSYASRY DPALGFA+GY
Sbjct: 108 GTALMTGGPVAMLIAYAFVGLLVFFTMACLGEMASYIPLDGFTSYASRYVDPALGFAIGY 167

Query: 173 AYLCKYLILPPNQLTAAALVIQYWLDREQVNPGVWITIFLVIIVAMNFIGVKFFGEFEFW 232
            YL KY ILPPNQLTAAALVIQYW+ R++VNPGVWITIF+V+IVA+N IGVKFFGEFEFW
Sbjct: 168 TYLFKYFILPPNQLTAAALVIQYWVSRDRVNPGVWITIFMVVIVAINVIGVKFFGEFEFW 227

Query: 233 LSTFKVIVMIGLIILLFVIMLGGGPTHDRLGFRFYDHPGAFKPYSKSIDGSKGKXXXXXX 292
           LS+FKV+VM+GLI+LLF+IMLGGGP HDRLGFR++  PGAFK YS +I G KGK      
Sbjct: 228 LSSFKVLVMLGLILLLFIIMLGGGPDHDRLGFRYWRDPGAFKEYSAAIGGGKGKFVSFLA 287

Query: 293 XXXXXXXXXXGIELTGIVAAEAANPRKSIPKAIKLTMYRIIVFYLVTIFLLGMCVAYDDP 352
                     GIELTGIV +EA NPRKS+PKAIKLT+YRIIVFYL T+FLLGMCVAY+DP
Sbjct: 288 VFVYSLFSYTGIELTGIVCSEAQNPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDP 347

Query: 353 LLXXXXXXXXXXXXXPYVVAIINSGIKALPHIFNACVLMFVFSACNSDLYVASRTLYGLA 412
            L             P+VVAI NSGIK LPHIFNACVL+FVFSACNSDLYV+SR LY LA
Sbjct: 348 RLISTKGKALSAAASPFVVAIQNSGIKVLPHIFNACVLVFVFSACNSDLYVSSRNLYALA 407

Query: 413 IDNKAPKIFAVTNRWGVPYYSLLMSSCFCLLAYMSVSSGSAKIFNYFVNVVSIFGLLSWI 472
           ID KAPKIF+ TN+WGVPY +L+ S  FC LAYM+VS+GSAKIFNYFVNVVS+FG+LSWI
Sbjct: 408 IDGKAPKIFSKTNKWGVPYNALIFSVLFCCLAYMNVSAGSAKIFNYFVNVVSMFGILSWI 467

Query: 473 SILITYLCFFRAVKAQNVDRSRFAYRAPFQPYGSYFTLAFCILIAFIKNFTVFLNHHFDY 532
           +ILI Y+ F +A +AQ +D+S+FAY AP Q YG+YF L FCI IA IKNFTVFL H FDY
Sbjct: 468 TILIVYIYFDKACRAQGIDKSKFAYVAPGQRYGAYFALVFCIFIALIKNFTVFLGHKFDY 527

Query: 533 KNFITGYIGIPVFVISYFGYKFVKKTKIWKPEEVDLYTFKAAIDEEEEQGKIADAERRER 592
           K FITGYIG+PV+V S+ GYK + KTK+ K  +VDLYTFK   D EEEQGKI D E+ ER
Sbjct: 528 KTFITGYIGLPVYVFSWVGYKLIYKTKVIKSTDVDLYTFKEIYDREEEQGKIEDQEKEER 587

Query: 593 LKNSKTKGWDWFYEKVLGNIF 613
           LK +  K  +WFYEK LG+IF
Sbjct: 588 LKKNG-KNMEWFYEKFLGHIF 607

>Suva_16.40 Chr16 (56664..58484) [1821 bp, 606 aa] {ON} YPL265W
           (REAL)
          Length = 606

 Score =  727 bits (1877), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 370/536 (69%), Positives = 423/536 (78%), Gaps = 1/536 (0%)

Query: 78  DGKDEHTRLRKDLKARHISMIAXXXXXXXXXXXXXXXXXYTAGPMSMFIAYAFVGVLVFF 137
           DGKDE TRLRKDLKARHISMIA                  T GP+SM IAY FVG+LVFF
Sbjct: 72  DGKDETTRLRKDLKARHISMIAIGGSLGTGLLIGTGTALLTGGPVSMLIAYGFVGLLVFF 131

Query: 138 TMAALGEMASYIPLDGFTSYASRYCDPALGFAVGYAYLCKYLILPPNQLTAAALVIQYWL 197
           TMA LGEMASYIPLDGFTSYASRY DPALGFA+GY YL KY ILPPNQLTAAALVIQYW+
Sbjct: 132 TMACLGEMASYIPLDGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWV 191

Query: 198 DREQVNPGVWITIFLVIIVAMNFIGVKFFGEFEFWLSTFKVIVMIGLIILLFVIMLGGGP 257
            R++VNPGVWITIFLV+IVA+N +GV+FFGEFEFWLS+FKV+VM+GLI+LLF+IMLGGGP
Sbjct: 192 SRDRVNPGVWITIFLVVIVAINIVGVRFFGEFEFWLSSFKVMVMLGLILLLFIIMLGGGP 251

Query: 258 THDRLGFRFYDHPGAFKPYSKSIDGSKGKXXXXXXXXXXXXXXXXGIELTGIVAAEAANP 317
            HDRLGFR++  PGAFK YS +I GSKGK                GIELTGIV +EA NP
Sbjct: 252 DHDRLGFRYWRDPGAFKEYSTAITGSKGKFVAFASVFVYSLFSYTGIELTGIVCSEAKNP 311

Query: 318 RKSIPKAIKLTMYRIIVFYLVTIFLLGMCVAYDDPLLXXXXXXXXXXXXXPYVVAIINSG 377
           RKS+PKAIKLT+YRIIVFYL T+FLLGMCVAY+DP L             P+VVAI NSG
Sbjct: 312 RKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKAMSAAASPFVVAIQNSG 371

Query: 378 IKALPHIFNACVLMFVFSACNSDLYVASRTLYGLAIDNKAPKIFAVTNRWGVPYYSLLMS 437
           IK LPHIFN CVL+FVFSACNSDLYV+SR LY LAID KAPKIFA T++WGVPYY+L++S
Sbjct: 372 IKVLPHIFNGCVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYYALMVS 431

Query: 438 SCFCLLAYMSVSSGSAKIFNYFVNVVSIFGLLSWISILITYLCFFRAVKAQNVDRSRFAY 497
             FC LAYM+VS+GSAKIFNYFVNVVS+FG+LSWI+ILI Y+ F RA +AQ VD+S+FAY
Sbjct: 432 VLFCCLAYMNVSAGSAKIFNYFVNVVSMFGILSWITILIVYIYFDRACRAQGVDKSKFAY 491

Query: 498 RAPFQPYGSYFTLAFCILIAFIKNFTVFLNHHFDYKNFITGYIGIPVFVISYFGYKFVKK 557
            AP Q YG+YF L FCILIA IKNFTVFL H FDYK FITGYIG+P++V S+ GYK + K
Sbjct: 492 VAPGQRYGAYFALFFCILIALIKNFTVFLGHTFDYKTFITGYIGLPIYVFSWVGYKLIYK 551

Query: 558 TKIWKPEEVDLYTFKAAIDEEEEQGKIADAERRERLKNSKTKGWDWFYEKVLGNIF 613
           TK+ KP + DLYT K   D EEEQGK+ D E+ ERL+ +  K  +WFYEK LGNIF
Sbjct: 552 TKVVKPADADLYTLKEIYDREEEQGKLQDQEKEERLQRNG-KNLEWFYEKFLGNIF 606

>YPL265W Chr16 (41043..42869) [1827 bp, 608 aa] {ON}
           DIP5Dicarboxylic amino acid permease, mediates
           high-affinity and high-capacity transport of L-glutamate
           and L-aspartate; also a transporter for Gln, Asn, Ser,
           Ala, and Gly
          Length = 608

 Score =  726 bits (1875), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 370/536 (69%), Positives = 426/536 (79%), Gaps = 1/536 (0%)

Query: 78  DGKDEHTRLRKDLKARHISMIAXXXXXXXXXXXXXXXXXYTAGPMSMFIAYAFVGVLVFF 137
           DGKDE+TRLRKDLKARHISMIA                  T GP++M IAYAFVG+LVF+
Sbjct: 74  DGKDENTRLRKDLKARHISMIAIGGSLGTGLLIGTGTALLTGGPVAMLIAYAFVGLLVFY 133

Query: 138 TMAALGEMASYIPLDGFTSYASRYCDPALGFAVGYAYLCKYLILPPNQLTAAALVIQYWL 197
           TMA LGEMASYIPLDGFTSYASRY DPALGFA+GY YL KY ILPPNQLTAAALVIQYW+
Sbjct: 134 TMACLGEMASYIPLDGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWI 193

Query: 198 DREQVNPGVWITIFLVIIVAMNFIGVKFFGEFEFWLSTFKVIVMIGLIILLFVIMLGGGP 257
            R++VNPGVWITIFLV+IVA+N +GVKFFGEFEFWLS+FKV+VM+GLI+LLF+IMLGGGP
Sbjct: 194 SRDRVNPGVWITIFLVVIVAINVVGVKFFGEFEFWLSSFKVMVMLGLILLLFIIMLGGGP 253

Query: 258 THDRLGFRFYDHPGAFKPYSKSIDGSKGKXXXXXXXXXXXXXXXXGIELTGIVAAEAANP 317
            HDRLGFR++  PGAFK YS +I G KGK                GIELTGIV +EA NP
Sbjct: 254 NHDRLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEAENP 313

Query: 318 RKSIPKAIKLTMYRIIVFYLVTIFLLGMCVAYDDPLLXXXXXXXXXXXXXPYVVAIINSG 377
           RKS+PKAIKLT+YRIIVFYL T+FLLGMCVAY+DP L             P+VVAI NSG
Sbjct: 314 RKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSG 373

Query: 378 IKALPHIFNACVLMFVFSACNSDLYVASRTLYGLAIDNKAPKIFAVTNRWGVPYYSLLMS 437
           I+ LPHIFNACVL+FVFSACNSDLYV+SR LY LAID KAPKIFA T+RWGVPY +L++S
Sbjct: 374 IEVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALILS 433

Query: 438 SCFCLLAYMSVSSGSAKIFNYFVNVVSIFGLLSWISILITYLCFFRAVKAQNVDRSRFAY 497
             FC LAYM+VSSGSAKIFNYFVNVVS+FG+LSWI+ILI Y+ F +A +AQ +D+S+FAY
Sbjct: 434 VLFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAY 493

Query: 498 RAPFQPYGSYFTLAFCILIAFIKNFTVFLNHHFDYKNFITGYIGIPVFVISYFGYKFVKK 557
            AP Q YG+YF L FCILIA IKNFTVFL H FDYK FITGYIG+PV++IS+ GYK + K
Sbjct: 494 VAPGQRYGAYFALFFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYIISWAGYKLIYK 553

Query: 558 TKIWKPEEVDLYTFKAAIDEEEEQGKIADAERRERLKNSKTKGWDWFYEKVLGNIF 613
           TK+ K  +VDLYTFK   D EEE+G++ D E+ ERLK S  K  +WFYEK LGNIF
Sbjct: 554 TKVIKSTDVDLYTFKEIYDREEEEGRMKDQEKEERLK-SNGKNMEWFYEKFLGNIF 608

>TBLA0A07060 Chr1 complement(1737650..1739527) [1878 bp, 625 aa]
           {ON} 
          Length = 625

 Score =  727 bits (1876), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 364/533 (68%), Positives = 424/533 (79%), Gaps = 2/533 (0%)

Query: 82  EHTR-LRKDLKARHISMIAXXXXXXXXXXXXXXXXXYTAGPMSMFIAYAFVGVLVFFTMA 140
           +HT  L+K+L+ARH+SMIA                   AGP SMFIAY+FVG+LVFFTMA
Sbjct: 94  KHTDGLKKNLQARHVSMIAIGGSLGTGLLIGTGTSLSAAGPASMFIAYSFVGILVFFTMA 153

Query: 141 ALGEMASYIPLDGFTSYASRYCDPALGFAVGYAYLCKYLILPPNQLTAAALVIQYWLDRE 200
           A+GEMASYIP+DGFTSYASRY DPALGFAVGY YL KYLIL PNQLTAA+LVIQYW+DR+
Sbjct: 154 AIGEMASYIPMDGFTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDRD 213

Query: 201 QVNPGVWITIFLVIIVAMNFIGVKFFGEFEFWLSTFKVIVMIGLIILLFVIMLGGGPTHD 260
            VNPGVWITIFLV+IV +N  GVKFFGEFEFWLS+FKV+VM+GLI+L+F++MLGGGP HD
Sbjct: 214 TVNPGVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKVLVMLGLILLMFILMLGGGPDHD 273

Query: 261 RLGFRFYDHPGAFKPYSKSIDGSKGKXXXXXXXXXXXXXXXXGIELTGIVAAEAANPRKS 320
           RLGFR++ HPGAFKPYS +IDGS GK                GIELTGIVAAEA NPRKS
Sbjct: 274 RLGFRYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPRKS 333

Query: 321 IPKAIKLTMYRIIVFYLVTIFLLGMCVAYDDPLLXXXXXXXXXXXXXPYVVAIINSGIKA 380
           +P+A+KLT++RI++FYLVTIFLLGMCVAY+DP L             P+VVAI NSGI+ 
Sbjct: 334 VPRAVKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLAAKGAGTSAAASPFVVAIQNSGIRV 393

Query: 381 LPHIFNACVLMFVFSACNSDLYVASRTLYGLAIDNKAPKIFAVTNRWGVPYYSLLMSSCF 440
           LPHIFNACVL+FVFSACNSDLYV SR+LY LA+D KAP IF  T  WG+P+YSL +   F
Sbjct: 394 LPHIFNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVLF 453

Query: 441 CLLAYMSVSSGSAKIFNYFVNVVSIFGLLSWISILITYLCFFRAVKAQNVDRSRFAYRAP 500
            LLAYM+VSSGSA++FNYFVNVVSIFGLLSWI I ITY+ F RAVK Q VDRS+FAY AP
Sbjct: 454 ALLAYMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSAP 513

Query: 501 FQPYGSYFTLAFCILIAFIKNFTVFLNHHFDYKNFITGYIGIPVFVISYFGYKFVKKTKI 560
           FQPYG+YF+LA+C+ IAFIKNFTVFL H FDYKNFITGYIG+PVFVI YFGYKF+KKTKI
Sbjct: 514 FQPYGTYFSLAWCVFIAFIKNFTVFLGHSFDYKNFITGYIGLPVFVIFYFGYKFIKKTKI 573

Query: 561 WKPEEVDLYTFKAAIDEEEEQGKIADAERRERLKNSKTKGWDWFYEKVLGNIF 613
            K  EVDL+T K   D++E +GKI D E++ RL+ +K    +W YEK LGNIF
Sbjct: 574 VKSHEVDLFTGKEVFDQQEIEGKILDQEKQIRLRENKFS-LEWIYEKFLGNIF 625

>Smik_6.473 Chr6 complement(778327..780147) [1821 bp, 606 aa] {ON}
           YPL265W (REAL)
          Length = 606

 Score =  723 bits (1865), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 367/536 (68%), Positives = 426/536 (79%), Gaps = 1/536 (0%)

Query: 78  DGKDEHTRLRKDLKARHISMIAXXXXXXXXXXXXXXXXXYTAGPMSMFIAYAFVGVLVFF 137
           DGKDE+TRL+K+LKARHISMIA                  T GP++M IAYAFVG+LVFF
Sbjct: 72  DGKDENTRLKKELKARHISMIAIGGSLGTGLLIGTGTALLTGGPVAMLIAYAFVGLLVFF 131

Query: 138 TMAALGEMASYIPLDGFTSYASRYCDPALGFAVGYAYLCKYLILPPNQLTAAALVIQYWL 197
           TMA LGEMASYIPLDGFTSYASRY DPALGFA+GY YL KY ILPPNQLTAAALVIQYW+
Sbjct: 132 TMACLGEMASYIPLDGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWI 191

Query: 198 DREQVNPGVWITIFLVIIVAMNFIGVKFFGEFEFWLSTFKVIVMIGLIILLFVIMLGGGP 257
            R++VNPGVWITIFLV+IVA+N +GVKFFGEFEFWLS+FKV+VM+GLI+LLF+IMLGGGP
Sbjct: 192 SRDRVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKVMVMLGLILLLFIIMLGGGP 251

Query: 258 THDRLGFRFYDHPGAFKPYSKSIDGSKGKXXXXXXXXXXXXXXXXGIELTGIVAAEAANP 317
            HDRLGFR++  PGAFK YS +I GS GK                GIELTGIV +EA NP
Sbjct: 252 DHDRLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEAENP 311

Query: 318 RKSIPKAIKLTMYRIIVFYLVTIFLLGMCVAYDDPLLXXXXXXXXXXXXXPYVVAIINSG 377
           RKS+PKAIKLT+YRIIVFYL T+FLLGMCVAY+DP L             P+VVAI NSG
Sbjct: 312 RKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSG 371

Query: 378 IKALPHIFNACVLMFVFSACNSDLYVASRTLYGLAIDNKAPKIFAVTNRWGVPYYSLLMS 437
           IK LPHIFNACVL+FVFSACNSDLYV+SR LY LAID KAPKIFA T++WGVPY +L++S
Sbjct: 372 IKVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALILS 431

Query: 438 SCFCLLAYMSVSSGSAKIFNYFVNVVSIFGLLSWISILITYLCFFRAVKAQNVDRSRFAY 497
             FC LAYM+VSSGSAKIFNYFVNVVS+FG+LSWI+ILI Y+ F +A +AQ +D+S+FAY
Sbjct: 432 VLFCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAY 491

Query: 498 RAPFQPYGSYFTLAFCILIAFIKNFTVFLNHHFDYKNFITGYIGIPVFVISYFGYKFVKK 557
            AP Q YG+YF L+FCILIA IKNFTVFL H FDYK FITGYIG+PV+++S+ GYK + K
Sbjct: 492 VAPGQRYGAYFALSFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYILSWAGYKLIYK 551

Query: 558 TKIWKPEEVDLYTFKAAIDEEEEQGKIADAERRERLKNSKTKGWDWFYEKVLGNIF 613
           TK+ K  +VDLYTFK   D EEE+G+I D ER ERL+ +  K  +WFYEK LG IF
Sbjct: 552 TKVIKSTDVDLYTFKEIYDREEEEGRIKDQEREERLQRNG-KNMEWFYEKFLGRIF 606

>KAFR0B06430 Chr2 complement(1333415..1335196) [1782 bp, 593 aa]
           {ON} 
          Length = 593

 Score =  717 bits (1851), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 357/562 (63%), Positives = 420/562 (74%), Gaps = 5/562 (0%)

Query: 55  DMDNLSTVSSRLEDSEKQDDYMDDGKDEHTRLRKDLKARHISMIAXXXXXXXXXXXXXXX 114
           + +++S  SSR   S    D  DDGK E  RL+K+LKARH+SMIA               
Sbjct: 34  EQNSISIASSR-NSSIGDRDIFDDGKTEGFRLKKNLKARHVSMIAIGGSLGTGLLIGTGT 92

Query: 115 XXYTAGPMSMFIAYAFVGVLVFFTMAALGEMASYIPLDGFTSYASRYCDPALGFAVGYAY 174
               AGP S+FI Y+FVGVLVFFTM+ LGEMA++IPLDGFTSYASRY DPALGFAVGY+Y
Sbjct: 93  SLAAAGPGSLFITYSFVGVLVFFTMSCLGEMAAFIPLDGFTSYASRYVDPALGFAVGYSY 152

Query: 175 LCKYLILPPNQLTAAALVIQYWLDREQVNPGVWITIFLVIIVAMNFIGVKFFGEFEFWLS 234
           LCKYLILP NQLTA A+V+QYW+DR+ +NPGV+ITIFL++IV +N  GVK FGEFEFWLS
Sbjct: 153 LCKYLILPANQLTAGAMVVQYWVDRDTLNPGVFITIFLILIVTINIFGVKIFGEFEFWLS 212

Query: 235 TFKVIVMIGLIILLFVIMLGGGPTHDRLGFRFYDHPGAFKPYSKSIDGS---KGKXXXXX 291
           +FKV+VM+GLI+L+F+IMLGGGP HDRLGFR++  PG+FKPYS SI       GK     
Sbjct: 213 SFKVLVMLGLILLMFIIMLGGGPNHDRLGFRYWRDPGSFKPYSSSIISISGSTGKFVSFT 272

Query: 292 XXXXXXXXXXXGIELTGIVAAEAANPRKSIPKAIKLTMYRIIVFYLVTIFLLGMCVAYDD 351
                      GIELTGIVAAEA NPRK+IPKAIKLTMYRII+FY++TI LL MCVAY+D
Sbjct: 273 SCFVYALFCYLGIELTGIVAAEAQNPRKNIPKAIKLTMYRIIIFYVITILLLTMCVAYND 332

Query: 352 PLLXXXXXXXXXXXXXPYVVAIINSGIKALPHIFNACVLMFVFSACNSDLYVASRTLYGL 411
           PLL             P+VVAI NSGI  LPHIFN CVL FV SA NSDLYVASR+LY L
Sbjct: 333 PLLLKATGQSTSAAASPFVVAIENSGINILPHIFNVCVLAFVLSAANSDLYVASRSLYSL 392

Query: 412 AIDNKAPKIFAVTNRWGVPYYSLLMSSCFCLLAYMSVSSGSAKIFNYFVNVVSIFGLLSW 471
           AIDNKAPK F  TN+WG+PY+SL  S+ F  LAYM+VSS ++ +FNYFVN VSIFG++SW
Sbjct: 393 AIDNKAPKFFGKTNKWGIPYWSLAFSTAFSCLAYMNVSSSASNVFNYFVNAVSIFGVISW 452

Query: 472 ISILITYLCFFRAVKAQNVDRSRFAYRAPFQPYGSYFTLAFCILIAFIKNFTVFLNHHFD 531
           I IL+TY+ F +A KAQ +D+S F Y AP+QPYG+YF L FC ++A +KNFTVFL   FD
Sbjct: 453 ICILVTYIHFDKACKAQGMDKSNFTYVAPWQPYGAYFALFFCCVLALVKNFTVFLGGQFD 512

Query: 532 YKNFITGYIGIPVFVISYFGYKFVKKTKIWKPEEVDLYTFKAAIDEEEEQGKIADAERRE 591
           YKNFITGYIGIPVF I + GYK V KTK  +PEEVDL T KA ID+EEE GKI DAER E
Sbjct: 513 YKNFITGYIGIPVFFICFVGYKIVYKTKTHRPEEVDLVTLKALIDQEEEDGKIEDAEREE 572

Query: 592 RLKNSKTKGWDWFYEKVLGNIF 613
           RLKN   K W WFY++ LG IF
Sbjct: 573 RLKNGN-KDWAWFYDRFLGKIF 593

>KLTH0B01166g Chr2 (102227..103960) [1734 bp, 577 aa] {ON} similar
           to uniprot|P53388 Saccharomyces cerevisiae YPL265W DIP5
           Dicarboxylic amino acid permease mediates high-affinity
           and high-capacity transport of L- glutamate and
           L-aspartate also a transporter for Gln Asn Ser Ala and
           Gly
          Length = 577

 Score =  667 bits (1722), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 352/536 (65%), Positives = 418/536 (77%), Gaps = 1/536 (0%)

Query: 78  DGKDEHTRLRKDLKARHISMIAXXXXXXXXXXXXXXXXXYTAGPMSMFIAYAFVGVLVFF 137
           DGK E  RL+K L+ARH+SMIA                  +AGP S+ I+Y+FVG+LV+ 
Sbjct: 43  DGKHEGIRLKKALEARHVSMIAIGGSLGTGLLIGTGSSLASAGPASILISYSFVGLLVYT 102

Query: 138 TMAALGEMASYIPLDGFTSYASRYCDPALGFAVGYAYLCKYLILPPNQLTAAALVIQYWL 197
            MA LGEMA++IPLDGFTSYASRY DPALGFAVGY YL KY I+ PNQLTA A+V+QYW+
Sbjct: 103 VMACLGEMAAFIPLDGFTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWV 162

Query: 198 DREQVNPGVWITIFLVIIVAMNFIGVKFFGEFEFWLSTFKVIVMIGLIILLFVIMLGGGP 257
            RE+VNPGVWITIFLV+IV +N +GV+FFGEFEFWLS+ KV+VM+GLI+LLF+IMLGGGP
Sbjct: 163 SREKVNPGVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKVLVMLGLILLLFIIMLGGGP 222

Query: 258 THDRLGFRFYDHPGAFKPYSKSIDGSKGKXXXXXXXXXXXXXXXXGIELTGIVAAEAANP 317
            HDR GFR++  PGAFKPYS++I GSKGK                G EL GIVAAEA NP
Sbjct: 223 NHDRTGFRYWRDPGAFKPYSEAISGSKGKFVSFASVFALALFAYTGTELCGIVAAEAKNP 282

Query: 318 RKSIPKAIKLTMYRIIVFYLVTIFLLGMCVAYDDPLLXXXXXXXXXXXXXPYVVAIINSG 377
           R+S+P+AIKLT+YRI++FY+++I LLGM VAY+DPLL             P+VVAI N+G
Sbjct: 283 RRSVPRAIKLTLYRIVLFYVISILLLGMTVAYNDPLLIKAKKMSTSAAASPFVVAIKNAG 342

Query: 378 IKALPHIFNACVLMFVFSACNSDLYVASRTLYGLAIDNKAPKIFAVTNRWGVPYYSLLMS 437
           I  LPHIFNACVL+FVFSACNSDLYVASRTLYGLAID KAPKIFA TN WGVPYYSL +S
Sbjct: 343 IPVLPHIFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVS 402

Query: 438 SCFCLLAYMSVSSGSAKIFNYFVNVVSIFGLLSWISILITYLCFFRAVKAQNVDRSRFAY 497
             FCLLAYM+VSSGSA+IFNYFVNVVSIFGLLSWISILITYL F +AV AQ  D+S F+Y
Sbjct: 403 VLFCLLAYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFSY 462

Query: 498 RAPFQPYGSYFTLAFCILIAFIKNFTVFLNHHFDYKNFITGYIGIPVFVISYFGYKFVKK 557
            APFQP+ ++ +L FC LI  IKN+TVFL H FDYK FI+GYIGIPV+ I Y GYK V +
Sbjct: 463 TAPFQPWSTWVSLFFCCLIGLIKNYTVFLGHTFDYKTFISGYIGIPVYAICYVGYKLVHR 522

Query: 558 TKIWKPEEVDLYTFKAAIDEEEEQGKIADAERRERLKNSKTKGWDWFYEKVLGNIF 613
           +K+ KPE+VDLYTFKAAID EEE+GK+ + ER+E+LK+S  K   WFY+  LG IF
Sbjct: 523 SKLIKPEDVDLYTFKAAIDAEEEEGKLLELERKEQLKSSP-KNLTWFYDTFLGWIF 577

>Kwal_33.15545 s33 complement(1149997..1151727) [1731 bp, 576 aa]
           {ON} YPL265W (DIP5) - dicarboxylic amino acid permease
           [contig 290] FULL
          Length = 576

 Score =  653 bits (1685), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 338/536 (63%), Positives = 413/536 (77%), Gaps = 1/536 (0%)

Query: 78  DGKDEHTRLRKDLKARHISMIAXXXXXXXXXXXXXXXXXYTAGPMSMFIAYAFVGVLVFF 137
           DGK E  RL+K+L+ARH+SMIA                  +AGP+S+ I+Y+FVG+LV+ 
Sbjct: 42  DGKHEGIRLKKELEARHVSMIAIGGSLGTGLLIGTGSSLASAGPVSILISYSFVGLLVYT 101

Query: 138 TMAALGEMASYIPLDGFTSYASRYCDPALGFAVGYAYLCKYLILPPNQLTAAALVIQYWL 197
            M+ LGEMA++IPLDGFTSYASRY DPA+GFAVGY+YL KY I+ PNQLTA A+V+Q+W+
Sbjct: 102 VMSCLGEMAAFIPLDGFTSYASRYVDPAVGFAVGYSYLFKYFIVTPNQLTAGAMVMQFWV 161

Query: 198 DREQVNPGVWITIFLVIIVAMNFIGVKFFGEFEFWLSTFKVIVMIGLIILLFVIMLGGGP 257
            R++VNPGVWITIFL +IV +N +GV+FFGEFEFWLS+ KV+VM+GLI+LLF+IMLGGGP
Sbjct: 162 SRDRVNPGVWITIFLALIVLINTVGVRFFGEFEFWLSSVKVLVMLGLILLLFIIMLGGGP 221

Query: 258 THDRLGFRFYDHPGAFKPYSKSIDGSKGKXXXXXXXXXXXXXXXXGIELTGIVAAEAANP 317
            HDR GFRF+  PGAFKPYS++I GSKGK                G EL GIVAAEA NP
Sbjct: 222 NHDRTGFRFWRDPGAFKPYSEAISGSKGKFVSFASVFALALFAYTGTELCGIVAAEAKNP 281

Query: 318 RKSIPKAIKLTMYRIIVFYLVTIFLLGMCVAYDDPLLXXXXXXXXXXXXXPYVVAIINSG 377
           R+S+P+AIKLT+YRI+VFY++TI LLGM VAY+DP L             P+VVAI N+ 
Sbjct: 282 RRSVPRAIKLTLYRIVVFYVITILLLGMTVAYNDPRLLKAKKMATSAAASPFVVAIENAS 341

Query: 378 IKALPHIFNACVLMFVFSACNSDLYVASRTLYGLAIDNKAPKIFAVTNRWGVPYYSLLMS 437
           I  LPHIFN CVL+FVFSACNSDLYVASR+LYGLAID KAP+IFA TN+WGVPYYSL +S
Sbjct: 342 IPVLPHIFNVCVLVFVFSACNSDLYVASRSLYGLAIDGKAPRIFATTNKWGVPYYSLGLS 401

Query: 438 SCFCLLAYMSVSSGSAKIFNYFVNVVSIFGLLSWISILITYLCFFRAVKAQNVDRSRFAY 497
             FCLLAYM+VSSGSA++FNYFVNVVSIFGLLSWI+ILITY+ F +A++ Q  D+S  +Y
Sbjct: 402 VLFCLLAYMNVSSGSAQVFNYFVNVVSIFGLLSWITILITYIRFDKAIRVQFGDKSSLSY 461

Query: 498 RAPFQPYGSYFTLAFCILIAFIKNFTVFLNHHFDYKNFITGYIGIPVFVISYFGYKFVKK 557
            A FQP+ +Y  L FC LI  IKN+TVFL H FDYK FI+GYIGIPV++I Y GYK V +
Sbjct: 462 TAAFQPWSTYVALFFCCLIGLIKNYTVFLGHKFDYKTFISGYIGIPVYLICYVGYKVVYR 521

Query: 558 TKIWKPEEVDLYTFKAAIDEEEEQGKIADAERRERLKNSKTKGWDWFYEKVLGNIF 613
           TK+ KPE+VDLYTFK AID EEE+ K+ + ER E ++NS  K + WFYE  LG IF
Sbjct: 522 TKLIKPEDVDLYTFKDAIDAEEEEYKLLEKERLENMENSP-KNFKWFYETFLGWIF 576

>KNAG0L02470 Chr12 (440549..442465) [1917 bp, 638 aa] {ON} 
          Length = 638

 Score =  650 bits (1676), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 336/552 (60%), Positives = 402/552 (72%), Gaps = 4/552 (0%)

Query: 47  KKDGLDINDMDNLSTVSSRLEDSEKQDDYMDDGKDEHTRLRKDLKARHISMIAXXXXXXX 106
            K  L+I    + S+ S     S+     + DGK E  RL+K LK+RHISMIA       
Sbjct: 26  SKLALNIEVQSDQSSKSLCDSASDVLASEIGDGKYEGIRLKKQLKSRHISMIAIGGSLGT 85

Query: 107 XXXXXXXXXXYTAGPMSMFIAYAFVGVLVFFTMAALGEMASYIPLDGFTSYASRYCDPAL 166
                       AGP+S  IAY FVG++VFFTMA LGEMA++IPLDGFTSYASRYCDPAL
Sbjct: 86  GLLIATGESLKVAGPVSTLIAYTFVGIMVFFTMACLGEMATFIPLDGFTSYASRYCDPAL 145

Query: 167 GFAVGYAYLCKYLILPPNQLTAAALVIQYWLDREQVNPGVWITIFLVIIVAMNFIGVKFF 226
           GFAVGYAYL KY ILPPNQLTAAA+V+QYW+ R+ VNPG+W+T+   +I  +N  GV+FF
Sbjct: 146 GFAVGYAYLIKYFILPPNQLTAAAMVMQYWVPRDTVNPGIWVTLVFAVITVINIFGVRFF 205

Query: 227 GEFEFWLSTFKVIVMIGLIILLFVIMLGGGPTHDRLGFRFYDHPGAFKPYSKSIDGSKGK 286
           GEFEFWLS+ KV++MIGLIILLFVIMLGG  +HDRLGFR++ HPGAF  YS  I GS GK
Sbjct: 206 GEFEFWLSSLKVLIMIGLIILLFVIMLGGAGSHDRLGFRYWKHPGAFNDYSDDISGSLGK 265

Query: 287 XXXXXXXXXXXXXXXXGIELTGIVAAEAANPRKSIPKAIKLTMYRIIVFYLVTIFLLGMC 346
                           GIELTGIVAAEA+NPR+S+PKAIKLT YRI+VFY+V+IFLLGMC
Sbjct: 266 FVSFVAVLVLGVFAYLGIELTGIVAAEASNPRRSVPKAIKLTFYRILVFYVVSIFLLGMC 325

Query: 347 VAYDDPLLXXXXXXXXXXXXXPYVVAIINSGIKALPHIFNACVLMFVFSACNSDLYVASR 406
           V Y+D  L             P+ +AI+N+GI  LP IFN C+L+FVFSA NSDLYVASR
Sbjct: 326 VPYNDEKL--VTTNENSLTASPFSIAILNAGITVLPDIFNGCLLIFVFSAANSDLYVASR 383

Query: 407 TLYGLAIDNKAPKIFAVTNRWGVPYYSLLMSSCFCLLAYMSVSSGSAKIFNYFVNVVSIF 466
            LY LA+DNKAPKIFA TNRWG+PY SL +S  FCLLAYM+VSS SA++F YFVNVVSI 
Sbjct: 384 NLYSLAVDNKAPKIFAHTNRWGIPYNSLFVSCLFCLLAYMTVSSSSAQVFKYFVNVVSIA 443

Query: 467 GLLSWISILITYLCFFRAVKAQNVDRSRFAYRAPFQPYGSYFTLAFCILIAFIKNFTVFL 526
           GLL+WISILITY+CF RAV+AQ+VD+S FAY APFQPYG+Y +L FC LIA IKNFTVFL
Sbjct: 444 GLLTWISILITYICFDRAVRAQHVDKSTFAYVAPFQPYGAYVSLFFCCLIAIIKNFTVFL 503

Query: 527 NHHFDYKNFITGYIGIPVFVISYFGYKFVKKTKIWKPEEVDLYTFKAAIDEEE-EQGKIA 585
             HFDYK FITGYIG+P+FV+ YFGYK   K++I     VDL + K+ +D E+ E   I 
Sbjct: 504 G-HFDYKTFITGYIGLPIFVLCYFGYKITCKSEIRSARYVDLVSQKSLVDREQVEYELIE 562

Query: 586 DAERRERLKNSK 597
             +R E + N+K
Sbjct: 563 QLKREEMIANTK 574

>KLLA0E16281g Chr5 (1455271..1457088) [1818 bp, 605 aa] {ON} similar
           to uniprot|P53388 Saccharomyces cerevisiae YPL265W DIP5
           Dicarboxylic amino acid permease mediates high-affinity
           and high-capacity transport of L-glutamate and
           L-aspartate also a transporter for Gln Asn Ser Ala and
           Gly
          Length = 605

 Score =  647 bits (1669), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 324/533 (60%), Positives = 397/533 (74%), Gaps = 1/533 (0%)

Query: 78  DGKDEHTRLRKDLKARHISMIAXXXXXXXXXXXXXXXXXYTAGPMSMFIAYAFVGVLVFF 137
           DGK +  RL+K L+ARH+SMIA                   AGP ++ IAYAFVG+LVFF
Sbjct: 71  DGKHDGIRLKKALEARHVSMIAIGGSLGTGLLIGTGSSLALAGPAAILIAYAFVGLLVFF 130

Query: 138 TMAALGEMASYIPLDGFTSYASRYCDPALGFAVGYAYLCKYLILPPNQLTAAALVIQYWL 197
            M+ LGEMA+YIPLDGFTSY++RY DPALGFAVGYAYL KY I+ PNQLTA ALVIQYW+
Sbjct: 131 VMSCLGEMAAYIPLDGFTSYSTRYADPALGFAVGYAYLFKYWIIVPNQLTAGALVIQYWV 190

Query: 198 DREQVNPGVWITIFLVIIVAMNFIGVKFFGEFEFWLSTFKVIVMIGLIILLFVIMLGGGP 257
           DR++VNPGVWITI LV I+ +NF+GV+FFGE E+++S  K+ VM+GLIILL V+  GGGP
Sbjct: 191 DRDKVNPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMLGLIILLLVLACGGGP 250

Query: 258 THDRLGFRFYDHPGAFKPYSKSIDGSKGKXXXXXXXXXXXXXXXXGIELTGIVAAEAANP 317
            H+ LGF+++ +PGAFK YS +I G+KG+                G EL GIV +E  NP
Sbjct: 251 NHEVLGFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAYLGTELCGIVVSECKNP 310

Query: 318 RKSIPKAIKLTMYRIIVFYLVTIFLLGMCVAYDDPLLXXXXXXXXXXXXXPYVVAIINSG 377
           RK++PKAIKLTMYRIIVFYL++IFLLGMCV ++DPLL             P+VVAI+N+G
Sbjct: 311 RKAVPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLISAKSAKTSASASPFVVAIVNAG 370

Query: 378 IKALPHIFNACVLMFVFSACNSDLYVASRTLYGLAIDNKAPKIFAVTNRWGVPYYSLLMS 437
           I  LPHI NAC+L+FVFSA NSDLYVASR+LYGLAIDNKAP+IFA TN+ GVPY+SLL+ 
Sbjct: 371 IPVLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQGVPYWSLLVG 430

Query: 438 SCFCLLAYMSVSSGSAKIFNYFVNVVSIFGLLSWISILITYLCFFRAVKAQNVDRSRFAY 497
             F LLAYM+VSSGS+++F YFVN VSIFGLLSWISILITY+ F +A + Q +D+S  AY
Sbjct: 431 VLFALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRVQGIDKSTLAY 490

Query: 498 RAPFQPYGSYFTLAFCILIAFIKNFTVFLNHHFDYKNFITGYIGIPVFVISYFGYKFVKK 557
           ++P QPYG++F+L FCILI  IKNF  FL   FDYK+FITGYIGIP ++ISY GYK   K
Sbjct: 491 QSPLQPYGAWFSLFFCILIGLIKNFPAFLGDTFDYKSFITGYIGIPTYIISYIGYKLWYK 550

Query: 558 TKIWKPEEVDLYTFKAAIDEEEEQGKIADAERRERLKNSKTKGWDWFYEKVLG 610
           TKI   EEVDL +FK A+D EEE+GK+ D ER   L  +  K   W YEK+ G
Sbjct: 551 TKIIPSEEVDLVSFKEAVDLEEEEGKMLDEERAAHLA-AHGKDLKWCYEKIFG 602

>Ecym_2480 Chr2 complement(940315..942075) [1761 bp, 586 aa] {ON}
           similar to Ashbya gossypii ACL135W
          Length = 586

 Score =  635 bits (1638), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 320/544 (58%), Positives = 395/544 (72%), Gaps = 7/544 (1%)

Query: 74  DYMDDGKDEHTRLRKDLKARHISMIAXXXXXXXXXXXXXXXXXYTAGPMSMFIAYAFVGV 133
           D+  DGK +  RL+KDL+ARH+SMIA                   AGP+++ IAY+ +G 
Sbjct: 46  DWGYDGKHKGIRLKKDLQARHVSMIAIGGSLGTGLLIGTGSALSQAGPIAILIAYSIMGW 105

Query: 134 LVFFTMAALGEMASYIPLDGFTSYASRYCDPALGFAVGYAYLCKYLILPPNQLTAAALVI 193
           +VF  M+ LGEMA+YIPLDGFTSYA+RY DPALGFAVGY YL KYL+L PNQLTAAALV+
Sbjct: 106 VVFTVMSCLGEMAAYIPLDGFTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVM 165

Query: 194 QYWLDREQVNPGVWITIFLVIIVAMNFIGVKFFGEFEFWLSTFKVIVMIGLIILLFVIML 253
           QYW+ R +VNPGVWIT+FL +I+ +N +GVKFFGEFEFWLS+FKV+VM+ ++ LL V++L
Sbjct: 166 QYWVGRGKVNPGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKVLVMLCVMTLLLVLVL 225

Query: 254 GGGPTHDRLGFRFYDHPGAFKPYSK--SIDGSKGKXXXXXXXXXXXXXXXXGIELTGIVA 311
           GGGP+H+RLGFR++  PG FKPYS   SI G KGK                G EL GIVA
Sbjct: 226 GGGPSHNRLGFRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVA 285

Query: 312 AEAANPRKSIPKAIKLTMYRIIVFYLVTIFLLGMCVAYDDPLLXXXXXXXXXXXXXPYVV 371
           AE  NPR+++P+AIKLT+YRI+VFYL T+FLLG+ VAY+DPLL             PYVV
Sbjct: 286 AECKNPRRNVPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQTKKAKTSAAASPYVV 345

Query: 372 AIINSGIKALPHIFNACVLMFVFSACNSDLYVASRTLYGLAIDNKAPKIFAVTNRWGVPY 431
           AI N+GI  LPHIFNACVL FVFSACNSDLYV SR+LYGLAID KAPKIFA TN WGVPY
Sbjct: 346 AIKNAGIPVLPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPY 405

Query: 432 YSLLMSSCFCLLAYMSVSSGSAKIFNYFVNVVSIFGLLSWISILITYLCFFRAVKAQNVD 491
            SL + + FC LAYM+VSS +  +F+YFVNV SIFGLLSWISILITY+ F RA + Q +D
Sbjct: 406 NSLALCTLFCCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGID 465

Query: 492 RSRFAYRAPFQPYGSYFTLAFCILIAFIKNFTVFLNHHFDYKNFITGYIGIPVFVISYFG 551
           ++  +Y+APFQP  ++  L FC+++A +KNFTVFL   FDYK FITGYIGIPV+++ +  
Sbjct: 466 KNTLSYQAPFQPVTAWIALGFCLMVALVKNFTVFLGDTFDYKTFITGYIGIPVYILCFVC 525

Query: 552 YKFVKKTKIWKPEEVDLYTFKAAIDEEEEQGKIADAERRERLKNSKTKGWDW--FYEKVL 609
           YK V KTK  K   VDL+T+K AID EEE+GK+     +E     K  GW W  FY+ + 
Sbjct: 526 YKIVHKTKWIKSANVDLFTYKTAIDLEEEEGKLEMMRLKEE---RKQHGWTWKQFYDYIF 582

Query: 610 GNIF 613
           G IF
Sbjct: 583 GWIF 586

>ACL135W Chr3 (115359..117125) [1767 bp, 588 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YPL265W (DIP5)
          Length = 588

 Score =  606 bits (1562), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 315/550 (57%), Positives = 383/550 (69%), Gaps = 5/550 (0%)

Query: 68  DSEKQD-DYMDDGKDEHTRLRKDLKARHISMIAXXXXXXXXXXXXXXXXXYTAGPMSMFI 126
           D E Q  D+  DGK E  RL+KDL+ARH+SMIA                   AGP S+ I
Sbjct: 40  DQEAQSVDWNYDGKHEGIRLKKDLQARHVSMIAIGGSLGTGLLIGTGSSLMRAGPGSILI 99

Query: 127 AYAFVGVLVFFTMAALGEMASYIPLDGFTSYASRYCDPALGFAVGYAYLCKYLILPPNQL 186
           AY+ +G +VF  M+ LGEMA+YIPLDGFTSYA+RY DPALGFAVG+AYL KYL+L PNQL
Sbjct: 100 AYSIMGWVVFTVMSCLGEMAAYIPLDGFTSYATRYADPALGFAVGWAYLFKYLVLTPNQL 159

Query: 187 TAAALVIQYWLDREQVNPGVWITIFLVIIVAMNFIGVKFFGEFEFWLSTFKVIVMIGLII 246
           TA ALVIQ+W+   +V+PGVWIT+ L +IV +N +GV+FFGEFEFWLS+FKV+VM+ ++I
Sbjct: 160 TAGALVIQFWIPAARVSPGVWITVVLAVIVVINTVGVRFFGEFEFWLSSFKVLVMLCVMI 219

Query: 247 LLFVIMLGGGPTHDRLGFRFYDHPGAFKPYSKS---IDGSKGKXXXXXXXXXXXXXXXXG 303
           LL V+ LGGGPTHDRLGFR++  PGAFK YSK    I G  GK                G
Sbjct: 220 LLLVLALGGGPTHDRLGFRYWSDPGAFKEYSKKDTHIKGGLGKFVAFLSVFVYALFAYLG 279

Query: 304 IELTGIVAAEAANPRKSIPKAIKLTMYRIIVFYLVTIFLLGMCVAYDDPLLXXXXXXXXX 363
            EL GIVAAE  +PR+++P+AIKLT+YRI+VFYLVTIFLLGMCVAY+DPLL         
Sbjct: 280 TELCGIVAAECKDPRRNVPRAIKLTLYRIVVFYLVTIFLLGMCVAYNDPLLMQASSAEVS 339

Query: 364 XXXXPYVVAIINSGIKALPHIFNACVLMFVFSACNSDLYVASRTLYGLAIDNKAPKIFAV 423
               PYVVAI N+ I  LP++FNACVL FVFSACNSDLYV SR+LYGLAID KAPK+FA 
Sbjct: 340 AAASPYVVAIENAVIPVLPNLFNACVLTFVFSACNSDLYVGSRSLYGLAIDGKAPKLFAR 399

Query: 424 TNRWGVPYYSLLMSSCFCLLAYMSVSSGSAKIFNYFVNVVSIFGLLSWISILITYLCFFR 483
           TN+WGVPY +L   + FC LAYMSVS  +   F YFVNV SIFGL+SW+SILITY+CF R
Sbjct: 400 TNKWGVPYNALACCTLFCCLAYMSVSKSARTAFGYFVNVTSIFGLMSWVSILITYICFDR 459

Query: 484 AVKAQNVDRSRFAYRAPFQPYGSYFTLAFCILIAFIKNFTVFLNHHFDYKNFITGYIGIP 543
           A +AQ + +S  +Y AP QPY  +  L FCI +A IKNF  F+    D   FITGYIG+P
Sbjct: 460 AFRAQGIPKSTLSYVAPCQPYAGWVALIFCIFVALIKNFDAFIGKEVDVPTFITGYIGLP 519

Query: 544 VFVISYFGYKFVKKTKIWKPEEVDLYTFKAAIDEEEEQGKIADAERRERLKNSKTKGWDW 603
           +++  + GYK V KTK    +EVDL+TFK AID EEE+     A  +E+L       W  
Sbjct: 520 IYIFCFIGYKIVHKTKWIPSKEVDLFTFKEAIDLEEEECIRERALMKEQLAKGGLS-WKK 578

Query: 604 FYEKVLGNIF 613
            Y+ VLG IF
Sbjct: 579 IYDNVLGWIF 588

>ZYRO0D17908g Chr4 (1486514..1488070) [1557 bp, 518 aa] {ON} similar
           to uniprot|P53388 Saccharomyces cerevisiae YPL265W DIP5
           Dicarboxylic amino acid permease, mediates high-affinity
           and high-capacity transport of L-glutamate and
           L-aspartate; also a transporter for Gln, Asn, Ser, Ala,
           and Gly
          Length = 518

 Score =  343 bits (879), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 195/527 (37%), Positives = 288/527 (54%), Gaps = 12/527 (2%)

Query: 56  MDNLSTVSSRLEDSEKQDDYMDDGKDEHTRLRKDLKARHISMIAXXXXXXXXXXXXXXXX 115
           ++   TV      S + +   ++  +++  L ++LK R +S++                 
Sbjct: 2   LEKKGTVVLERPASGEDECESEEIDEKNGNLSRELKPRVVSLLTLGSAVGTGLIIGSGSA 61

Query: 116 XYTAGPMSMFIAYAFVGVLVFFTMAALGEMASYIPLD-GFTSYASRYCDPALGFAVGYAY 174
               GP+S+FIAY F G L+   + +L EMAS+ P+D GF+ Y +RY DPA GFA G+ Y
Sbjct: 62  LAKGGPISLFIAYLFTGSLLCVVIFSLSEMASFAPMDKGFSGYLNRYVDPAFGFAAGWNY 121

Query: 175 LCKYLILPPNQLTAAALVIQYWLDREQVNPGVWITIFLVIIVAMNFIGVKFFGEFEFWLS 234
             KY I+    LTA  LVI YW  R  VN GVW+T+  V +  +NF+ VK+FGE E  L+
Sbjct: 122 FLKYAIVLSANLTAFGLVIGYW--RPDVNVGVWVTVLYVTVFCVNFLAVKYFGEIEALLT 179

Query: 235 TFKVIVMIGLIILLFVIMLGGGPTHDRLGFRFYDHPGAFKPYSKSIDGSKGKXXXXXXXX 294
            FK++V++ + I   +I  GG P H   GFR++   GA  PY   + G  GK        
Sbjct: 180 VFKLLVLVIVYITCLIITCGGAPNHTTTGFRYWRESGAL-PYL--VGGGTGKFLGWWACV 236

Query: 295 XXXXXXXXGIELTGIVAAEAANPRKSIPKAIKLTMYRIIVFYLVTIFLLGMCVAYDDPLL 354
                   G E+ GIV  E ANP+K+IPK+     +RI   Y+  +F+LG+ ++  +  L
Sbjct: 237 VQSIFGFMGSEMIGIVYGETANPKKTIPKSSMNVFFRIGFLYVFGVFILGLAISPVNSKL 296

Query: 355 XXXXXXXXXXXXXPYVVAIINSGIKALPHIFNACVLMFVFSACNSDLYVASRTLYGLAID 414
                        P+V+AI +SGIK LP+  NA +L+F+ S+ N+D+Y+ SR LYGLA D
Sbjct: 297 VHAHSTDANAS--PFVIAISSSGIKVLPNFVNAALLVFIISSANTDIYICSRQLYGLAKD 354

Query: 415 NKAPKIFAVTNRWGVPYYSLLMSSCFCLLAYMSVSSGSAKIFNYFVNVVSIFGLLSWISI 474
             APKIF + NR+ VP    +  S    LAYM+    +A +F+Y  + VS+FG+L+W  I
Sbjct: 355 GAAPKIFLLVNRFKVPVVGCVTGSLLGFLAYMNTKKSAATVFSYITSTVSVFGILNWFYI 414

Query: 475 LITYLCFFRAVKAQNVDRSRFAYRAPFQPYGSYFTLAFCILIAFIKNFTVFLNHHFDYKN 534
           LI Y+ + RA+KA+ +      +R  FQPY +Y TL F  +I F   +  F+   F YK 
Sbjct: 415 LIAYINYDRAIKAKGISIDDIPFRMWFQPYAAYVTLFFVTIITFFNGYNAFI-IKFHYKT 473

Query: 535 FITGYIGIPVFVISYFGYKFVKKTKIWKPEEVDLYTFKAAIDEEEEQ 581
           FIT YIG+   ++   GYK   KTK  KP E+   +F+   + E E+
Sbjct: 474 FITSYIGVFANILMVIGYKLYFKTKFVKPSEI---SFRTRNEHEGEE 517

>CAGL0E05632g Chr5 complement(556856..558652) [1797 bp, 598 aa] {ON}
           similar to uniprot|P15380 Saccharomyces cerevisiae
           YOR348c PUT4 proline and gamma-aminobutyrate permease
          Length = 598

 Score =  343 bits (880), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 196/557 (35%), Positives = 306/557 (54%), Gaps = 27/557 (4%)

Query: 46  DKKDGLDINDMDNLSTVSSRLEDSEKQDDYMDDGKDEHTRLRKDLKARHISMIAXXXXXX 105
           D+K G    D+D  S  SS    +EK   +  D       L++ LK+RH+ +IA      
Sbjct: 41  DEKFGKMPGDVDVFSLSSS----TEKHSPHYTDMTGH--ELKQGLKSRHVQLIALGGAIG 94

Query: 106 XXXXXXXXXXXYTAGPMSMFIAYAFVGVLVFFTMAALGEMASYIP-----LDGFTSY-AS 159
                      +T GP  +FI+Y  +  +++  M  +GEM  Y+P      +GF +Y   
Sbjct: 95  TGLFVGTSSTLHTCGPAGLFISYCIISSVIYPIMQGIGEMVCYLPGSGSKPEGFAAYLVG 154

Query: 160 RYCDPALGFAVGYAYLCKYLILPPNQLTAAALVIQYWLDREQVNPGVWITIFLVIIVAMN 219
           +Y D +LGFA  + Y   Y+IL   + TAA+ V++YW     V    WITIFL  +V +N
Sbjct: 155 KYVDESLGFADAWNYYYCYVILVAAECTAASGVVEYW--TTSVPKAAWITIFLAAVVILN 212

Query: 220 FIGVKFFGEFEFWLSTFKVIVMIGLIILLFVIMLGGGPTHDRLGFRFYDHPGAFKPYSKS 279
           F  VKF+GE EFW ++ K++ ++GLIIL F++  GGGP HDRLGFR++ +PG F  + + 
Sbjct: 213 FTAVKFYGESEFWFASIKILCIVGLIILSFILFWGGGPNHDRLGFRYWQNPGGFAHHIRG 272

Query: 280 IDGSKGKXXXXXXXXXXXXXX-XXGIELTGIVAAEAANPRKSIPKAIKLTMYRIIVFYLV 338
             GS G                  G E+  + ++E  + R++I KA +  ++R++ FY++
Sbjct: 273 --GSFGSFLDIYTGIIKGGFAFILGPEMIAMTSSEVEDQRRNIAKAARRFVWRLMFFYIL 330

Query: 339 TIFLLGMCVAYDDPLLXXXXXXXX-XXXXXPYVVAIINSGIKALPHIFNACVLMFVFSAC 397
               + + VAY+DP L              P+V+ I N+GIK LPHI NAC+L   +SA 
Sbjct: 331 GALSISVIVAYNDPALENALAQNKPGAGSSPFVIGIQNAGIKVLPHIINACILSSAWSAG 390

Query: 398 NSDLYVASRTLYGLAIDNKAPKIFAVTNRWGVPYYSLLMSSCFCLLAYMSVSSGSAKIFN 457
           N+ ++ +SR+L  +A + +AP+IFA  NRWGVPYY++ +SS    LAY++ SS +A +FN
Sbjct: 391 NAFMFTSSRSLLTMAQNGQAPRIFAKVNRWGVPYYAVGLSSAISCLAYLNCSSSTADVFN 450

Query: 458 YFVNVVSIFGLLSWISILITYLCFFRAVKAQNVDRSRFAYRAPFQPYGSYFTLAFCILIA 517
           +F N+  I G + WI + I Y+ F +A+    + +SR  Y A   PY  Y+ L    +I 
Sbjct: 451 WFSNISVISGFIGWICVCIAYIRFHKAILFHGM-QSRLPYTARGMPYLIYWPLLVISIIT 509

Query: 518 FIKNFTVFLNHHFDYKNFITGYIGIPVFVISYFGYKFVKKT----KIWKP-EEVDLYTFK 572
               + VF+   +D KNF+  YI +PVF + + G++  ++     K WK  EE+D+ T  
Sbjct: 510 LTNGYEVFIPRFWDAKNFVAAYITLPVFWVLWIGHRVYRRKIFTLKWWKSIEEIDVVT-- 567

Query: 573 AAIDEEEEQGKIADAER 589
             ++E EE+ +  DA R
Sbjct: 568 -GVEEIEEKTRECDASR 583

>SAKL0B10956g Chr2 complement(949900..951618) [1719 bp, 572 aa] {ON}
           similar to uniprot|P15380 Saccharomyces cerevisiae
           YOR348C PUT4 proline-specific permease (also capable of
           transporting alanine and glycine) putative proline-
           specific permease
          Length = 572

 Score =  342 bits (876), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 197/555 (35%), Positives = 311/555 (56%), Gaps = 25/555 (4%)

Query: 46  DKKDGLDINDMDNLSTVSSRLEDSEKQDDYMDDGKDEHTRLRKDLKARHISMIAXXXXXX 105
           DK+ G  + ++D    + S  + S  +    D  + +HT L+K LK+RHI +IA      
Sbjct: 17  DKQTG-QVYEID----IESYSQISGPKVSSSDAPQGDHT-LKKGLKSRHIQLIALGGCIG 70

Query: 106 XXXXXXXXXXXYTAGPMSMFIAYAFVGVLVFFTMAALGEMASYIPLDGFT------SYAS 159
                      +  GP  +F +Y  + V+++  M ALGEM  Y+P DG +         +
Sbjct: 71  TGLFVGTSSTLHACGPAGLFTSYCIISVIIYPVMNALGEMVCYLPGDGSSSGGSISKLVT 130

Query: 160 RYCDPALGFAVGYAYLCKYLILPPNQLTAAALVIQYWLDREQVNPGVWITIFLVIIVAMN 219
           RY DP+LGFA G+ Y   Y+IL   + TAA+ V+QYW     V  G WITIFL ++V +N
Sbjct: 131 RYVDPSLGFATGWNYYYCYVILVAAECTAASGVVQYW--TTAVPKGAWITIFLGVVVLLN 188

Query: 220 FIGVKFFGEFEFWLSTFKVIVMIGLIILLFVIMLGGGPTHDRLGFRFYDHPGAFKPYSKS 279
           F  VKF+GE EFW ++ K++ ++GL+ + F++  GGGP HDRLGFR++  PGAF  +  S
Sbjct: 189 FCAVKFYGESEFWFASMKILCILGLLFVSFILFWGGGPHHDRLGFRYWQKPGAFAYHITS 248

Query: 280 IDGSKGKXX-XXXXXXXXXXXXXXGIELTGIVAAEAANPRKSIPKAIKLTMYRIIVFYLV 338
             G+ G+                 G EL  + +AEA + R++I KA +  +YR+I FY+ 
Sbjct: 249 --GNTGRFLDIWTGVIKGGFAFILGPELVALTSAEAQDARRNIQKASRRFVYRLIFFYVS 306

Query: 339 TIFLLGMCVAYDDPLLXXXX-XXXXXXXXXPYVVAIINSGIKALPHIFNACVLMFVFSAC 397
           +   +G  VAY+D  L              P+V+ I N+GIK LPHI N C+L   +S+ 
Sbjct: 307 SSLAIGCIVAYNDKTLSTALDQGKPGAGSSPFVIGIQNAGIKVLPHIINVCILSSAWSSG 366

Query: 398 NSDLYVASRTLYGLAIDNKAPKIFAVTNRWGVPYYSLLMSSCFCLLAYMSVSSGSAKIFN 457
           NS ++ ASR+L  ++ +  APKI    NR+GVPY ++ ++S    +AY++VSS +A +F 
Sbjct: 367 NSFMFAASRSLLSMSQEGFAPKILGRVNRFGVPYAAVALTSLLSCIAYLNVSSSTADVFT 426

Query: 458 YFVNVVSIFGLLSWISILITYLCFFRAVKAQNVDRSRFAYRAPFQPYGSYFTLAFCILIA 517
           +F N+ +I G + WI I I YL F +A+  QN+   R  ++ PFQPYG++F +    +I 
Sbjct: 427 WFSNISTISGFIGWICIGIAYLRFRKAIFFQNL-YERVPFKTPFQPYGTWFFIIAVSVIC 485

Query: 518 FIKNFTVFLNHHFDYKNFITGYIGIPVFVISYFGYKFVKKT-KIWK--PEEVDLYTFKAA 574
               + +F+  +++  +FI  Y+ +P+F++ + G+K   +T K W     E+D+ T    
Sbjct: 486 LTNGYAIFIPANWNVSDFIAAYVTLPIFLVLWIGHKLWTRTWKTWAIPVPEIDVTT---G 542

Query: 575 IDEEEEQGKIADAER 589
           + E EE+ K  D +R
Sbjct: 543 LKEIEEESKECDEKR 557

>YOR348C Chr15 complement(986899..988782) [1884 bp, 627 aa] {ON}
           PUT4Proline permease, required for high-affinity
           transport of proline; also transports the toxic proline
           analog azetidine-2-carboxylate (AzC); PUT4 transcription
           is repressed in ammonia-grown cells
          Length = 627

 Score =  343 bits (880), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 191/556 (34%), Positives = 304/556 (54%), Gaps = 27/556 (4%)

Query: 46  DKKDGLDINDMDNLSTVSSRLEDSEKQDDYMD---------DGKDEHTRLRKDLKARHIS 96
           +K D + +  +    + SS    + ++D  MD         DG  E  +L++ L++RH+ 
Sbjct: 59  EKDDAIRMEKISKNQSASS--NGTIREDLIMDVDLEKSPSVDGDSEPHKLKQGLQSRHVQ 116

Query: 97  MIAXXXXXXXXXXXXXXXXXYTAGPMSMFIAYAFVGVLVFFTMAALGEMASYIPLDGFTS 156
           +IA                 +T GP  +FI+Y  +  +++  M ALGEM  ++P DG  S
Sbjct: 117 LIALGGAIGTGLLVGTSSTLHTCGPAGLFISYIIISAVIYPIMCALGEMVCFLPGDGSDS 176

Query: 157 YAS------RYCDPALGFAVGYAYLCKYLILPPNQLTAAALVIQYWLDREQVNPGVWITI 210
             S      RY DP+LGFA G+ Y   Y+IL   + TAA+ V++YW     V  GVWITI
Sbjct: 177 AGSTANLVTRYVDPSLGFATGWNYFYCYVILVAAECTAASGVVEYW--TTAVPKGVWITI 234

Query: 211 FLVIIVAMNFIGVKFFGEFEFWLSTFKVIVMIGLIILLFVIMLGGGPTHDRLGFRFYDHP 270
           FL ++V +NF  VK +GE EFW ++ K++ ++GLIIL F++  GGGP HDRLGFR++ HP
Sbjct: 235 FLCVVVILNFSAVKVYGESEFWFASIKILCIVGLIILSFILFWGGGPNHDRLGFRYWQHP 294

Query: 271 GAFKPYSKSIDGSKGKXXXXXXXXXXXXXX-XXGIELTGIVAAEAANPRKSIPKAIKLTM 329
           GAF  +     GS G                  G EL  + +AE A+ R++I KA +  +
Sbjct: 295 GAFAHHLTG--GSLGNFTDIYTGIIKGAFAFILGPELVCMTSAECADQRRNIAKASRRFV 352

Query: 330 YRIIVFYLVTIFLLGMCVAYDDP-LLXXXXXXXXXXXXXPYVVAIINSGIKALPHIFNAC 388
           +R+I FY++    + + V Y+DP L+             P+V+ I N+GIK LPHI N C
Sbjct: 353 WRLIFFYVLGTLAISVIVPYNDPTLVNALAQGKPGAGSSPFVIGIQNAGIKVLPHIINGC 412

Query: 389 VLMFVFSACNSDLYVASRTLYGLAIDNKAPKIFAVTNRWGVPYYSLLMSSCFCLLAYMSV 448
           +L   +SA N+ ++ ++R+L  +A   +APK     N+WGVPY ++ +S     LAY++V
Sbjct: 413 ILTSAWSAANAFMFASTRSLLTMAQTGQAPKCLGRINKWGVPYVAVGVSFLCSCLAYLNV 472

Query: 449 SSGSAKIFNYFVNVVSIFGLLSWISILITYLCFFRAVKAQNVDRSRFAYRAPFQPYGSYF 508
           SS +A +FN+F N+ +I G L W+   I YL F +A+    +   R  ++   QPY  +F
Sbjct: 473 SSSTADVFNWFSNISTISGFLGWMCGCIAYLRFRKAIFYNGL-YDRLPFKTWGQPYTVWF 531

Query: 509 TLAFCILIAFIKNFTVFLNHHFDYKNFITGYIGIPVFVISYFGYKFVKKT--KIWKP-EE 565
           +L    +I     + +F+  ++   +FI  YI +P+F++ +FG+K   +T  + W P  E
Sbjct: 532 SLIVIGIITITNGYAIFIPKYWRVADFIAAYITLPIFLVLWFGHKLYTRTWRQWWLPVSE 591

Query: 566 VDLYTFKAAIDEEEEQ 581
           +D+ T    I+E+  +
Sbjct: 592 IDVTTGLVEIEEKSRE 607

>Smik_5.24 Chr5 complement(34087..35859) [1773 bp, 590 aa] {ON}
           YEL063C (REAL)
          Length = 590

 Score =  341 bits (875), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 189/534 (35%), Positives = 301/534 (56%), Gaps = 19/534 (3%)

Query: 47  KKDGLDINDMDN-----LSTVSSRL--EDSEKQDDYM---DDGKDEHTRLRKDLKARHIS 96
           ++  L + D  N     L + S+R+  ED+    D +   D G+  +  ++++LK RHI 
Sbjct: 35  RRGSLPLKDEKNKELYPLHSFSTRVDGEDTFSMGDVIRDEDQGEVRNAEVKRELKQRHIG 94

Query: 97  MIAXXXXXXXXXXXXXXXXXYTAGPMSMFIAYAFVGVLVFFTMAALGEMASYIPL-DGFT 155
           MIA                   AGP+   I+Y F+G L +    +LGEMA++IP+   FT
Sbjct: 95  MIALGGTIGTGLFIGLSKPLANAGPVGALISYLFMGSLAYSVTQSLGEMATFIPVTSSFT 154

Query: 156 SYASRYCDPALGFAVGYAYLCKYLILPPNQLTAAALVIQYWLDREQVNPGVWITIFLVII 215
            ++ R+  PA G A GY Y   + I    +L+    VI++W ++  V    WI+IF VII
Sbjct: 155 VFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIEFWTNK--VPLAAWISIFWVII 212

Query: 216 VAMNFIGVKFFGEFEFWLSTFKVIVMIGLIILLFVIMLGGGPTHDRLGFRFYDHPGAFKP 275
             MN   VK++GEFEFW+++ KV+ +IG +I  F ++ G G T   +GFR++ +PGA+ P
Sbjct: 213 TIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCGAGVTGP-VGFRYWRNPGAWGP 271

Query: 276 YSKSIDGSKGKXXXXXXXXXXXXXXXXGIELTGIVAAEAANPRKSIPKAIKLTMYRIIVF 335
              S D ++G+                G EL GI A EAANPRK++P+AIK  ++RI+ F
Sbjct: 272 GIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTVPRAIKKVVFRILTF 331

Query: 336 YLVTIFLLGMCVAYDDPLLXXXXXXXXXXXXXPYVVAIINSGIKALPHIFNACVLMFVFS 395
           Y+ ++  +G+ V Y+DP L             P+++AI NSG K LPHIFNA +L  + S
Sbjct: 332 YIGSLLFIGLLVPYNDPKLTTATSYVSVS---PFIIAIENSGTKVLPHIFNAVILTTIIS 388

Query: 396 ACNSDLYVASRTLYGLAIDNKAPKIFAVTNRWGVPYYSLLMSSCFCLLAYMSVSSGSAKI 455
           A NS++YV SR L+GL+ +  APK  + T + GVPY ++ +++ F  LAYM  S+G  K+
Sbjct: 389 AANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFITAVFGALAYMETSTGGDKV 448

Query: 456 FNYFVNVVSIFGLLSWISILITYLCFFRAVKAQNVDRSRFAYRAPFQPYGSYFTLAFCIL 515
           F + +N+  + G  +W+ I I+++ F +A+K + + R    ++A   P  +YF   F I+
Sbjct: 449 FEWLLNITGVAGFFAWLLISISHIRFMQALKYRGISRDELPFKAKLMPGLAYFAATFMII 508

Query: 516 IAFIKNFTVFLNHHFDYKNFITGYIGIPVFVISYFGYKFVKKTK-IWKPEEVDL 568
           I  I+ FT F    FD  +F+  YI I +F+  +  ++ + + + IWK E+VD+
Sbjct: 509 IILIQGFTAF-APKFDGIDFLAAYISIFLFLAIWILFEIIFRCRFIWKIEDVDI 561

>Kwal_23.4026 s23 (534468..536072) [1605 bp, 534 aa] {ON} YPL265W
           (DIP5) - dicarboxylic amino acid permease [contig 255]
           FULL
          Length = 534

 Score =  339 bits (870), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 195/531 (36%), Positives = 303/531 (57%), Gaps = 11/531 (2%)

Query: 53  INDMDNLSTVSSRLEDSEK--QDDYMDDGKDEHTRLRKDLKARHISMIAXXXXXXXXXXX 110
           +  +D L T +S  + + +  + D+ +   +    L++  K RH+ M+A           
Sbjct: 11  VKRVDTLDTGNSDTQQNGEVYELDFQEAIGESSQTLQRGFKQRHVDMLAIAGAIGTGLVI 70

Query: 111 XXXXXXYTAGPMSMFIAYAFVGVLVFFTMAALGEMASYIPLD-GFTSYASRYCDPALGFA 169
                    GP S+ IA+ F G L+   + +L EMAS+ P+D  F+ YA+RY DPALGFA
Sbjct: 71  GTGTALKRGGPGSLLIAFIFTGSLLIGVLMSLAEMASFAPMDKSFSGYATRYVDPALGFA 130

Query: 170 VGYAYLCKYLILPPNQLTAAALVIQYWLDREQVNPGVWITIFLVIIVAMNFIGVKFFGEF 229
            G+ Y  KY I   ++L+A  L++QYW  RE ++  ++I +FLV+++++NF+ +KF+GE 
Sbjct: 131 TGWNYFLKYAIALASELSAIGLLVQYW--REDLSIAIFIVVFLVVLLSLNFMNIKFYGEV 188

Query: 230 EFWLSTFKVIVMIGLIILLFVIMLGGGPTHDRLGFRFYDHPGAFKPYSKSIDGSKGKXXX 289
           EFW +  K +V+I   +   V+  GGGP+ + +GFR++    AF PY   + G+ G+   
Sbjct: 189 EFWSALLKFLVLIICFVTGLVLTCGGGPSKETIGFRYWREY-AFVPYL--VKGTTGRFLG 245

Query: 290 XXXXXXXXXXXXXGIELTGIVAAEAANPRKSIPKAIKLTMYRIIVFYLVTIFLLGMCVAY 349
                        G E  G+V  EA NP+K+IP A +  ++RI  FY+V + +LG+ ++ 
Sbjct: 246 WWACVIQSCYAYIGSETIGVVFGEAPNPKKTIPAATRNVIFRITGFYIVGVLILGLIISP 305

Query: 350 DDPLLXXXXXXXXXXXXXPYVVAIINSGIKALPHIFNACVLMFVFSACNSDLYVASRTLY 409
            D  L             P+V+A  N+GIK LP   NA ++MF+ SA N+ LYV SRT Y
Sbjct: 306 HDKTLANAKTSDASGS--PFVIAFTNAGIKGLPSFINAMLIMFIASAANTALYVCSRTAY 363

Query: 410 GLAIDNKAPKIFAVTNRWGVPYYSLLMSSCFCLLAYMSVSSGSAKIFNYFVNVVSIFGLL 469
           GLA D  APKIF   NR+GVP+   L++    LL++M++S+ S+ IF Y  + V++FG L
Sbjct: 364 GLAKDGMAPKIFLAQNRYGVPFNGCLLAGLISLLSFMNISNSSSVIFGYLTSSVTVFGTL 423

Query: 470 SWISILITYLCFFRAVKAQNVDRSRFAYRAPFQPYGSYFTLAFCILIAFIKNFTVFLNHH 529
           +W+S+LI+Y+ + RA    +V R R  +R  FQPY +Y  L F  LI F   ++ F+   
Sbjct: 424 NWLSVLISYIGYERARVFHDVPRDRIPFRMWFQPYSAYVCLFFVSLIIFFNGYSAFI-AG 482

Query: 530 FDYKNFITGYIGIPVFVISYFGYKFVKKTKIWKPEEVDLYTFKAAIDEEEE 580
           F YK+FI  YIGI VF+ +   +KF KK+   +PE++     + AI E  E
Sbjct: 483 FKYKSFIVSYIGIAVFIGNTLFWKFWKKSAATRPEDLRSIMVEEAIVEVRE 533

>Suva_5.4 Chr5 complement(7388..9160) [1773 bp, 590 aa] {ON} YEL063C
           (REAL)
          Length = 590

 Score =  338 bits (868), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 187/540 (34%), Positives = 301/540 (55%), Gaps = 21/540 (3%)

Query: 53  INDMDNLSTVSSRLEDSEKQDDYMDDGKDEHTRLRKDLKARHISMIAXXXXXXXXXXXXX 112
           +N  D  S       + + QD+  D+G+ ++  ++++LK RHI MIA             
Sbjct: 59  VNGQDTFSM------EEDIQDE--DEGEVQNAEVKRELKQRHIGMIALGGTIGTGLFIGL 110

Query: 113 XXXXYTAGPMSMFIAYAFVGVLVFFTMAALGEMASYIPL-DGFTSYASRYCDPALGFAVG 171
                 AGP+   I+Y F+G L +    +LGEMA++IP+   FT ++ R+  PA G A G
Sbjct: 111 STPLTNAGPVGALISYLFMGSLAYSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANG 170

Query: 172 YAYLCKYLILPPNQLTAAALVIQYWLDREQVNPGVWITIFLVIIVAMNFIGVKFFGEFEF 231
           Y Y   + +    +L+    VIQ+W     V    WI+IF VII AMN   VK++GEFEF
Sbjct: 171 YMYWFSWAVTFALELSVVGQVIQFW--TYAVPLAAWISIFWVIITAMNMFPVKYYGEFEF 228

Query: 232 WLSTFKVIVMIGLIILLFVIMLGGGPTHDRLGFRFYDHPGAFKPYSKSIDGSKGKXXXXX 291
           W+++ KVI +IG +I  F ++ G G T   +GFR++ +PGA+ P   S + ++ +     
Sbjct: 229 WVASIKVIAIIGFLIYCFCMVCGAGVTGP-VGFRYWRNPGAWGPGIISKNKNEARFLGWV 287

Query: 292 XXXXXXXXXXXGIELTGIVAAEAANPRKSIPKAIKLTMYRIIVFYLVTIFLLGMCVAYDD 351
                      G EL GI A EAANPRK++P+AIK  ++RI+ FY+ ++  +G+ V Y+D
Sbjct: 288 SSLINAAFTFQGTELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYND 347

Query: 352 PLLXXXXXXXXXXXXXPYVVAIINSGIKALPHIFNACVLMFVFSACNSDLYVASRTLYGL 411
           P L             P+++AI NSG K LPHIFNA +L  + SA NS++YV SR L+GL
Sbjct: 348 PKLTSATSYVSTS---PFIIAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRVLFGL 404

Query: 412 AIDNKAPKIFAVTNRWGVPYYSLLMSSCFCLLAYMSVSSGSAKIFNYFVNVVSIFGLLSW 471
           +    APK F+ T + GVPY ++  +S F  LAYM  S+G  K+F + +N+  + G  +W
Sbjct: 405 SKSKLAPKFFSKTTKGGVPYIAVFATSIFGALAYMETSTGGGKVFAWLLNITGVAGFFAW 464

Query: 472 ISILITYLCFFRAVKAQNVDRSRFAYRAPFQPYGSYFTLAFCILIAFIKNFTVFLNHHFD 531
           + I ++++ F +A+K + + R    ++A   P  +Y+   F ++I  I+ FT F    F+
Sbjct: 465 LFISVSHIRFMQALKYRGISRDELPFKAKLMPGLAYYATFFMVVIILIQGFTSF-TPTFN 523

Query: 532 YKNFITGYIGIPVFVISYFGYKFVKKTK-IWKPEEVDLYT----FKAAIDEEEEQGKIAD 586
             NF+  YI + +F+  +  ++ + + + +WK E+VD+ +     +A + EE E   + D
Sbjct: 524 GVNFLAAYISVFLFLAIWILFELIFRCRFVWKIEDVDIDSDRRDIEAIVWEEPEPKTLWD 583

>SAKL0C02662g Chr3 complement(249789..251435) [1647 bp, 548 aa] {ON}
           uniprot|Q875R1 Saccharomyces kluyveri CAN1 Plasma
           membrane arginine permease requires phosphatidyl
           ethanolamine (PE) for localization exclusively
           associated with lipid rafts mutation confers canavanine
           resistance
          Length = 548

 Score =  337 bits (863), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 188/532 (35%), Positives = 294/532 (55%), Gaps = 14/532 (2%)

Query: 54  NDMDNLSTVSSRLEDSEKQDDYMDDGKDEHTRLRKDLKARHISMIAXXXXXXXXXXXXXX 113
            D  +L    S  ED+   +     G  + T++++ LK RHISMIA              
Sbjct: 13  KDGSHLIIKPSIAEDAVSMESL---GSVKETQVKRALKPRHISMIALGGTIGTGLFISIS 69

Query: 114 XXXYTAGPMSMFIAYAFVGVLVFFTMAALGEMASYIPL-DGFTSYASRYCDPALGFAVGY 172
                AGP+   IAY F+G L +    +LGEMA++IP+   FT +  R+  PALG A GY
Sbjct: 70  TPLSNAGPVGALIAYMFIGTLAYSVTQSLGEMATFIPVTSSFTVFTQRFLSPALGSANGY 129

Query: 173 AYLCKYLILPPNQLTAAALVIQYWLDREQVNPGVWITIFLVIIVAMNFIGVKFFGEFEFW 232
            Y   + I    +L+    +IQ+W D   +    WI IF VI+   N   VK++GE EFW
Sbjct: 130 LYWLSWAITFALELSVVGQIIQFWTDAVPLT--AWIAIFWVILTISNLFPVKYYGEVEFW 187

Query: 233 LSTFKVIVMIGLIILLFVIMLGGGPTHDRLGFRFYDHPGAFKPYSKSIDGSKGKXXXXXX 292
           ++  KV+ ++G II  F+++ G G T   +GFR++ +PG + P   S D ++G+      
Sbjct: 188 IACIKVLAIVGFIIYAFIMVCGAGKTGP-VGFRYWRNPGPWGPGIISKDVNEGRFLGWVS 246

Query: 293 XXXXXXXXXXGIELTGIVAAEAANPRKSIPKAIKLTMYRIIVFYLVTIFLLGMCVAYDDP 352
                     G EL GI A EAANPRK++P+AI    +RI+ FY++++  +G+ V ++DP
Sbjct: 247 SLISAAFTYQGTELVGITAGEAANPRKTVPRAINKVFFRILFFYILSLLFIGLLVPFNDP 306

Query: 353 LLXXXXXXXXXXXXXPYVVAIINSGIKALPHIFNACVLMFVFSACNSDLYVASRTLYGLA 412
            L             P+V+AI NSG K LPHIFNA +L  + SA NS++YV SR  Y +A
Sbjct: 307 KLKSEDSYISSS---PFVIAIENSGTKVLPHIFNAVILSTIISAGNSNVYVGSRIAYSMA 363

Query: 413 IDNKAPKIFAVTNRWGVPYYSLLMSSCFCLLAYMSVSSGSAKIFNYFVNVVSIFGLLSWI 472
           ++  APK    T + G+PY ++L +S    LAY+  SSG++ +FN+ +N+ ++ G  +WI
Sbjct: 364 MNGLAPKYLTWTTKSGIPYAAVLTTSVLGFLAYLESSSGASAVFNWLLNITAVAGFFTWI 423

Query: 473 SILITYLCFFRAVKAQNVDRSRFAYRAPFQPYGSYFTLAFCILIAFIKNFTVFLNHHFDY 532
            I I+++ F +A+K Q + R    ++A F P+G+Y+   F  +I  I+ FT F    F  
Sbjct: 424 LISISHIRFMQALKHQGISRDDLPFKAKFMPWGAYYAAFFIGVIIIIQGFTAF-APKFKV 482

Query: 533 KNFITGYIGIPVFVISYFGYKFVKKTKIW-KPEEVDLYTFKAAIDE--EEEQ 581
            +F T YI + +F + + G++   +  ++ K E++DL T +  ID+   EEQ
Sbjct: 483 SDFFTAYISVMLFFVFWIGFQIWFRGPLFIKTEDIDLDTDRREIDDVVWEEQ 534

>Kwal_26.6940 s26 (133377..135089) [1713 bp, 570 aa] {ON} YOR348C
           (PUT4) - 1:1 [contig 46] FULL
          Length = 570

 Score =  337 bits (865), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 199/556 (35%), Positives = 307/556 (55%), Gaps = 29/556 (5%)

Query: 46  DKKDGLDIN-DMDNLSTVSSRLEDSEKQDDYMDDGKDEHTRLRKDLKARHISMIAXXXXX 104
           DK+ G     D ++LS +++   +S+K        ++ HT L++ L++RHI +IA     
Sbjct: 17  DKQTGQVFELDTESLSALNTGGSESQK--------REPHT-LKQGLQSRHIQLIALGGVI 67

Query: 105 XXXXXXXXXXXXYTAGPMSMFIAYAFVGVLVFFTMAALGEMASYIPLDG------FTSYA 158
                        T GP  +  +Y  + ++++  M ALGEM  Y+P  G       +   
Sbjct: 68  GTGLFVGTSSTLSTCGPAGLLTSYIIISLVIYPVMNALGEMVCYLPGSGTDSGGSISKLV 127

Query: 159 SRYCDPALGFAVGYAYLCKYLILPPNQLTAAALVIQYWLDREQVNPGVWITIFLVIIVAM 218
           SRY DP+LGFA G+ Y   Y+IL   + TAA+ V+ YW     V    WITIFL ++  +
Sbjct: 128 SRYADPSLGFATGWNYYYCYVILIAAECTAASGVVTYW--TTVVPKAAWITIFLGVVTML 185

Query: 219 NFIGVKFFGEFEFWLSTFKVIVMIGLIILLFVIMLGGGPTHDRLGFRFYDHPGAFKPYSK 278
           NF  VKF+GE EFW +  K++ ++GL+ + F++  GGGP+HDRLGFR++  PGAF  +  
Sbjct: 186 NFGPVKFYGESEFWFAILKILCIVGLLFVSFILFWGGGPSHDRLGFRYWQKPGAFAYHIT 245

Query: 279 SIDGSKGKXXXXXXXXXXXXXX-XXGIELTGIVAAEAANPRKSIPKAIKLTMYRIIVFYL 337
           +  G+ G+                 G EL  + ++EA + R++I KA +   YR+I FY+
Sbjct: 246 T--GNTGRFLDVWTGVIKGGFAFILGPELVAVTSSEAMDQRRNIEKASRRFAYRLIFFYV 303

Query: 338 VTIFLLGMCVAYDDPLLX-XXXXXXXXXXXXPYVVAIINSGIKALPHIFNACVLMFVFSA 396
            +   +G+ VA +DP+L              P+V+AI N+ IK LPHI NAC+L   +S+
Sbjct: 304 ASALAIGVIVAQNDPVLRDALASGKAGAASSPFVIAIQNAHIKILPHIINACILSSAWSS 363

Query: 397 CNSDLYVASRTLYGLAIDNKAPKIFAVTNRWGVPYYSLLMSSCFCLLAYMSVSSGSAKIF 456
            NS ++ ASR+L  +A D  APK+F   NR GVPY ++ +S+ F  LAY++VSSGSAK F
Sbjct: 364 GNSFMFAASRSLLSMAEDGVAPKMFKKINRAGVPYNAVAVSAAFSCLAYLNVSSGSAKAF 423

Query: 457 NYFVNVVSIFGLLSWISILITYLCFFRAVKAQNVDRSRFAYRAPFQPYGSYFTLAFCILI 516
            +F N+ +I G + WI I + YL F +A+  + +   R  +++PFQPYG+YF +    +I
Sbjct: 424 TWFSNISTISGFIGWICIGVAYLRFRKAIFFRGL-YDRVPFKSPFQPYGTYFFIIVVSII 482

Query: 517 AFIKNFTVFLNHHFDYKNFITGYIGIPVFVISYFGYKFVKKT-KIW--KPEEVDLYTFKA 573
                +  F+   +   +F+  YI +PVFV+ + G+K   +T   W     EVD+ T   
Sbjct: 483 CLTNGYATFIPRFWKGADFVAAYITLPVFVVLWVGHKIYTRTLSTWVIPVAEVDVTT--- 539

Query: 574 AIDEEEEQGKIADAER 589
            + E EE  K  DA R
Sbjct: 540 GLAEIEELTKELDALR 555

>YNL268W Chr14 (138550..140385) [1836 bp, 611 aa] {ON}  LYP1Lysine
           permease; one of three amino acid permeases (Alp1p,
           Can1p, Lyp1p) responsible for uptake of cationic amino
           acids
          Length = 611

 Score =  337 bits (865), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 188/541 (34%), Positives = 300/541 (55%), Gaps = 17/541 (3%)

Query: 49  DGLDINDMDNLSTVSSRLEDSEKQDDYMDDGKDEH---TRLRKDLKARHISMIAXXXXXX 105
            G  I D+++++   +RL+    + D  +D ++ H     +++ LK RHI MIA      
Sbjct: 66  QGGAIADVNSITNSLTRLQVVSHETDINEDEEEAHYEDKHVKRALKQRHIGMIALGGTIG 125

Query: 106 XXXXXXXXXXXYTAGPMSMFIAYAFVGVLVFFTMAALGEMASYIPL-DGFTSYASRYCDP 164
                        AGP+   IAY F+G +V+F   +LGEMA++IP+    T ++ R+  P
Sbjct: 126 TGLFVGISTPLSNAGPVGSLIAYIFMGTIVYFVTQSLGEMATFIPVTSSITVFSKRFLSP 185

Query: 165 ALGFAVGYAYLCKYLILPPNQLTAAALVIQYWLDREQVNPGVWITIFLVIIVAMNFIGVK 224
           A G + GY Y   + I    +++    VI+YW D+  V    WI IF VII  MNF  VK
Sbjct: 186 AFGVSNGYMYWFNWAITYAVEVSVIGQVIEYWTDK--VPLAAWIAIFWVIITLMNFFPVK 243

Query: 225 FFGEFEFWLSTFKVIVMIGLIILLFVIMLGGGPTHDRLGFRFYDHPGAFKPYSKSIDGSK 284
            +GEFEFW+++ KV+ ++G +I   +I+ GG      +GFR++ +PGA+ P   S D S+
Sbjct: 244 VYGEFEFWVASVKVLAIMGYLIYALIIVCGGS-HQGPIGFRYWRNPGAWGPGIISSDKSE 302

Query: 285 GKXXXXXXXXXXXXXXXXGIELTGIVAAEAANPRKSIPKAIKLTMYRIIVFYLVTIFLLG 344
           G+                G EL GI A EAANPRK++P+AI   ++RI++FY++++F +G
Sbjct: 303 GRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVPRAINKVVFRIVLFYIMSLFFIG 362

Query: 345 MCVAYDDPLLXXXXXXXXXXXXXPYVVAIINSGIKALPHIFNACVLMFVFSACNSDLYVA 404
           + V Y+D  L             P+V++I N+G  ALP IFNA VL+ V SA NS++YV 
Sbjct: 363 LLVPYNDSRLSASSAVIASS---PFVISIQNAGTYALPDIFNAVVLITVVSAANSNVYVG 419

Query: 405 SRTLYGLAIDNKAPKIFAVTNRWGVPYYSLLMSSCFCLLAYMSVSSGSAKIFNYFVNVVS 464
           SR LY LA    APK F    R GVPY  ++ ++   LLA++ V++ +   FN+ +N+ +
Sbjct: 420 SRVLYSLARTGNAPKQFGYVTRQGVPYLGVVCTAALGLLAFLVVNNNANTAFNWLINIST 479

Query: 465 IFGLLSWISILITYLCFFRAVKAQNVDRSRFAYRAPFQPYGSYFTLAFCILIAFIKNFTV 524
           + GL +W+ I + ++ F +A+K + + R    ++A   PYG+Y+   F  +I FI+ F  
Sbjct: 480 LAGLCAWLFISLAHIRFMQALKHRGISRDDLPFKAKLMPYGAYYAAFFVTVIIFIQGFQA 539

Query: 525 FLNHHFDYKNFITGYIGIPVFVISYFGYKFVKKTK-IWKPEEVDLYT----FKAAIDEEE 579
           F    F    F T YI + +  + + G +   K + IWK E++D+ +     +A I E++
Sbjct: 540 FC--PFKVSEFFTSYISLILLAVVFIGCQIYYKCRFIWKLEDIDIDSDRREIEAIIWEDD 597

Query: 580 E 580
           E
Sbjct: 598 E 598

>TBLA0A05460 Chr1 (1348452..1350278) [1827 bp, 608 aa] {ON} Anc_1.84
           YNL268W
          Length = 608

 Score =  336 bits (861), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 186/547 (34%), Positives = 309/547 (56%), Gaps = 15/547 (2%)

Query: 46  DKKDGLDINDMDNLSTVSSRLEDSEKQDDYMDDGKDE--HTRLRKDLKARHISMIAXXXX 103
           +KKD    +   +++  +S   ++    D  D  + E   T++++ LK RHI MIA    
Sbjct: 61  EKKDSKS-DIFTSVNRYASHPSEARISSDEYDHQEAEFKDTKVKRALKPRHIGMIALGGT 119

Query: 104 XXXXXXXXXXXXXYTAGPMSMFIAYAFVGVLVFFTMAALGEMASYIPL-DGFTSYASRYC 162
                          +GP+   IAY F+G +V+F   ALGEMA++IP+    T ++SR+ 
Sbjct: 120 IGTGLFIGISDPLQKSGPVGSLIAYIFMGTVVYFVTQALGEMATFIPVTSSITVFSSRFL 179

Query: 163 DPALGFAVGYAYLCKYLILPPNQLTAAALVIQYWLDREQVNPGVWITIFLVIIVAMNFIG 222
            PA G + GY Y   + I    +++    VI++W  +  V    WI+IF V++ A+NF  
Sbjct: 180 SPAFGVSNGYLYWFNWAITYAVEISVVGQVIEFWTTK--VPLAAWISIFWVLVTALNFFP 237

Query: 223 VKFFGEFEFWLSTFKVIVMIGLIILLFVIMLGGGPTHDRLGFRFYDHPGAFKPYSKSIDG 282
           V  +GE EFW+++ KV+ ++G +I   VI+ GG      +GFR++ H  A      S D 
Sbjct: 238 VSVYGEIEFWVASVKVLAIVGYLIYALVIVCGGS-KQGPIGFRYWRHGYAMGGGMISKDK 296

Query: 283 SKGKXXXXXXXXXXXXXXXXGIELTGIVAAEAANPRKSIPKAIKLTMYRIIVFYLVTIFL 342
           ++ +                G EL GI A EAANPRKS+P+AI   ++RI++FY++++F 
Sbjct: 297 NEARFLGWVASLINAAFTYQGTELVGITAGEAANPRKSVPRAINKVVFRIVIFYILSLFF 356

Query: 343 LGMCVAYDDPLLXXXXXXXXXXXXXPYVVAIINSGIKALPHIFNACVLMFVFSACNSDLY 402
           +G+ V Y+DP L             P+V++I N+G +ALPHIFNA +++ + SA NS++Y
Sbjct: 357 IGLLVPYNDPKLNSATSYIASS---PFVISIENAGTRALPHIFNAIIMITIISAANSNVY 413

Query: 403 VASRTLYGLAIDNKAPKIFAVTNRWGVPYYSLLMSSCFCLLAYMSVSSGSAKIFNYFVNV 462
           V+SR LY LA+   APKIFA     GVP+  +++++   LLA++ V++ + + FN+ +N+
Sbjct: 414 VSSRVLYSLALSGHAPKIFARVTPQGVPFLGVIVTALMGLLAFLVVNNNANEAFNWLINI 473

Query: 463 VSIFGLLSWISILITYLCFFRAVKAQNVDRSRFAYRAPFQPYGSYFTLAFCILIAFIKNF 522
            ++ GL +W+ I +++L F  A+K + + R    ++A F PYGSY+   F  +I FI+ F
Sbjct: 474 STLAGLCAWLFISMSHLRFMEALKYRGISRDDLPFKARFMPYGSYYACFFITVIIFIQGF 533

Query: 523 TVFLNHHFDYKNFITGYIGIPVFVISYFGYKFVKKTK-IWKPEEVDLYTFKAAIDE---E 578
           T F +  FD  +F T YI + +  + + G +   + +  WK E++D+ T +  IDE   E
Sbjct: 534 TAF-SPKFDVASFFTAYISLILLAVLFIGCQLYYRCRFFWKVEDIDIDTDRREIDEIVWE 592

Query: 579 EEQGKIA 585
           +++ K A
Sbjct: 593 DDEPKTA 599

>CAGL0J08184g Chr10 (806631..808349) [1719 bp, 572 aa] {ON} similar
           to uniprot|P04817 Saccharomyces cerevisiae YEL063c CAN1
           or uniprot|P38971 Saccharomyces cerevisiae YNL270c ALP1
           or uniprot|P32487 Saccharomyces cerevisiae YNL268w LYP1
          Length = 572

 Score =  335 bits (858), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 182/520 (35%), Positives = 292/520 (56%), Gaps = 13/520 (2%)

Query: 60  STVSSRLEDSEKQDDYMDDGKDEHTRLRKDLKARHISMIAXXXXXXXXXXXXXXXXXYTA 119
           S  S++ ED   + D +     EH  +++ LK RHI MIA                   A
Sbjct: 44  SVSSTQYEDLATEKDELL----EHHDVKRSLKQRHIGMIALGGTIGTGLFIGIATPLANA 99

Query: 120 GPMSMFIAYAFVGVLVFFTMAALGEMASYIPL-DGFTSYASRYCDPALGFAVGYAYLCKY 178
           GP+   +AY F+G +VF    +LGEMA++IP+   F+ +A R+  PALG A GY Y   +
Sbjct: 100 GPVGALVAYLFMGTVVFSVTQSLGEMATFIPVTSSFSVFAQRFLSPALGAANGYMYFLSW 159

Query: 179 LILPPNQLTAAALVIQYWLDREQVNPGVWITIFLVIIVAMNFIGVKFFGEFEFWLSTFKV 238
                 +L+    +IQ+W  +  V    WI+IF V++ A N   VKF+GEFEFW+++ KV
Sbjct: 160 CFTFALELSVVGQIIQFWTFK--VPLAAWISIFWVLLTAFNMFPVKFYGEFEFWIASIKV 217

Query: 239 IVMIGLIILLFVIMLGGGPTHDRLGFRFYDHPGAFKPYSKSIDGSKGKXXXXXXXXXXXX 298
           + ++G +I    I+ G G T   +GFR++ +PGA  P   S +  + +            
Sbjct: 218 LALMGFLIYSLCIVCGAGKTGP-IGFRYWRNPGAMGPGIISSNTGEARFLGWVSSLINAA 276

Query: 299 XXXXGIELTGIVAAEAANPRKSIPKAIKLTMYRIIVFYLVTIFLLGMCVAYDDPLLXXXX 358
               G EL GI A EAANPRK++P+AI+  + RI++FY+ ++F +G+ V Y+DP L    
Sbjct: 277 FTYQGTELVGITAGEAANPRKAVPRAIRKVLIRILLFYIGSLFFIGLTVPYNDPKLTSTD 336

Query: 359 XXXXXXXXXPYVVAIINSGIKALPHIFNACVLMFVFSACNSDLYVASRTLYGLAIDNKAP 418
                    P+++ I N+G + LPHIFNA +L  + SA NS++YV SR L+ +A +  AP
Sbjct: 337 SYVSSS---PFIITIQNAGTRVLPHIFNAVILTTIISAGNSNVYVGSRILFSMAKNGLAP 393

Query: 419 KIFAVTNRWGVPYYSLLMSSCFCLLAYMSVSSGSAKIFNYFVNVVSIFGLLSWISILITY 478
           K  A T   GVPY S+L  S F  L+YM +S+G AK FN+ +N+  + G  +W+ I  ++
Sbjct: 394 KFLAKTTLQGVPYLSVLAISAFGSLSYMELSTGGAKAFNWLLNITGVAGFFAWLLISCSH 453

Query: 479 LCFFRAVKAQNVDRSRFAYRAPFQPYGSYFTLAFCILIAFIKNFTVFLNHHFDYKNFITG 538
           + F +A+K + + R    Y+A + P+ +Y+ + F ++I  I+ FT F   HF  ++F+  
Sbjct: 454 VRFMQALKHRGISRDDLPYKALWMPWLAYYAIFFMVVIILIQGFTSF-APHFSGRDFVAA 512

Query: 539 YIGIPVFVISYFGYKFVKKTK-IWKPEEVDLYTFKAAIDE 577
           YI + +F++ +  ++   + + IWK E+VD+ T +  I+ 
Sbjct: 513 YISVGLFLVFWGFFQIYFRCRIIWKLEDVDIDTDRREIES 552

>TDEL0H04070 Chr8 complement(698717..700450) [1734 bp, 577 aa] {ON}
           Anc_7.44 YOR348C
          Length = 577

 Score =  334 bits (857), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 194/557 (34%), Positives = 308/557 (55%), Gaps = 22/557 (3%)

Query: 46  DKKDGLDINDMDNLSTVSSRLEDSEKQDDYMDDGKDEHTRLRKDLKARHISMIAXXXXXX 105
           D+K G  + ++D L +++     + +  +   D K E  +L++ L ARHI +IA      
Sbjct: 19  DQKTG-QVLEID-LESLTPEGSSTNRGINGNKDAKLEG-KLQQGLSARHIQLIALGGAIG 75

Query: 106 XXXXXXXXXXXYTAGPMSMFIAYAFVGVLVFFTMAALGEMASYIPLDGFTSYAS------ 159
                      +T GP  +FI+Y  +  +++  M A GEM  Y+P +G  S  S      
Sbjct: 76  TGLFVGTSSTLHTCGPAGLFISYVIISTVLYPIMNAFGEMVCYLPGNGDDSAGSVSHLVD 135

Query: 160 RYCDPALGFAVGYAYLCKYLILPPNQLTAAALVIQYWLDREQVNPGVWITIFLVIIVAMN 219
           RY DP+L FA G+ Y   Y+IL   + TAA+ V++YW D   V    WITIFL I+V +N
Sbjct: 136 RYVDPSLSFATGWNYFYCYVILVAAECTAASGVVKYWTD--AVPTAAWITIFLSIVVLLN 193

Query: 220 FIGVKFFGEFEFWLSTFKVIVMIGLIILLFVIMLGGGPTHDRLGFRFYDHPGAFKPYSKS 279
              VK++GE EFW ++ KV+ ++GLIIL F++  GGGP HDRLGFR++ +PG F  +   
Sbjct: 194 LCAVKYYGETEFWFASIKVLCIVGLIILSFILFWGGGPNHDRLGFRYWKNPGGFAHHITG 253

Query: 280 IDGSKGKXXXXXXXXXXXXXX-XXGIELTGIVAAEAANPRKSIPKAIKLTMYRIIVFYLV 338
             G+ G                  G EL  + ++E  + R++I KA K  ++R++ FY++
Sbjct: 254 --GNLGNFLDVYSGIIKGAFAFILGPELIALASSECKDQRRNIMKASKRFVWRLMFFYIL 311

Query: 339 TIFLLGMCVAYDDPLLXXXXXXXX-XXXXXPYVVAIINSGIKALPHIFNACVLMFVFSAC 397
               + + VA +DP L              P+V+ I N+GIK LPHI NAC+L   +SA 
Sbjct: 312 GALSISVIVASNDPALTSALASGKPGAGSSPFVIGIQNAGIKILPHIINACILTSAWSAG 371

Query: 398 NSDLYVASRTLYGLAIDNKAPKIFAVTNRWGVPYYSLLMSSCFCLLAYMSVSSGSAKIFN 457
           N+ ++ +SR+L  +A + +APKIF   NR+GVP+ ++  S+    LAY++VSS +A +F 
Sbjct: 372 NAFMFASSRSLLTMASNGQAPKIFGKINRFGVPWVAVTFSALISCLAYLNVSSSTADVFA 431

Query: 458 YFVNVVSIFGLLSWISILITYLCFFRAVKAQNVDRSRFAYRAPFQPYGSYFTLAFCILIA 517
           +F N+ +I G + W   L+ YL F +A+K   ++ +R  Y   FQ Y  ++++    L+ 
Sbjct: 432 WFTNISTISGFIGWDCGLVAYLRFRKAIKYNGLE-NRLPYAPRFQQYMVWWSILVVTLVI 490

Query: 518 FIKNFTVFLNHHFDYKNFITGYIGIPVFVISYFGYKFVKK--TKIWKP-EEVDLYTFKAA 574
           F   + VF+   ++  +FI  YI +P+FV+ + G+K   +   K W P EE+D+ T    
Sbjct: 491 FTNGYQVFIPRFWNVSDFIAAYITLPLFVVLWIGHKIYTRDFKKWWYPVEEIDVVT---G 547

Query: 575 IDEEEEQGKIADAERRE 591
           + E EE+ +I D ER E
Sbjct: 548 LTEIEERTRILDEERVE 564

>TDEL0C06170 Chr3 complement(1117792..1119513) [1722 bp, 573 aa]
           {ON} Anc_1.84 YNL268W
          Length = 573

 Score =  334 bits (857), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 182/533 (34%), Positives = 296/533 (55%), Gaps = 17/533 (3%)

Query: 46  DKKDGLDINDMD------NLSTVSSRLEDSEKQDDYMDDGKDEHTRLRKDLKARHISMIA 99
             K G +++ +D       L TV++  +  E++D   ++     TR+++ LK RHI MIA
Sbjct: 23  QDKYGYELHPLDPVTQQVTLRTVTNVCDGLEEED--AEEAGYHDTRVKRALKQRHIGMIA 80

Query: 100 XXXXXXXXXXXXXXXXXYTAGPMSMFIAYAFVGVLVFFTMAALGEMASYIPL-DGFTSYA 158
                              AGP+   IAY F+G +V+F   +LGEMA++IP+    T ++
Sbjct: 81  LGGTIGTGLFVGIATPLSNAGPVGSLIAYLFMGSIVYFITQSLGEMATFIPVTSSITVFS 140

Query: 159 SRYCDPALGFAVGYAYLCKYLILPPNQLTAAALVIQYWLDREQVNPGVWITIFLVIIVAM 218
            R+  PA G A GY Y   + I    +++    VIQ+W     V    WI IF V +  +
Sbjct: 141 KRFLSPAFGVANGYMYWFNWAITYAVEISVIGQVIQFW--TSAVPLAAWIAIFWVFVSLL 198

Query: 219 NFIGVKFFGEFEFWLSTFKVIVMIGLIILLFVIMLGGGPTHDRLGFRFYDHPGAFKPYSK 278
           NF  VK +GE EFW+++ KVI ++G +I   VI+ GG  +   +GFR++ +PG + P   
Sbjct: 199 NFFPVKVYGEIEFWVASIKVIAIVGYLIYALVIVCGGS-SQGPIGFRYWRNPGPWGPGII 257

Query: 279 SIDGSKGKXXXXXXXXXXXXXXXXGIELTGIVAAEAANPRKSIPKAIKLTMYRIIVFYLV 338
           S D ++G+                G EL GI A EAANPRKS+P+AI   ++RI++FY++
Sbjct: 258 SDDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPRAINKVVFRIVIFYIM 317

Query: 339 TIFLLGMCVAYDDPLLXXXXXXXXXXXXXPYVVAIINSGIKALPHIFNACVLMFVFSACN 398
           ++F +GM V ++DP L             P+V++I N+G + LPHIFNA V++ + SA N
Sbjct: 318 SLFFVGMLVPFNDPRLASNVAVIASS---PFVISIQNAGTRVLPHIFNAVVMLTIISAAN 374

Query: 399 SDLYVASRTLYGLAIDNKAPKIFAVTNRWGVPYYSLLMSSCFCLLAYMSVSSGSAKIFNY 458
           S++YV SR LY L+    APK F    R GVPY  ++ +S   LLA++ V++ +   FN+
Sbjct: 375 SNVYVGSRVLYALSQTGNAPKQFGYVTRHGVPYLGVIATSLLGLLAFLVVNNNANTAFNW 434

Query: 459 FVNVVSIFGLLSWISILITYLCFFRAVKAQNVDRSRFAYRAPFQPYGSYFTLAFCILIAF 518
            +N+ ++ GL +W+ I ++++ F +A+K + + R    ++A   P+G+Y+   F  +I F
Sbjct: 435 LINISTLAGLCAWLFISLSHIRFMQALKFRGISRDDLPFKAKLMPWGAYYAAFFVTVIIF 494

Query: 519 IKNFTVFLNHHFDYKNFITGYIGIPVFVISYFGYKFVKKTK-IWKPEEVDLYT 570
           I+ F  F +  FD   F T YI + + V+   G +   + + +WK E++D+ T
Sbjct: 495 IQGFEAF-SPKFDVSGFFTAYISLIILVVLLIGCQLYYRCRFLWKLEDIDIDT 546

>KLTH0D01474g Chr4 (139116..140990) [1875 bp, 624 aa] {ON} similar
           to uniprot|P15380 Saccharomyces cerevisiae YOR348C PUT4
           proline-specific permease (also capable of transporting
           alanine and glycine) putative proline- specific permease
          Length = 624

 Score =  335 bits (859), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 189/515 (36%), Positives = 289/515 (56%), Gaps = 21/515 (4%)

Query: 86  LRKDLKARHISMIAXXXXXXXXXXXXXXXXXYTAGPMSMFIAYAFVGVLVFFTMAALGEM 145
           L+K L++RHI +IA                  T GP  +  +Y  + ++++  M +LGEM
Sbjct: 105 LKKGLQSRHIQLIALGGVIGTGLFVGTSSTLSTCGPAGLLTSYIIISLVIYPVMNSLGEM 164

Query: 146 ASYIPLDGFTSYAS------RYCDPALGFAVGYAYLCKYLILPPNQLTAAALVIQYWLDR 199
             ++P     S  S      RY DP+LGFA G+ Y   Y+IL   + TAA+ V+ YW   
Sbjct: 165 VCFLPGSNGQSGGSISKIVTRYADPSLGFATGWNYYYCYVILIAAECTAASGVVTYW--T 222

Query: 200 EQVNPGVWITIFLVIIVAMNFIGVKFFGEFEFWLSTFKVIVMIGLIILLFVIMLGGGPTH 259
             V  G WI IFL ++  +NF  VK +GE EFW +  K++ ++GL+ + F++  GGGPTH
Sbjct: 223 TAVPKGAWIAIFLGVVTVLNFSPVKIYGETEFWFAILKILCIVGLLFVSFILFWGGGPTH 282

Query: 260 DRLGFRFYDHPGAFKPYSKSIDGSKGKXX-XXXXXXXXXXXXXXGIELTGIVAAEAANPR 318
           DRLGFR++ HPGAF  +  +  G+ G+                 G EL  I ++EA + R
Sbjct: 283 DRLGFRYWQHPGAFAYHITT--GNTGRFLDIWTGVIKGGFAFILGPELVAITSSEALDAR 340

Query: 319 KSIPKAIKLTMYRIIVFYLVTIFLLGMCVAYDDPLLXXXXXXXXXXX-XXPYVVAIINSG 377
           ++I KA +   YR++ FY+ +   +G+ V+  DP+L              P+V+AI N+ 
Sbjct: 341 RNIEKASRRFAYRLVFFYVASALAIGVIVSRTDPVLKNALAEGKAGAGSSPFVIAIQNAH 400

Query: 378 IKALPHIFNACVLMFVFSACNSDLYVASRTLYGLAIDNKAPKIFAVTNRWGVPYYSLLMS 437
           IK LPHI NAC+L   +S+ NS ++ ASR+L  +A D  AP+I    NR GVPYY++ +S
Sbjct: 401 IKVLPHIINACILSSAWSSGNSFMFAASRSLLSMAEDGNAPRILGRINRQGVPYYAVALS 460

Query: 438 SCFCLLAYMSVSSGSAKIFNYFVNVVSIFGLLSWISILITYLCFFRAVKAQNVDRSRFAY 497
           + F  LA+++VSSGSAK F +F N+ +I G + WI I + YL F +AV  + +   R  +
Sbjct: 461 AAFSCLAFLNVSSGSAKAFTWFSNISTISGFIGWICIGVAYLQFRKAVFFRGL-YERVPF 519

Query: 498 RAPFQPYGSYFTLAFCILIAFIKNFTVFLNHHFDYKNFITGYIGIPVFVISYFGYKFVKK 557
           ++P QPYG+YF +    LI     +  F+N  ++  +F+  YI +P+FV+ + G+K   +
Sbjct: 520 KSPLQPYGTYFFIVVVSLICLTNGYASFVN--WNASDFVAAYITLPIFVVLWVGHKIYTR 577

Query: 558 T-KIW--KPEEVDLYTFKAAIDEEEEQGKIADAER 589
           T   W     EVD+ T    + E EE+ KI DA+R
Sbjct: 578 TWSTWLLPVAEVDVTT---GLAEIEEETKILDAQR 609

>TPHA0B04480 Chr2 (1050173..1051984) [1812 bp, 603 aa] {ON} Anc_1.83
           YEL063C
          Length = 603

 Score =  334 bits (856), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 187/501 (37%), Positives = 288/501 (57%), Gaps = 9/501 (1%)

Query: 78  DGKDEHTRLRKDLKARHISMIAXXXXXXXXXXXXXXXXXYTAGPMSMFIAYAFVGVLVFF 137
           +G  +   +++ LK RHI MIA                   AGP+   IAY F+  +VF 
Sbjct: 89  EGVVKEAEVKRQLKQRHIGMIALGGTIGTGLFIGIATPLGNAGPVGALIAYLFMATIVFS 148

Query: 138 TMAALGEMASYIPL-DGFTSYASRYCDPALGFAVGYAYLCKYLILPPNQLTAAALVIQYW 196
              +LGEMA++IP+   FT ++SR+  PA+G A GY Y   + +    +L+    +IQ+W
Sbjct: 149 VTQSLGEMATFIPVTSSFTVFSSRFLSPAIGAANGYMYWFSWAVTFALELSVVGQIIQFW 208

Query: 197 LDREQVNPGVWITIFLVIIVAMNFIGVKFFGEFEFWLSTFKVIVMIGLIILLFVIMLGGG 256
                V    WI I+ VI+  MN   VKF+GEFEFW+++ KV+ +IG +I    ++ G G
Sbjct: 209 --THAVPLSAWIVIWWVILTIMNLFPVKFYGEFEFWVASIKVLAIIGFLIYCLCMVCGAG 266

Query: 257 PTHDRLGFRFYDHPGAFKPYSKSIDGSKGKXXXXXXXXXXXXXXXXGIELTGIVAAEAAN 316
            T   +GFR++ +PG + P   S D ++G+                G EL GI A EAAN
Sbjct: 267 VTGP-VGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLINAAFTYQGTELVGITAGEAAN 325

Query: 317 PRKSIPKAIKLTMYRIIVFYLVTIFLLGMCVAYDDPLLXXXXXXXXXXXXXPYVVAIINS 376
           PRK++P+AIK   +RI++FY++++F +G+ V YDD  L             P+++AI NS
Sbjct: 326 PRKTVPRAIKKVTFRILIFYILSLFFIGLLVPYDDEKLTSTDSYISAS---PFIIAIENS 382

Query: 377 GIKALPHIFNACVLMFVFSACNSDLYVASRTLYGLAIDNKAPKIFAVTNRWGVPYYSLLM 436
           G K LPHIFNA +L  + SA NS++YV SR L+GLA    APK F  T+R GVPYYS+  
Sbjct: 383 GTKILPHIFNAVILSTIISAGNSNVYVGSRILFGLAKTKLAPKWFGYTSRGGVPYYSVFF 442

Query: 437 SSCFCLLAYMSVSSGSAKIFNYFVNVVSIFGLLSWISILITYLCFFRAVKAQNVDRSRFA 496
           +S F  LA++ VSSG AK FN+ +N++S+ G  +W+ I I ++ F +A+K + + R    
Sbjct: 443 TSSFGALAFLEVSSGGAKAFNWLLNIISVAGFFAWLLISIAHVRFMQALKHRGISRDDLP 502

Query: 497 YRAPFQPYGSYFTLAFCILIAFIKNFTVFLNHHFDYKNFITGYIGIPVFVISYFGYKFVK 556
           ++A F P+ +Y+++ F  +I  I+ FT F    F+  +F+  YI I +F   +  ++   
Sbjct: 503 FKARFMPHLAYYSIFFMTIIIIIQGFTAFA-PTFNGSDFVAAYISIFLFFFLWLCFQLYF 561

Query: 557 KTK-IWKPEEVDLYTFKAAID 576
           ++K +W  EEVD+ T +  +D
Sbjct: 562 RSKLLWTVEEVDIDTDRRDVD 582

>Skud_5.26 Chr5 complement(30850..32622) [1773 bp, 590 aa] {ON}
           YEL063C (REAL)
          Length = 590

 Score =  333 bits (855), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 186/518 (35%), Positives = 294/518 (56%), Gaps = 17/518 (3%)

Query: 53  INDMDNLSTVSSRLEDSEKQDDYMDDGKDEHTRLRKDLKARHISMIAXXXXXXXXXXXXX 112
           +N  D  S       +   QD+  D+G+ ++  ++++LK RHI MIA             
Sbjct: 59  VNGQDTFSM------EENLQDE--DEGEVQNAEVKRELKQRHIGMIALGGTIGTGLFIGL 110

Query: 113 XXXXYTAGPMSMFIAYAFVGVLVFFTMAALGEMASYIPL-DGFTSYASRYCDPALGFAVG 171
                 AGP+   IAY F+G L F    +LGEMA++IP+   FT ++ R+  PA G A G
Sbjct: 111 STPLANAGPVGALIAYLFMGSLAFSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANG 170

Query: 172 YAYLCKYLILPPNQLTAAALVIQYWLDREQVNPGVWITIFLVIIVAMNFIGVKFFGEFEF 231
           Y Y   + I    +L+    VIQ+W  +  V    WI+IF V+I  MN   VK++GEFEF
Sbjct: 171 YMYWFSWAITFALELSVVGQVIQFWTHK--VPLAAWISIFWVLITIMNLFPVKYYGEFEF 228

Query: 232 WLSTFKVIVMIGLIILLFVIMLGGGPTHDRLGFRFYDHPGAFKPYSKSIDGSKGKXXXXX 291
           W+++ KVI +IG +I  F ++ G G T   +GFR++ +PGA+ P   S + ++G+     
Sbjct: 229 WVASIKVIAIIGFLIYCFCMVCGAGVTGP-VGFRYWRNPGAWGPGIISKNKNEGRFLGWV 287

Query: 292 XXXXXXXXXXXGIELTGIVAAEAANPRKSIPKAIKLTMYRIIVFYLVTIFLLGMCVAYDD 351
                      G EL GI A EAANPRK++P+AIK  ++RI+ FY+ ++  +G+ V Y+D
Sbjct: 288 SSLINAAFTFQGTELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYND 347

Query: 352 PLLXXXXXXXXXXXXXPYVVAIINSGIKALPHIFNACVLMFVFSACNSDLYVASRTLYGL 411
           P L             P++VAI NSG K LPHIFNA +L  + SA NS++YV SR L+GL
Sbjct: 348 PKLTEATSYVSTS---PFIVAIQNSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGL 404

Query: 412 AIDNKAPKIFAVTNRWGVPYYSLLMSSCFCLLAYMSVSSGSAKIFNYFVNVVSIFGLLSW 471
           + +  APK  + T++ GVPY ++  ++ F  LAYM  S+G  K+F + +N+  + G  +W
Sbjct: 405 SKNKLAPKFLSRTSKGGVPYIAVFATAVFGALAYMETSTGGDKVFEWLLNITGVAGFFAW 464

Query: 472 ISILITYLCFFRAVKAQNVDRSRFAYRAPFQPYGSYFTLAFCILIAFIKNFTVFLNHHFD 531
           + I I+++ F +A+K + + R    ++A   P  +Y++  F I+I  I+ FT F    F+
Sbjct: 465 LFISISHIRFMQALKYRGISRDELPFKAKLMPGLAYYSSFFMIIIIIIQGFTAF-APKFN 523

Query: 532 YKNFITGYIGIPVFVISYFGYKFVKKTK-IWKPEEVDL 568
             +F+  YI I +F+  +  ++ + + + IWK E+VD+
Sbjct: 524 GSSFLAAYISIFLFIAVWILFECIFRCRFIWKIEDVDI 561

>Kpol_2000.64 s2000 complement(130912..132744) [1833 bp, 610 aa]
           {ON} complement(130912..132744) [1833 nt, 611 aa]
          Length = 610

 Score =  334 bits (856), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 186/546 (34%), Positives = 301/546 (55%), Gaps = 25/546 (4%)

Query: 63  SSRLEDSEKQDDYMDDGKDEHTRLRKDLKARHISMIAXXXXXXXXXXXXXXXXXYTAGPM 122
           ++ L D E+ D   ++ + + TR+++ LK RHI MIA                   AGP+
Sbjct: 83  TTSLHDDEESD--TEEAQYQDTRVKRALKQRHIGMIALGGTIGTGLFVGIATPLSNAGPV 140

Query: 123 SMFIAYAFVGVLVFFTMAALGEMASYIPL-DGFTSYASRYCDPALGFAVGYAYLCKYLIL 181
              IAY F+G +V+F   +LGEMA++IP+    T ++ R+  PA G A GY Y   + I 
Sbjct: 141 GSLIAYIFMGSVVYFVTQSLGEMATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAIT 200

Query: 182 PPNQLTAAALVIQYWLDREQVNPGVWITIFLVIIVAMNFIGVKFFGEFEFWLSTFKVIVM 241
              +++    VIQYW   + V    WI IF VI+  MNF  VK +GEFEFW+++ KV+ +
Sbjct: 201 YAVEISVIGQVIQYW--TKAVPLAAWIGIFWVIVTLMNFFPVKVYGEFEFWIASIKVLAI 258

Query: 242 IGLIILLFVIMLGG---GPTHDRLGFRFYDHPGAFKPYSKSIDGSKGKXXXXXXXXXXXX 298
           +G +I   +I+ GG   GP    +GFR++ +PG + P   S    + +            
Sbjct: 259 MGYLIYALIIVCGGSHQGP----IGFRYWRNPGPWGPGIISDKTGEARFLGWVSSLINAA 314

Query: 299 XXXXGIELTGIVAAEAANPRKSIPKAIKLTMYRIIVFYLVTIFLLGMCVAYDDPLLXXXX 358
               G EL GI A EAANPRKS+P+AI   ++RI +FY++++F +G+ V ++D  L    
Sbjct: 315 FTYQGTELVGITAGEAANPRKSVPRAINKVVFRIALFYIMSLFFIGLLVPFNDDRLANDS 374

Query: 359 XXXXXXXXXPYVVAIINSGIKALPHIFNACVLMFVFSACNSDLYVASRTLYGLAIDNKAP 418
                    P+V++I N+G +ALP IFNA VL+ + SA NS++YV SR LY LA+   AP
Sbjct: 375 AVIASS---PFVISIQNAGTRALPDIFNAVVLLTIISAANSNVYVGSRVLYALALTGNAP 431

Query: 419 KIFAVTNRWGVPYYSLLMSSCFCLLAYMSVSSGSAKIFNYFVNVVSIFGLLSWISILITY 478
           KIF+   ++GVPY  ++ ++   LLA++ V++ +   FN+ +N+ ++ GL +W+ I +++
Sbjct: 432 KIFSYVTKYGVPYMGVICTAALGLLAFLVVNNNANTAFNWLINISTLAGLCAWLFISLSH 491

Query: 479 LCFFRAVKAQNVDRSRFAYRAPFQPYGSYFTLAFCILIAFIKNFTVFLNHHFDYKNFITG 538
           + F +A+K + + R    ++A   P+G+Y+   F  +I FI+ F  F    FD   F T 
Sbjct: 492 IRFMQALKYRGISRDDLPFKAKLMPWGAYYASFFVTVIIFIQGFQAF-TPKFDVSTFFTS 550

Query: 539 YIGIPVFVISYFGYKFVKKTK-IWKPEEVDLYTFKAAIDEEEEQGKIADAERRERLKNSK 597
           YI + +  + + G +   + + IWK E++D+ +     D  E +  I +    +  KN  
Sbjct: 551 YISLILLAVLFSGCQLYYRCRFIWKVEDIDIDS-----DRREIEAIIWE---EDEPKNLW 602

Query: 598 TKGWDW 603
            K W W
Sbjct: 603 EKFWAW 608

>SAKL0C02684g Chr3 complement(251988..253754) [1767 bp, 588 aa] {ON}
           similar to uniprot|P04817 Saccharomyces cerevisiae
           YEL063C CAN1 Plasma membrane arginine permease requires
           phosphatidyl ethanolamine (PE) for localization
           exclusively associated with lipid rafts mutation confers
           canavanine resistance
          Length = 588

 Score =  333 bits (854), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 180/514 (35%), Positives = 286/514 (55%), Gaps = 13/514 (2%)

Query: 52  DINDMDNLSTVSSRLEDSEKQD-----DYMDDGKDEHTRLRKDLKARHISMIAXXXXXXX 106
           D    D  + V S++            DYMD+G  +   +++ LK RHISMIA       
Sbjct: 43  DTKSTDEKTRVVSQVSPMRTGSPNVSIDYMDEGNVQDAEVKRALKPRHISMIALGGTIGT 102

Query: 107 XXXXXXXXXXYTAGPMSMFIAYAFVGVLVFFTMAALGEMASYIPL-DGFTSYASRYCDPA 165
                       AGP+   IAY F+G + +F   +LGEMA++IP+   FT +  R+  PA
Sbjct: 103 GLFIGISSPLADAGPVGALIAYMFMGTIAYFVTQSLGEMATFIPVTSSFTVFTQRFLSPA 162

Query: 166 LGFAVGYAYLCKYLILPPNQLTAAALVIQYWLDREQVNPGVWITIFLVIIVAMNFIGVKF 225
            G A GY Y   + I    +L+    +IQ+W     V  G WI IF VI+   N   VK+
Sbjct: 163 FGVANGYLYWFSWCITFALELSVVGQIIQFW--TFAVPLGAWIAIFWVILTTSNLFPVKY 220

Query: 226 FGEFEFWLSTFKVIVMIGLIILLFVIMLGGGPTHDRLGFRFYDHPGAFKPYSKSIDGSKG 285
           +GE EFW++  KV+ ++G II  F+++ G G T   +GFR++ +PG + P   S D ++G
Sbjct: 221 YGEVEFWIACIKVLAIVGFIIYAFIMVCGAGKTGP-VGFRYWRNPGPWGPGIISKDVNEG 279

Query: 286 KXXXXXXXXXXXXXXXXGIELTGIVAAEAANPRKSIPKAIKLTMYRIIVFYLVTIFLLGM 345
           +                G EL GI A E+ NPR+++P+AI    +RI+ FY++++  +G+
Sbjct: 280 RFLGWVSSLINAAFTYQGTELVGITAGESKNPRRTVPRAINKVFFRILFFYILSLLFIGL 339

Query: 346 CVAYDDPLLXXXXXXXXXXXXXPYVVAIINSGIKALPHIFNACVLMFVFSACNSDLYVAS 405
            V ++DP L             P+V+AI NSG K LPHIFNA +L  + SA NS++YV S
Sbjct: 340 LVPFNDPKLKSEDSYISSS---PFVIAIENSGTKVLPHIFNAVILSTIISAGNSNIYVGS 396

Query: 406 RTLYGLAIDNKAPKIFAVTNRWGVPYYSLLMSSCFCLLAYMSVSSGSAKIFNYFVNVVSI 465
           R LYGLA +  APK+FA   + GVPY S+L ++ F  LAY+++S+ + K+F++ +N+ +I
Sbjct: 397 RVLYGLAKNKLAPKVFARATKDGVPYISVLGTAAFGFLAYLNLSNSAQKVFDWLLNITAI 456

Query: 466 FGLLSWISILITYLCFFRAVKAQNVDRSRFAYRAPFQPYGSYFTLAFCILIAFIKNFTVF 525
            G  +W+ I + ++ F + +K +N+ R+   ++A F P+G+Y++  F  LI  I+ FT F
Sbjct: 457 AGFFAWLFISLAHIRFMQVLKDRNMSRNDLPFKAKFMPWGAYYSAFFISLIIIIQGFTAF 516

Query: 526 LNHHFDYKNFITGYIGIPVFVISYFGYKFVKKTK 559
               F+  NF   YI + +F+  +  ++   +T+
Sbjct: 517 A-PKFNVSNFFAAYISVFLFLAIWVVFQIRFRTR 549

>YNL270C Chr14 complement(135940..137661) [1722 bp, 573 aa] {ON}
           ALP1Arginine transporter; expression is normally very
           low and it is unclear what conditions would induce
           significant expression
          Length = 573

 Score =  333 bits (853), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 178/519 (34%), Positives = 290/519 (55%), Gaps = 10/519 (1%)

Query: 61  TVSSRLEDSEKQDDYMDDGKDEHTRLRKDLKARHISMIAXXXXXXXXXXXXXXXXXYTAG 120
           T   ++ED   ++   +    E   +++ LK RHI MIA                   AG
Sbjct: 43  TTERKVEDDAAKET--ESSPQERREVKRKLKQRHIGMIALGGTIGTGLIIGIGPPLAHAG 100

Query: 121 PMSMFIAYAFVGVLVFFTMAALGEMASYIPL-DGFTSYASRYCDPALGFAVGYAYLCKYL 179
           P+   I+Y F+G +++    +LGEM ++IP+   F+ +A R+  PALG   GY Y   + 
Sbjct: 101 PVGALISYLFMGTVIYSVTQSLGEMVTFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWC 160

Query: 180 ILPPNQLTAAALVIQYWLDREQVNPGVWITIFLVIIVAMNFIGVKFFGEFEFWLSTFKVI 239
                +L+    VIQYW   E V    WI IF  ++ +MN   VK++GEFEF +++ KVI
Sbjct: 161 FTFALELSVLGKVIQYW--TEAVPLAAWIVIFWCLLTSMNMFPVKYYGEFEFCIASIKVI 218

Query: 240 VMIGLIILLFVIMLGGGPTHDRLGFRFYDHPGAFKPYSKSIDGSKGKXXXXXXXXXXXXX 299
            ++G II  F ++ G G +   +GFR++ +PGA+ P   S D ++G+             
Sbjct: 219 ALLGFIIFSFCVVCGAGQSDGPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAF 278

Query: 300 XXXGIELTGIVAAEAANPRKSIPKAIKLTMYRIIVFYLVTIFLLGMCVAYDDPLLXXXXX 359
              G EL GI A EAANPRK++P+AIK  + RI+VFY++++F +G+ V Y+DP L     
Sbjct: 279 TYQGTELVGITAGEAANPRKALPRAIKKVVVRILVFYILSLFFIGLLVPYNDPKLDSDGI 338

Query: 360 XXXXXXXXPYVVAIINSGIKALPHIFNACVLMFVFSACNSDLYVASRTLYGLAIDNKAPK 419
                   P++++I NSG K LP IFNA VL+ + SA NS++Y+ SR LY L+ ++ AP+
Sbjct: 339 FVSSS---PFMISIENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPR 395

Query: 420 IFAVTNRWGVPYYSLLMSSCFCLLAYMSVSSGSAKIFNYFVNVVSIFGLLSWISILITYL 479
             +   R GVPY+S+L +S F  LA++ VS+GS K FN+ +N+  + G  +W+ I  +++
Sbjct: 396 FLSNVTRGGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLLISFSHI 455

Query: 480 CFFRAVKAQNVDRSRFAYRAPFQPYGSYFTLAFCILIAFIKNFTVFLNHHFDYKNFITGY 539
            F +A++ + + R    Y+A   P+ +Y+   F  LI  I+ FT F    F   +F+  Y
Sbjct: 456 RFMQAIRKRGISRDDLPYKAQMMPFLAYYASFFIALIVLIQGFTAF-APTFQPIDFVAAY 514

Query: 540 IGIPVFVISYFGYKFVKKTK-IWKPEEVDLYTFKAAIDE 577
           I I +F+  +  ++   K + +WK +++D+ + +  I+E
Sbjct: 515 ISIFLFLAIWLSFQVWFKCRLLWKLQDIDIDSDRRQIEE 553

>Smik_15.532 Chr15 complement(932437..934332) [1896 bp, 631 aa] {ON}
           YOR348C (REAL)
          Length = 631

 Score =  334 bits (857), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 188/556 (33%), Positives = 302/556 (54%), Gaps = 27/556 (4%)

Query: 46  DKKDGLDINDMDNLSTVSSRLEDSEKQDDYMD---------DGKDEHTRLRKDLKARHIS 96
           +K D + +  +    + SS    + ++D  MD         +G +E  +L++ L++RH+ 
Sbjct: 63  EKDDAIRMEKISKNHSASS--NGTIREDLIMDVDVEKSPSVEGDNEPHKLKQGLQSRHVQ 120

Query: 97  MIAXXXXXXXXXXXXXXXXXYTAGPMSMFIAYAFVGVLVFFTMAALGEMASYIPLDGFTS 156
           +IA                 +T GP  +FI+Y  +  +++  M ALGEM  ++P DG  S
Sbjct: 121 LIALGGAIGTGLLVGTSSTLHTCGPAGLFISYIIISAVIYPIMCALGEMVCFLPGDGSDS 180

Query: 157 YAS------RYCDPALGFAVGYAYLCKYLILPPNQLTAAALVIQYWLDREQVNPGVWITI 210
             S      RY D +LGFA G+ Y   Y+IL   + TAA+ V++YW     V  GVWITI
Sbjct: 181 AGSTANLVTRYVDASLGFATGWNYFYCYVILVAAECTAASGVVEYW--TTAVPKGVWITI 238

Query: 211 FLVIIVAMNFIGVKFFGEFEFWLSTFKVIVMIGLIILLFVIMLGGGPTHDRLGFRFYDHP 270
           FL ++V +N   VK +GE EFW ++ K++ ++GLIIL F++  GGGP HDRLGFR++ HP
Sbjct: 239 FLCVVVLLNLSAVKVYGESEFWFASIKILCIVGLIILSFILFWGGGPNHDRLGFRYWQHP 298

Query: 271 GAFKPYSKSIDGSKGKXXXXXXXXXXXXXX-XXGIELTGIVAAEAANPRKSIPKAIKLTM 329
           GAF  +     GS G                  G EL  + +AE A+ R++I KA +  +
Sbjct: 299 GAFAHHLTG--GSLGNFTDIYTGIIKGAFAFILGPELVCMTSAECADQRRNISKASRRFV 356

Query: 330 YRIIVFYLVTIFLLGMCVAYDDP-LLXXXXXXXXXXXXXPYVVAIINSGIKALPHIFNAC 388
           +R+I FY++    + + V Y+DP L+             P+V+ I N+GIK LPHI N C
Sbjct: 357 WRLIFFYVLGTLAISVIVPYNDPSLVNALAQGKPGAGSSPFVIGIQNAGIKVLPHIINGC 416

Query: 389 VLMFVFSACNSDLYVASRTLYGLAIDNKAPKIFAVTNRWGVPYYSLLMSSCFCLLAYMSV 448
           +L   +SA N+ ++ ++R+L  +A   +APK     NRWGVPY ++ +S     LAY++V
Sbjct: 417 ILSSAWSAANAFMFASTRSLLTMAQTGQAPKCLGRINRWGVPYVAVGVSFLCSCLAYLNV 476

Query: 449 SSGSAKIFNYFVNVVSIFGLLSWISILITYLCFFRAVKAQNVDRSRFAYRAPFQPYGSYF 508
           SS +A +FN+F N+ +I G L W+   I YL F +A+    +   R  ++   QPY  + 
Sbjct: 477 SSSTADVFNWFSNISTISGFLGWMCGCIAYLRFRKAIFYNGL-FDRLPFKTWGQPYTVWA 535

Query: 509 TLAFCILIAFIKNFTVFLNHHFDYKNFITGYIGIPVFVISYFGYKFVKKT--KIWKP-EE 565
           +L    +I     + +F+  ++   +FI  YI +P+F++ +FG+K   +T  + W P  E
Sbjct: 536 SLIVVGIITLTNGYAIFIPKYWKIADFIAAYITLPIFLVLWFGHKLYTRTWSQWWLPVSE 595

Query: 566 VDLYTFKAAIDEEEEQ 581
           +D+ T    I+E+  +
Sbjct: 596 IDVTTGLIEIEEKSRE 611

>Suva_14.75 Chr14 (133164..134999) [1836 bp, 611 aa] {ON} YEL063C
           (REAL)
          Length = 611

 Score =  334 bits (856), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 195/547 (35%), Positives = 301/547 (55%), Gaps = 21/547 (3%)

Query: 47  KKDGL-------DINDMDNLSTVSSRLEDSEKQDDYMDDGKDEHTRLRKDLKARHISMIA 99
           KK GL       DIN + N  T S      +  DD  ++   E   +R+ LK RHI MIA
Sbjct: 60  KKSGLMLDGTIGDINSITNSLTRSQIASHEQGGDDEEEEAHYEDKHVRRALKQRHIGMIA 119

Query: 100 XXXXXXXXXXXXXXXXXYTAGPMSMFIAYAFVGVLVFFTMAALGEMASYIPL-DGFTSYA 158
                              AGP+   IAY F+G +V+F   +LGEMA++IP+    T ++
Sbjct: 120 LGGTIGTGLFVGISTPLSNAGPVGSLIAYIFMGTVVYFVTQSLGEMATFIPVTSSITVFS 179

Query: 159 SRYCDPALGFAVGYAYLCKYLILPPNQLTAAALVIQYWLDREQVNPGVWITIFLVIIVAM 218
            R+  PA G + GY Y   + I    +++    VI+YW  +  V  GVWI IF V+I  M
Sbjct: 180 KRFLSPAFGVSNGYMYWFNWAITYAVEVSVIGQVIEYWTTK--VPLGVWIAIFWVLITLM 237

Query: 219 NFIGVKFFGEFEFWLSTFKVIVMIGLIILLFVIMLGGGPTHDRLGFRFYDHPGAFKPYSK 278
           NF  VK +GEFEFW+++ KV+ ++G +I   VI+ GG      +GFR++ +PGA+ P   
Sbjct: 238 NFFPVKVYGEFEFWVASVKVLAIMGYLIYALVIVCGGS-KQGPIGFRYWRNPGAWGPGII 296

Query: 279 SIDGSKGKXXXXXXXXXXXXXXXXGIELTGIVAAEAANPRKSIPKAIKLTMYRIIVFYLV 338
           S D ++G+                G EL GI A EAANPRK++P+AI   ++RI++FY++
Sbjct: 297 SSDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVPRAINKVVFRIVLFYIM 356

Query: 339 TIFLLGMCVAYDDPLLXXXXXXXXXXXXXPYVVAIINSGIKALPHIFNACVLMFVFSACN 398
           ++F +G+ V Y DP L             P+V++I N+G  ALP IFNA VL+ V SA N
Sbjct: 357 SLFFIGLLVPYTDPRLSASSAVIASS---PFVISIQNAGTYALPDIFNAIVLITVISAAN 413

Query: 399 SDLYVASRTLYGLAIDNKAPKIFAVTNRWGVPYYSLLMSSCFCLLAYMSVSSGSAKIFNY 458
           S++YV SR LY LA    APK F    + GVPY  +L ++   LLA++ V++ +   FN+
Sbjct: 414 SNVYVGSRVLYSLAQTGNAPKQFGYVTKQGVPYLGVLSTAALGLLAFLVVNNNANTAFNW 473

Query: 459 FVNVVSIFGLLSWISILITYLCFFRAVKAQNVDRSRFAYRAPFQPYGSYFTLAFCILIAF 518
            +N+ ++ GL +W+ I ++++ F +A+  + + R    ++A F PYG+Y+   F  +I F
Sbjct: 474 LINISTLAGLCAWLFISLSHIRFMQALNQRGISRDDLPFKAKFMPYGAYYASFFVTVIIF 533

Query: 519 IKNFTVFLNHHFDYKNFITGYIGIPVFVISYFGYKFVKKTK-IWKPEEVDLYT----FKA 573
           I+ F  F    F   +F T YI + +  + + G +   K + IWK E++D+ +     +A
Sbjct: 534 IQGFQSFC--PFRVADFFTSYISLILLAVVFTGCQLYYKCRFIWKLEDIDIDSDRREIEA 591

Query: 574 AIDEEEE 580
            I E++E
Sbjct: 592 IIWEDDE 598

>SAKL0C02640g Chr3 complement(247651..249297) [1647 bp, 548 aa] {ON}
           highly similar to uniprot|Q875R1 Saccharomyces kluyveri
           CAN1 and similar to YEL063C uniprot|P04817 Saccharomyces
           cerevisiae YEL063C CAN1 Plasma membrane arginine
           permease requires phosphatidyl ethanolamine (PE) for
           localization exclusively associated with lipid rafts
           mutation confers canavanine resistance
          Length = 548

 Score =  331 bits (848), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 178/510 (34%), Positives = 286/510 (56%), Gaps = 12/510 (2%)

Query: 79  GKDEHTRLRKDLKARHISMIAXXXXXXXXXXXXXXXXXYTAGPMSMFIAYAFVGVLVFFT 138
           G  + T++++ LK RHISMIA                   AGP+   IAY F+G L +  
Sbjct: 35  GSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYMV 94

Query: 139 MAALGEMASYIPL-DGFTSYASRYCDPALGFAVGYAYLCKYLILPPNQLTAAALVIQYWL 197
             +LGEMA++IP+   F  +  R+  PALG A GY Y   + I    +L+    VIQ+W 
Sbjct: 95  SQSLGEMATFIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSVVGQVIQFWT 154

Query: 198 DREQVNPGVWITIFLVIIVAMNFIGVKFFGEFEFWLSTFKVIVMIGLIILLFVIMLGGGP 257
           D   +    WI I  V++V+ N   VKF+GE EFW++  KV+ ++G II  F+++ G G 
Sbjct: 155 DAVPLT--AWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAFIMVCGAGK 212

Query: 258 THDRLGFRFYDHPGAFKPYSKSIDGSKGKXXXXXXXXXXXXXXXXGIELTGIVAAEAANP 317
           T   +GFR++ +PG + P   S D ++G+                G EL GI A EAANP
Sbjct: 213 TGP-VGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANP 271

Query: 318 RKSIPKAIKLTMYRIIVFYLVTIFLLGMCVAYDDPLLXXXXXXXXXXXXXPYVVAIINSG 377
           RK++P+AI    +RI+ FY++++  +G+ V ++DP L             P+V+AI NSG
Sbjct: 272 RKTVPRAINKVFFRILFFYILSLLFIGLLVPFNDPKLKSEDSYISSS---PFVIAIENSG 328

Query: 378 IKALPHIFNACVLMFVFSACNSDLYVASRTLYGLAIDNKAPKIFAVTNRWGVPYYSLLMS 437
            K LPHIFNA +L  + SA NSD+Y++SR LY + ++  APK    T + G+PY ++L +
Sbjct: 329 TKVLPHIFNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYAAVLTT 388

Query: 438 SCFCLLAYMSVSSGSAKIFNYFVNVVSIFGLLSWISILITYLCFFRAVKAQNVDRSRFAY 497
           S    LAY+  S G++ +F++ +N+ ++ G  +W+ I + ++ F +A+K Q + R    +
Sbjct: 389 SLVGFLAYLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISRDDLPF 448

Query: 498 RAPFQPYGSYFTLAFCILIAFIKNFTVFLNHHFDYKNFITGYIGIPVFVISYFGYKFVKK 557
           +A F P+G+Y+   F  +I  I+ FT F    F+  +F T Y+ + +F   + G++   +
Sbjct: 449 KAKFMPWGAYYAAFFIGVIIIIQGFTAF-APKFNVSDFFTAYVSVILFFAVWIGFQIWFR 507

Query: 558 TKIW-KPEEVDLYTFKAAIDE---EEEQGK 583
             ++ K E++DL T +  ID    EE++ K
Sbjct: 508 GPLFKKTEDIDLDTDRREIDNDVWEEDEPK 537

>YEL063C Chr5 complement(31694..33466) [1773 bp, 590 aa] {ON}
           CAN1Plasma membrane arginine permease, requires
           phosphatidyl ethanolamine (PE) for localization,
           exclusively associated with lipid rafts; mutation
           confers canavanine resistance
          Length = 590

 Score =  332 bits (852), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 181/507 (35%), Positives = 288/507 (56%), Gaps = 12/507 (2%)

Query: 67  EDSEKQDDYM---DDGKDEHTRLRKDLKARHISMIAXXXXXXXXXXXXXXXXXYTAGPMS 123
           ED+   +D +   D+G+ ++  ++++LK RHI MIA                   AGP+ 
Sbjct: 62  EDTFSMEDGIGDEDEGEVQNAEVKRELKQRHIGMIALGGTIGTGLFIGLSTPLTNAGPVG 121

Query: 124 MFIAYAFVGVLVFFTMAALGEMASYIPL-DGFTSYASRYCDPALGFAVGYAYLCKYLILP 182
             I+Y F+G L +    +LGEMA++IP+   FT ++ R+  PA G A GY Y   + I  
Sbjct: 122 ALISYLFMGSLAYSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITF 181

Query: 183 PNQLTAAALVIQYWLDREQVNPGVWITIFLVIIVAMNFIGVKFFGEFEFWLSTFKVIVMI 242
             +L+    VIQ+W    +V    WI+IF VII  MN   VK++GEFEFW+++ KV+ +I
Sbjct: 182 ALELSVVGQVIQFW--TYKVPLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAII 239

Query: 243 GLIILLFVIMLGGGPTHDRLGFRFYDHPGAFKPYSKSIDGSKGKXXXXXXXXXXXXXXXX 302
           G +I  F ++ G G T   +GFR++ +PGA+ P   S D ++G+                
Sbjct: 240 GFLIYCFCMVCGAGVTGP-VGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQ 298

Query: 303 GIELTGIVAAEAANPRKSIPKAIKLTMYRIIVFYLVTIFLLGMCVAYDDPLLXXXXXXXX 362
           G EL GI A EAANPRKS+P+AIK  ++RI+ FY+ ++  +G+ V Y+DP L        
Sbjct: 299 GTELVGITAGEAANPRKSVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQSTSYVS 358

Query: 363 XXXXXPYVVAIINSGIKALPHIFNACVLMFVFSACNSDLYVASRTLYGLAIDNKAPKIFA 422
                P+++AI NSG K LPHIFNA +L  + SA NS++YV SR L+GL+ +  APK  +
Sbjct: 359 TS---PFIIAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLS 415

Query: 423 VTNRWGVPYYSLLMSSCFCLLAYMSVSSGSAKIFNYFVNVVSIFGLLSWISILITYLCFF 482
            T + GVPY ++ +++ F  LAYM  S+G  K+F + +N+  + G  +W+ I I+++ F 
Sbjct: 416 RTTKGGVPYIAVFVTAAFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFM 475

Query: 483 RAVKAQNVDRSRFAYRAPFQPYGSYFTLAFCILIAFIKNFTVFLNHHFDYKNFITGYIGI 542
           +A+K + + R    ++A   P  +Y+   F  +I  I+ FT F    F+  +F   YI I
Sbjct: 476 QALKYRGISRDELPFKAKLMPGLAYYAATFMTIIIIIQGFTAF-APKFNGVSFAAAYISI 534

Query: 543 PVFVISYFGYKFVKKTK-IWKPEEVDL 568
            +F+  +  ++ + + + IWK  +VD+
Sbjct: 535 FLFLAVWILFQCIFRCRFIWKIGDVDI 561

>TBLA0A05450 Chr1 complement(1345808..1347628) [1821 bp, 606 aa]
           {ON} Anc_1.83 YEL063C
          Length = 606

 Score =  332 bits (851), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 187/492 (38%), Positives = 274/492 (55%), Gaps = 9/492 (1%)

Query: 72  QDDYMDDGKDEHTRLRKDLKARHISMIAXXXXXXXXXXXXXXXXXYTAGPMSMFIAYAFV 131
           ++D    G  E  +++++LK RHI MIA                   AGP+   IAY F+
Sbjct: 88  EEDIDATGVVEEAQVKRELKPRHIGMIALGGTIGTGLFIGIATPIQNAGPVGSLIAYIFM 147

Query: 132 GVLVFFTMAALGEMASYIPL-DGFTSYASRYCDPALGFAVGYAYLCKYLILPPNQLTAAA 190
           G LVF    +LGEMA++IP+   FT +ASR+     G A GY Y   + I    +L+   
Sbjct: 148 GTLVFSVTQSLGEMATFIPVTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVVG 207

Query: 191 LVIQYWLDREQVNPGVWITIFLVIIVAMNFIGVKFFGEFEFWLSTFKVIVMIGLIILLFV 250
            VI++W  +  V    WI+IF V+IV MNF  VK +GEFEFW+++ KVI +IG II    
Sbjct: 208 QVIEFWTFK--VPLAAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLC 265

Query: 251 IMLGGGPTHDRLGFRFYDHPGAFKPYSKSIDGSKGKXXXXXXXXXXXXXXXXGIELTGIV 310
           ++ G G T   +GFR++ HPG + P   S D ++ +                G EL GI 
Sbjct: 266 MVCGAGITGP-VGFRYWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTYQGTELVGIT 324

Query: 311 AAEAANPRKSIPKAIKLTMYRIIVFYLVTIFLLGMCVAYDDPLLXXXXXXXXXXXXXPYV 370
           A EAANPRKS+P+AIK    RI++FY++++F +G+ V Y+DP L             P++
Sbjct: 325 AGEAANPRKSVPRAIKKVSVRILLFYILSLFFIGLLVPYNDPKLSSTDSYVSAS---PFI 381

Query: 371 VAIINSGIKALPHIFNACVLMFVFSACNSDLYVASRTLYGLAIDNKAPKIFAVTNRWGVP 430
           +AI NSG K LPHIFNA +L  + SA NS++YV SR LYGL+    APK F  T R GVP
Sbjct: 382 IAIQNSGTKVLPHIFNAVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQKT-RNGVP 440

Query: 431 YYSLLMSSCFCLLAYMSVSSGSAKIFNYFVNVVSIFGLLSWISILITYLCFFRAVKAQNV 490
           + ++L ++ F  LAYM  S+G    FN+ +N+  + G  +W+SI I+++ F + +K + +
Sbjct: 441 FIAVLFTAAFGALAYMETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGM 500

Query: 491 DRSRFAYRAPFQPYGSYFTLAFCILIAFIKNFTVFLNHHFDYKNFITGYIGIPVFVISYF 550
            R    Y+A   P  +Y+   F  LI  I+ FT F    FD   F+T YI   +F+  Y 
Sbjct: 501 SRDDLPYKAALMPGLAYYGAFFVTLIILIQGFTAF-APKFDSTAFLTAYISCFLFLFIYI 559

Query: 551 GYKFVKKTKIWK 562
             +   +T++W+
Sbjct: 560 VAQCYFRTRLWR 571

>Ecym_8035 Chr8 (81434..83125) [1692 bp, 563 aa] {ON} similar to
           Ashbya gossypii AFR156W
          Length = 563

 Score =  330 bits (845), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 184/534 (34%), Positives = 285/534 (53%), Gaps = 14/534 (2%)

Query: 46  DKKDGLDINDMDNLSTVSS-----RLEDSEKQDDYMDDGKDEHTRLRKDLKARHISMIAX 100
            K+  +   + + +  V S     R   S  +    D   D    L+K L  RHI +IA 
Sbjct: 6   KKEASVSKQEFNGMKEVKSNEETYRTSHSNLESQNSDVVSDYEHNLKKGLSNRHIQLIAL 65

Query: 101 XXXXXXXXXXXXXXXXYTAGPMSMFIAYAFVGVLVFFTMAALGEMASYIPLDG-FTSYAS 159
                              GP  +F+++  +  +V+  M  L EM  Y+P  G      +
Sbjct: 66  GGCIGTGLFVGTSSTLTQCGPAPLFLSFIIISTMVYCIMCTLAEMVCYLPQQGSVPELVT 125

Query: 160 RYCDPALGFAVGYAYLCKYLILPPNQLTAAALVIQYWLDREQVNPGVWITIFLVIIVAMN 219
           RY DP+LGFA G+ Y   Y +L   +LTAAA +++YW D  QV  GVWITIFL+++V +N
Sbjct: 126 RYVDPSLGFAAGWNYAYSYAMLVATELTAAAGIVRYWTD--QVPQGVWITIFLIVVVVLN 183

Query: 220 FIGVKFFGEFEFWLSTFKVIVMIGLIILLFVIMLGGGPTHDRLGFRFYDHPGAFKPYSKS 279
           F  V+F+GE EFW ++ K+I ++ L+++  VI  GG P HDR+GFR++ +PGAF  +   
Sbjct: 184 FSAVRFYGESEFWFASLKIICILALLVVSIVIFFGGAPNHDRVGFRYWRNPGAFGYHITG 243

Query: 280 IDGSKGKXXXX-XXXXXXXXXXXXGIELTGIVAAEAANPRKSIPKAIKLTMYRIIVFYLV 338
             G+ G+                   EL G+   EA + R++I KA +  +YRII FYL 
Sbjct: 244 --GNLGRFLDLWTAIIKSAFAFILSPELVGLACVEAKDTRRNIEKASRRFIYRIIFFYLS 301

Query: 339 TIFLLGMCVAYDD-PLLXXXXXXXXXXXXXPYVVAIINSGIKALPHIFNACVLMFVFSAC 397
           +  ++G+ VA +D  LL             P+V  I NSGI  L H+ N  +L   +SA 
Sbjct: 302 SSLMIGVIVAKNDHNLLLALEENRPGAASSPFVQGIANSGIPVLNHVINVAILTSAWSAG 361

Query: 398 NSDLYVASRTLYGLAIDNKAPKIFAVTNRWGVPYYSLLMSSCFCLLAYMSVSSGSAKIFN 457
           NS  Y +SR++  L+    APKIF+  NR+GVPY ++ + S    LAY++VSS S+K+F 
Sbjct: 362 NSFFYASSRSILALSKQGDAPKIFSKINRFGVPYNAVFLCSLVACLAYLNVSSTSSKVFQ 421

Query: 458 YFVNVVSIFGLLSWISILITYLCFFRAVKAQNVDRSRFAYRAPFQPYGSYFTLAFCILIA 517
           +  N+ +I G + W  I + Y+ F +A+    +   R  YR+P QP+ +YF      +I 
Sbjct: 422 WLSNICTISGFIGWFLIGVAYIRFRKAILFNRL-LDRIPYRSPLQPFSAYFFTIVVAIIT 480

Query: 518 FIKNFTVFLNHHFDYKNFITGYIGIPVFVISYFGYKFVKKTKIWKP-EEVDLYT 570
               + VF+   +DYK+F+T YI +P+F+  Y G+K + KT+   P +++D+ T
Sbjct: 481 LTNGYVVFIKGRWDYKDFLTSYISLPIFLAFYLGHKTIYKTRFCIPVDQIDVIT 534

>Suva_8.402 Chr8 complement(722727..724778) [2052 bp, 683 aa] {ON}
           YOR348C (REAL)
          Length = 683

 Score =  333 bits (854), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 190/568 (33%), Positives = 307/568 (54%), Gaps = 22/568 (3%)

Query: 46  DKKDGLDINDMDNLSTVSSR---LEDSEKQDDYMDDGKDEHTRLRKDLKARHISMIAXXX 102
           +K D + +  +    + SS     E+ + +     DG     RL++ L++RH+ +IA   
Sbjct: 119 EKDDAIRMEKISKNQSASSNGTVREELDLEKSPSADGDAGPHRLKQGLQSRHVQLIALGG 178

Query: 103 XXXXXXXXXXXXXXYTAGPMSMFIAYAFVGVLVFFTMAALGEMASYIPLDGFTSYAS--- 159
                         +T GP  +FI+Y  +  +++  M ALGEM  ++P DG  S  S   
Sbjct: 179 AIGTGLLVGTSSTLHTCGPAGLFISYIIISAVIYPIMCALGEMVCFLPGDGSDSAGSSAN 238

Query: 160 ---RYCDPALGFAVGYAYLCKYLILPPNQLTAAALVIQYWLDREQVNPGVWITIFLVIIV 216
              RY D +LGFA G+ Y   Y+IL   + TAA+ V++YW     V  GVWITIFL ++V
Sbjct: 239 LVTRYVDASLGFATGWNYYYCYVILVAAECTAASGVVEYW--TTAVPKGVWITIFLCVVV 296

Query: 217 AMNFIGVKFFGEFEFWLSTFKVIVMIGLIILLFVIMLGGGPTHDRLGFRFYDHPGAFKPY 276
            +NF  VK +GE EFW ++ K++ ++GLIIL F++  GGGP HDRLGFR++ HPG+F  +
Sbjct: 297 LLNFSAVKVYGESEFWFASIKILCIVGLIILSFILFWGGGPKHDRLGFRYWQHPGSFAHH 356

Query: 277 SKSIDGSKGKXXXXXXXXXXXXXX-XXGIELTGIVAAEAANPRKSIPKAIKLTMYRIIVF 335
                GS G                  G EL  + +AE A+ R++I KA +  ++R+I F
Sbjct: 357 LAG--GSLGNFTDIYTGIIKGAFAFILGPELVCMTSAECADQRRNIAKASRRFVWRLIFF 414

Query: 336 YLVTIFLLGMCVAYDDP-LLXXXXXXXXXXXXXPYVVAIINSGIKALPHIFNACVLMFVF 394
           Y++    + + V Y+DP L+             PYV+ I N+GIK LPHI N C+L   +
Sbjct: 415 YVLGTLAITVIVPYNDPSLVNALAQGKPGAGSSPYVIGIQNAGIKVLPHIINGCILTSAW 474

Query: 395 SACNSDLYVASRTLYGLAIDNKAPKIFAVTNRWGVPYYSLLMSSCFCLLAYMSVSSGSAK 454
           SA N+ ++ ++R+L  +A   +APK     NR+GVPY ++ +S     LAY++VSS +A 
Sbjct: 475 SAANAFMFASTRSLLTMAQTGQAPKCLGKINRFGVPYVAVGVSFLCSCLAYLNVSSSTAD 534

Query: 455 IFNYFVNVVSIFGLLSWISILITYLCFFRAVKAQNVDRSRFAYRAPFQPYGSYFTLAFCI 514
           +FN+F N+ +I G L WI   I YL F +A+    +   R  ++   QPY  +F+L    
Sbjct: 535 VFNWFSNISTISGFLGWICGCIAYLRFRKAIFFNGL-YDRLPFKTWGQPYTVWFSLTVVS 593

Query: 515 LIAFIKNFTVFLNHHFDYKNFITGYIGIPVFVISYFGYKFVKKT--KIWKP-EEVDLYTF 571
           +I     + +F+  +++  +FI  YI +P+F++ + G+K   +T    W    E+D+ T 
Sbjct: 594 IITITNGYAIFIPKYWNVADFIAAYITLPIFLVLWLGHKLYTRTWNHWWHSVSEIDVTTG 653

Query: 572 KAAIDEEE---EQGKIADAERRERLKNS 596
              I+E+    E+ ++  A  +E+  ++
Sbjct: 654 LVEIEEKSRDIEELRLPPATFKEKFMDA 681

>KAFR0D03940 Chr4 complement(767673..769466) [1794 bp, 597 aa] {ON}
           Anc_1.84 YNL268W
          Length = 597

 Score =  330 bits (847), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 184/546 (33%), Positives = 298/546 (54%), Gaps = 20/546 (3%)

Query: 54  NDMDNLSTVSSRLEDSEKQDDYMDDGKDEHTRLRKDLKARHISMIAXXXXXXXXXXXXXX 113
           +++ +L+   SR     + D+  ++   E  +++++LK RHI MIA              
Sbjct: 52  SELASLTHAYSRSRVEPEHDEDAEEADYEDKQVKRELKQRHIGMIALGGTIGTGLFVGIA 111

Query: 114 XXXYTAGPMSMFIAYAFVGVLVFFTMAALGEMASYIPL-DGFTSYASRYCDPALGFAVGY 172
                AGP+   IAY F+G +V+F   ALGEMA++IP+    T ++ R+  PA G A GY
Sbjct: 112 TPLADAGPVGALIAYIFMGSIVYFVTQALGEMATFIPVTSSITVFSQRFLSPAFGVANGY 171

Query: 173 AYLCKYLILPPNQLTAAALVIQYWLDREQVNPGVWITIFLVIIVAMNFIGVKFFGEFEFW 232
            Y   + I    +++    VIQYW D   V    WI IF V++  MNF  VK +GE EFW
Sbjct: 172 MYWFNWAITFAVEISVVGQVIQYWTD--AVPLAAWIAIFWVLVTLMNFFPVKVYGEVEFW 229

Query: 233 LSTFKVIVMIGLIILLFVIMLGGGPTHDRLGFRFYDHPGAFKPYSKSIDGS-------KG 285
           ++  KVI ++G ++   +I+ GG      +GFR++ +PGA+     S DG        +G
Sbjct: 230 VAFMKVIAIVGYLLYALIIVCGGSKKQGPIGFRYWRNPGAWGNGLTS-DGEPIYSSKYEG 288

Query: 286 KXXXXXXXXXXXXXXXXGIELTGIVAAEAANPRKSIPKAIKLTMYRIIVFYLVTIFLLGM 345
           +                G EL GI A EAANPRK++P+AI   ++RI++FY++++F +G+
Sbjct: 289 RFLGWVASLINAAFTYQGTELVGITAGEAANPRKTVPRAINKVVFRIVLFYIMSLFFIGL 348

Query: 346 CVAYDDPLLXXXXXXXXXXXXXPYVVAIINSGIKALPHIFNACVLMFVFSACNSDLYVAS 405
            V + D  L             P+V++I N+G K LP IFNA V++ V SA NS++YV S
Sbjct: 349 LVPFTDSRLSDDTTVIASS---PFVISIENAGTKILPDIFNAIVMVTVLSAANSNVYVGS 405

Query: 406 RTLYGLAIDNKAPKIFAVTNRWGVPYYSLLMSSCFCLLAYMSVSSGSAKIFNYFVNVVSI 465
           R LY LA    APKIFA   R GVP+  ++ +S   LLA++ V + +   FN+ V++ ++
Sbjct: 406 RVLYSLAHTKVAPKIFARVTRQGVPFMGVICTSLLGLLAFLVVDNNANTAFNWLVDISTL 465

Query: 466 FGLLSWISILITYLCFFRAVKAQNVDRSRFAYRAPFQPYGSYFTLAFCILIAFIKNFTVF 525
            GL +W+ I + ++ F + +K + + R    ++A F P+GSY+   +  +I F++ F  F
Sbjct: 466 AGLCAWLFISLAHVRFMQVLKQRGISRDDLPFKAKFMPWGSYYAAFWVFVIIFVQGFQAF 525

Query: 526 LNHHFDYKNFITGYIGIPVFVISYFGYKFVKKTK-IWKPEEVDLYTFKAAID----EEEE 580
            + HFD   F T YI + +  + + G +   + + +WK E+VD+ + +  I+    E++E
Sbjct: 526 -SPHFDVTTFFTDYISLILLAVVFIGAQLYYRCRFLWKLEDVDIDSDRREIEDAIWEDDE 584

Query: 581 QGKIAD 586
              I D
Sbjct: 585 PKTIWD 590

>Ecym_1088 Chr1 (184038..185741) [1704 bp, 567 aa] {ON} similar to
           Ashbya gossypii AFR667C
          Length = 567

 Score =  329 bits (844), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 178/526 (33%), Positives = 293/526 (55%), Gaps = 18/526 (3%)

Query: 67  EDSEKQDDYMDDGKDEHTRLRKDLKARHISMIAXXXXXXXXXXXXXXXXXYTAGPMSMFI 126
           E+ E++ DY        T +++ LKARHISMIA                  TAGP+   I
Sbjct: 47  EEHEQEGDY------HETEVKRALKARHISMIALGGTIGTGLFIVIASPLRTAGPVGSLI 100

Query: 127 AYAFVGVLVFFTMAALGEMASYIPL-DGFTSYASRYCDPALGFAVGYAYLCKYLILPPNQ 185
           AY F+G +V+    +LGEMA++IP+    T ++ R+  PA G A GY Y   + I    +
Sbjct: 101 AYIFMGTVVYSITQSLGEMATFIPVTSSVTVFSKRFLSPAFGVANGYMYWFNWAITFAVE 160

Query: 186 LTAAALVIQYWLDREQVNPGVWITIFLVIIVAMNFIGVKFFGEFEFWLSTFKVIVMIGLI 245
           L+    +I YW     V  G WITIF +I+  +NF  V+F+GE EFW+++ KVI ++G +
Sbjct: 161 LSVVGQIINYW--TSVVPLGAWITIFWIIVTLLNFFPVRFYGEIEFWIASVKVITIVGYL 218

Query: 246 ILLFVIMLGGGPTHDRLGFRFYDHPGAFKPYSKSIDGSKGKXXXXXXXXXXXXXXXXGIE 305
           I  F+++ GG  +   +GFR + +PG +     S + ++ +                G E
Sbjct: 219 IYAFIVVCGGS-SQGPIGFRNWRNPGPWGTGVISSNQTEARFLGWVSSLIKAAFTYQGTE 277

Query: 306 LTGIVAAEAANPRKSIPKAIKLTMYRIIVFYLVTIFLLGMCVAYDDPLLXXXXXXXXXXX 365
           L GI A E+ NPRK++PKAI    +RI+ FY++++F +G+ V Y+DP +           
Sbjct: 278 LVGITAGESKNPRKTVPKAINKVFFRILFFYILSLFFVGLLVPYNDPRMDNTSDTDVNAS 337

Query: 366 XXPYVVAIINSGIKALPHIFNACVLMFVFSACNSDLYVASRTLYGLAIDNKAPKIFAVTN 425
             P+V++I N+G K LP IFNA VL+ V SA NS++Y+ SR +Y LA    APK F   N
Sbjct: 338 --PFVISIRNAGTKILPDIFNAVVLVTVVSAANSNVYIGSRVIYSLAQSGNAPKQFGYVN 395

Query: 426 RWGVPYYSLLMSSCFCLLAYMSVSSGSAKIFNYFVNVVSIFGLLSWISILITYLCFFRAV 485
           R GVP   +++++   L+A++ V++ +   FN+ VN+ ++ GL +W+ I + ++ F + +
Sbjct: 396 RHGVPVLGVMVTALMGLMAFLVVNNNAKAAFNWLVNISTLAGLCAWLFISLAHIRFMQCL 455

Query: 486 KAQNVDRSRFAYRAPFQPYGSYFTLAFCILIAFIKNFTVFLNHHFDYKNFITGYIGIPVF 545
           K + + R    ++A F P+ +Y+  +F  +I FI+ +T F +  FD   F T YI + + 
Sbjct: 456 KQRGISRDALPFKAKFMPWAAYYAASFVFVIIFIQGYTAF-SPKFDVTQFFTAYISLMLM 514

Query: 546 VISYFGYKFVKKTK-IWKPEEVDLYTFKAAID----EEEEQGKIAD 586
           ++ + G +   K + +WK E++D+ T +  ID    E++E   + D
Sbjct: 515 LVVFIGCQIYYKCRFLWKLEDIDIDTNRREIDAIVWEDDEPKNLWD 560

>TDEL0A08030 Chr1 (1405718..1407262) [1545 bp, 514 aa] {ON} 
          Length = 514

 Score =  327 bits (838), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 186/512 (36%), Positives = 276/512 (53%), Gaps = 11/512 (2%)

Query: 57  DNLSTVSSRLEDSEKQDDYMDDGKDEHTRLRKDLKARHISMIAXXXXXXXXXXXXXXXXX 116
           + ++ V   L DS    D  + G      L ++L    +S++                  
Sbjct: 6   NTVTVVEPTLSDSASSRD--EGGSTNEATLSRELSPGVVSLLTLGSAVGTGLIIGSGTAL 63

Query: 117 YTAGPMSMFIAYAFVGVLVFFTMAALGEMASYIPLD-GFTSYASRYCDPALGFAVGYAYL 175
              GP+S+F+AY F G ++   + +L EMA++ P+D GF+ Y ++Y DPA GFA G+ Y 
Sbjct: 64  ARGGPISIFLAYLFTGSILAVVIFSLSEMAAFHPMDRGFSGYLTKYVDPAFGFAAGWNYF 123

Query: 176 CKYLILPPNQLTAAALVIQYWLDREQVNPGVWITIFLVIIVAMNFIGVKFFGEFEFWLST 235
            KY I+    LTA  LVI YW  R  +N  VW+T+       +NF+ V++FG+ E +++ 
Sbjct: 124 LKYAIVLSANLTAFGLVIGYW--RPDINVAVWVTVLYANAFVVNFLAVRYFGKLEAFMTV 181

Query: 236 FKVIVMIGLIILLFVIMLGGGPTHDRLGFRFYDHPGAFKPYSKSIDGSKGKXXXXXXXXX 295
            K+ +++ + I+  VI  GGGP H  +GFR++   G F PY   + G+ GK         
Sbjct: 182 AKLTILLLIFIVCLVITCGGGPDHTTIGFRYWRESG-FLPYL--VKGNTGKFLGWWACVI 238

Query: 296 XXXXXXXGIELTGIVAAEAANPRKSIPKAIKLTMYRIIVFYLVTIFLLGMCVAYDDPLLX 355
                  G E+ GI+  E ANPRK+IPKA +  + RI VFY+  +F+LG+ V+  +  L 
Sbjct: 239 QSIFGFMGSEMIGIIYGETANPRKTIPKASRNVIIRICVFYIFGVFVLGLAVSPHNAKLV 298

Query: 356 XXXXXXXXXXXXPYVVAIINSGIKALPHIFNACVLMFVFSACNSDLYVASRTLYGLAIDN 415
                       P+V+AI  SGIK LP   NA +L+F+ S+  +D+Y+ SR LYGLA D 
Sbjct: 299 HAHSTDANAS--PFVIAISTSGIKVLPSFVNAFLLVFITSSAYTDIYICSRQLYGLAKDG 356

Query: 416 KAPKIFAVTNRWGVPYYSLLMSSCFCLLAYMSVSSGSAKIFNYFVNVVSIFGLLSWISIL 475
            APKIF   N+  +P    ++ S    LAYM+    +A +F Y  + VS+FG+L+W  IL
Sbjct: 357 AAPKIFLRLNKHKIPMVGCVVGSLLGFLAYMNTKKSAATVFGYITSTVSVFGILNWFYIL 416

Query: 476 ITYLCFFRAVKAQNVDRSRFAYRAPFQPYGSYFTLAFCILIAFIKNFTVFLNHHFDYKNF 535
           + Y+ + R VK+  V      +R PFQPY +Y  L F  +I F   ++ F+   F+YK F
Sbjct: 417 VAYIHYDRVVKSHGVRLDEIPFRMPFQPYAAYIALFFVSVITFFNGYSAFI-LKFNYKLF 475

Query: 536 ITGYIGIPVFVISYFGYKFVKKTKIWKPEEVD 567
           IT YIGI   V+   GYK   KTK  KPEE+ 
Sbjct: 476 ITSYIGIFANVLLVLGYKLYYKTKWVKPEEIT 507

>NDAI0A00610 Chr1 complement(113913..115610) [1698 bp, 565 aa] {ON} 
          Length = 565

 Score =  328 bits (842), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 178/510 (34%), Positives = 288/510 (56%), Gaps = 9/510 (1%)

Query: 70  EKQDDYMDDGKDEHTRLRKDLKARHISMIAXXXXXXXXXXXXXXXXXYTAGPMSMFIAYA 129
           E Q++ + +G+     ++++LK RHI MIA                   AGP+   IAY 
Sbjct: 43  ESQEEEIANGQIREAEVKRELKQRHIGMIALGGTIGTGLFIGLSTPLTNAGPVGALIAYL 102

Query: 130 FVGVLVFFTMAALGEMASYIPL-DGFTSYASRYCDPALGFAVGYAYLCKYLILPPNQLTA 188
           F+G LV+    +LGEMA++IP+   FT ++ R+  P+ G A GY Y   + I    +L+ 
Sbjct: 103 FMGTLVYSVTQSLGEMATFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSV 162

Query: 189 AALVIQYWLDREQVNPGVWITIFLVIIVAMNFIGVKFFGEFEFWLSTFKVIVMIGLIILL 248
              +IQ+W     +    WI+IF V++VAMN   V+F+GEFEFW+++ KV+ ++G +I  
Sbjct: 163 VGQIIQFWTSAVPIV--AWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYC 220

Query: 249 FVIMLGGGPTHDRLGFRFYDHPGAFKPYSKSIDGSKGKXXXXXXXXXXXXXXXXGIELTG 308
             ++ G G T   +GFR++ +PG   P   + + ++ K                G EL G
Sbjct: 221 LCMVCGAGVTGP-VGFRYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVG 279

Query: 309 IVAAEAANPRKSIPKAIKLTMYRIIVFYLVTIFLLGMCVAYDDPLLXXXXXXXXXXXXXP 368
           I A EAANPRKS+P+AIK  ++RI+ FY+ ++F +G+ V Y+DP L             P
Sbjct: 280 ITAGEAANPRKSVPRAIKKVVFRILFFYIGSLFFIGLLVPYNDPKLTSDDSYVAAS---P 336

Query: 369 YVVAIINSGIKALPHIFNACVLMFVFSACNSDLYVASRTLYGLAIDNKAPKIFAVTNRWG 428
           ++++I NSG   LPHIFNA +L  + SA NS++YV SR ++GL+    AP+I + TN+ G
Sbjct: 337 FIISIQNSGTPILPHIFNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNG 396

Query: 429 VPYYSLLMSSCFCLLAYMSVSSGSAKIFNYFVNVVSIFGLLSWISILITYLCFFRAVKAQ 488
           VP+ S++ +  F  LAYM  S+G    FN+ +N+  + G  SW+ I I+++ F +A++ +
Sbjct: 397 VPWVSVIFTGLFGALAYMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYR 456

Query: 489 NVDRSRFAYRAPFQPYGSYFTLAFCILIAFIKNFTVFLNHHFDYKNFITGYIGIPVFVIS 548
            + R    ++A F P  +Y+ + F  LI  I+ FT F    FD  +F+  YI   +F+  
Sbjct: 457 GISRDDLPFKAKFMPGLAYYAIFFMTLIIIIQGFTSFC-PSFDGIDFLAAYISCFLFIAI 515

Query: 549 YFGYKFVKKTK-IWKPEEVDLYTFKAAIDE 577
           +  ++   + + IWK E+VD+ T +  I+E
Sbjct: 516 WIVFQLWFRCRLIWKIEDVDIDTDRRDIEE 545

>TPHA0H02850 Chr8 complement(676524..678329) [1806 bp, 601 aa] {ON}
           Anc_7.44 YOR348C
          Length = 601

 Score =  329 bits (843), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 192/566 (33%), Positives = 306/566 (54%), Gaps = 35/566 (6%)

Query: 46  DKKDGLDINDMDNLSTVSSRLEDSEKQDDYMDDGKDEHTRLRKDLKARHISMIAXXXXXX 105
           +KKD    + ++ + TVSS    +  ++DY +        L++ LK+RH+ +IA      
Sbjct: 46  NKKD----SGLNKVLTVSSDTSTNSLEEDYTN-------TLKQGLKSRHVQLIALGGCIG 94

Query: 106 XXXXXXXXXXXYTAGPMSMFIAYAFVGVLVFFTMAALGEMASYIPLDGFTSYAS------ 159
                      +T GP  +FIAY  +  +++  M A+GEM  Y+P DG  S  S      
Sbjct: 95  TGLFVGTSSTLHTCGPAGLFIAYCIISSVIYPIMNAVGEMVCYLPGDGHDSAGSVTHLVK 154

Query: 160 RYCDPALGFAVGYAYLCKYLILPPNQLTAAALVIQYWLDREQVNPGVWITIFLVIIVAMN 219
           RY D +L FA G+ Y   Y+IL   + TAAA V++YW     V    WITIFL II  +N
Sbjct: 155 RYVDESLAFATGWNYFYCYVILVAAECTAAAGVVEYW--TLAVPKAAWITIFLAIIFLLN 212

Query: 220 FIGVKFFGEFEFWLSTFKVIVMIGLIILLFVIMLGGGPTHDRLGFRFYDHPGAFKPYSKS 279
              VK+FGE EFW ++ K++ ++GLIIL F++  GGGP+HDRLGFR++ +PGAF  +   
Sbjct: 213 MSSVKYFGETEFWFASIKILCIMGLIILSFILFWGGGPSHDRLGFRYWKNPGAFAHHVT- 271

Query: 280 IDGSKGKXXXXXXXXXXXXXX-XXGIELTGIVAAEAANPRKSIPKAIKLTMYRIIVFYLV 338
            DGS G                  G EL  + ++E ++ R++I KA K  +YR++ FY++
Sbjct: 272 -DGSLGNFLDIYSGIIKGAFAFILGPELVALTSSECSDQRRNIAKASKRFIYRLMFFYIL 330

Query: 339 TIFLLGMCVAYDDPLLXXXXXXXX-XXXXXPYVVAIINSGIKALPHIFNACVLMFVFSAC 397
               +G+ VA++DP+L              P+V+ I N+GI+ LPHI NAC+L   +S+ 
Sbjct: 331 GTLAIGVIVAWNDPVLASALSNNTPGAGSSPFVIGIQNAGIEVLPHIINACILTSAWSSG 390

Query: 398 NSDLYVASRTLYGLAIDNKAPKIFAVTNRWGVPYYSLLMSSCFCLLAYMSVSSGSAKIFN 457
           N+ ++ +SR+L+ +A +  APKIF   N++GVPY ++++S+    LAY++ SS +A++F 
Sbjct: 391 NAFMFASSRSLFTMAQNGTAPKIFGRINKYGVPYMAVILSTLISCLAYLNASSSAARVFT 450

Query: 458 YFVNVVSIFGLLSWISILITYLCFFRAVKAQNVDRSRFAYRAPFQPYGSYFTLAFCILIA 517
           +  N+ +I G L WI   I YL F +A+   N+   R  ++   QPY   ++L    +I 
Sbjct: 451 WLSNISTISGFLGWICACIAYLRFRKAIFYNNL-YDRMPFKTWGQPYLILWSLTVVSIIT 509

Query: 518 FIKNFTVFLNHHFDYKNFITGYIGIPVFVISYFGYKFVKKTKIWKP--------EEVDLY 569
               +  F+   ++  +FI  YI +P+F+  Y G+K     K   P        E++D+ 
Sbjct: 510 ITNGYQTFIPKFWNVSDFIAAYITLPIFLALYVGHKVYNHFKNDYPLMKLAYSVEDIDVI 569

Query: 570 TFKAAIDE---EEEQGKIADAERRER 592
           T    I+    E ++ +I    R ER
Sbjct: 570 TGLDEIETKTCELDENRILPTNRWER 595

>ZYRO0F16654g Chr6 (1374093..1375835) [1743 bp, 580 aa] {ON} similar
           to uniprot|P04817 Saccharomyces cerevisiae YEL063C CAN1
           Plasma membrane arginine permease requires phosphatidyl
           ethanolamine (PE) for localization exclusively
           associated with lipid rafts mutation confers canavanine
           resistance
          Length = 580

 Score =  328 bits (841), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 183/518 (35%), Positives = 287/518 (55%), Gaps = 11/518 (2%)

Query: 65  RLEDSEKQDDYMDDGKDE--HTRLRKDLKARHISMIAXXXXXXXXXXXXXXXXXYTAGPM 122
           R+++    DD +D  K E   T +++ LK RHI MIA                   AGP+
Sbjct: 51  RVDNEYDVDDSVDGEKGEVRSTEVKRALKPRHIGMIALGGTIGTGLFVGISEPLQNAGPV 110

Query: 123 SMFIAYAFVGVLVFFTMAALGEMASYIPL-DGFTSYASRYCDPALGFAVGYAYLCKYLIL 181
            M IAY F+  + F  M +LGEMA+YIP+   F+ ++ R+  PA G A GY Y   + I 
Sbjct: 111 GMLIAYLFMATIAFSVMQSLGEMATYIPVTSAFSVFSQRFLSPAFGAANGYMYWFSWSIT 170

Query: 182 PPNQLTAAALVIQYWLDREQVNPGVWITIFLVIIVAMNFIGVKFFGEFEFWLSTFKVIVM 241
              +L+    ++QYW  +  V    WI+IF V+I  +NF  VKF+GEFEFW++  KV+ +
Sbjct: 171 FALELSVIGQIVQYWTFKVPV--AAWISIFWVLIAGLNFCPVKFYGEFEFWIAFIKVVAI 228

Query: 242 IGLIILLFVIMLGGGPTHDRLGFRFYDHPGAFKPYSKSIDGSKGKXXXXXXXXXXXXXXX 301
           +G II  F+++ G G T   +GFR++ H  AF     S + ++ +               
Sbjct: 229 VGFIIYCFIMVCGAGKTGP-VGFRYWRHGYAFGDGIISKNKNEARFLGWVSSLINAAFTY 287

Query: 302 XGIELTGIVAAEAANPRKSIPKAIKLTMYRIIVFYLVTIFLLGMCVAYDDPLLXXXXXXX 361
            G EL GI A EAANPRK++PK+IK T++RI++FY+ ++  +G+ V ++D  L       
Sbjct: 288 QGTELVGITAGEAANPRKTVPKSIKRTLWRILIFYIFSLLFVGLLVPFNDHGLQDSRSYA 347

Query: 362 XXXXXXPYVVAIINSGIKALPHIFNACVLMFVFSACNSDLYVASRTLYGLAIDNKAPKIF 421
                 P+++AI NSG KALP IFNA +L  V SA NSD+YV SR +Y +A +  AP I 
Sbjct: 348 ASS---PFILAIKNSGTKALPDIFNAVILTTVISAANSDVYVGSRVMYSMARNRLAPPIL 404

Query: 422 AVTNRWGVPYYSLLMSSCFCLLAYMSVSSGSAKIFNYFVNVVSIFGLLSWISILITYLCF 481
           A  ++ GVPY ++L +S    LAY+  SS  A +FN+ +N+  + G  SW  I  ++L F
Sbjct: 405 AKASKGGVPYAAVLFTSAIGALAYLETSSSGANVFNWLMNITGVAGFFSWWLISWSHLRF 464

Query: 482 FRAVKAQNVDRSRFAYRAPFQPYGSYFTLAFCILIAFIKNFTVFLNHHFDYKNFITGYIG 541
            +A+K + + R+   ++A F P+ + ++  F  LI  ++ FT F   HF   +F+  YI 
Sbjct: 465 MKALKQRGISRNDLPFKASFMPWIAIYSFFFMTLIILVQGFTCF-TPHFQASDFVASYIS 523

Query: 542 IPVFVISYFGYKFVKKTKIWKP-EEVDLYTFKAAIDEE 578
           + +F + +  ++   +  +  P  E+D+ T +  +D E
Sbjct: 524 VGLFFVIWAVFQIWFRCPLLVPIAEIDIDTDRRDVDAE 561

>KNAG0C05920 Chr3 (1157993..1159792) [1800 bp, 599 aa] {ON} 
          Length = 599

 Score =  329 bits (843), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 178/514 (34%), Positives = 288/514 (56%), Gaps = 9/514 (1%)

Query: 66  LEDSEKQDDYMDDGKDEHTRLRKDLKARHISMIAXXXXXXXXXXXXXXXXXYTAGPMSMF 125
           L+ +        +   +H  +++ LK RHI+MIA                   AGP+   
Sbjct: 73  LQSATNTGTLCTEEHVKHRSVKRALKPRHIAMIALGGTIGTGLFMGIAKPLRNAGPVGAL 132

Query: 126 IAYAFVGVLVFFTMAALGEMASYIPL-DGFTSYASRYCDPALGFAVGYAYLCKYLILPPN 184
           IAY FVG ++F    +LGEM ++IP+   FT ++ R+  PA G A GY Y   + +    
Sbjct: 133 IAYIFVGTIIFSVTQSLGEMVTFIPVTSSFTVFSHRFLSPAFGAANGYMYWFSWAMTFAV 192

Query: 185 QLTAAALVIQYWLDREQVNPGVWITIFLVIIVAMNFIGVKFFGEFEFWLSTFKVIVMIGL 244
           +L+    VIQ+W     V    WI IF  ++   N   VK++GE EFW++  KV+ ++G 
Sbjct: 193 ELSVLGKVIQFW--TTAVPLAAWIVIFWFLLTLSNMFPVKYYGEIEFWIAFLKVLSLVGF 250

Query: 245 IILLFVIMLGGGPTHDRLGFRFYDHPGAFKPYSKSIDGSKGKXXXXXXXXXXXXXXXXGI 304
           +I    I  G GP H   GFR++  PGA+ P   + D S+ +                G 
Sbjct: 251 LIFCLCITSGAGP-HGPFGFRYWRDPGAWGPGIIAEDQSEARFLGWVSSLINAAFTYQGT 309

Query: 305 ELTGIVAAEAANPRKSIPKAIKLTMYRIIVFYLVTIFLLGMCVAYDDPLLXXXXXXXXXX 364
           EL GI A EAANPRK++PKAIK  + RI+ FY+ ++F +GM V ++DP L          
Sbjct: 310 ELVGITAGEAANPRKAVPKAIKKVILRILFFYVGSLFFIGMLVPFNDPKLTSATSFVSSS 369

Query: 365 XXXPYVVAIINSGIKALPHIFNACVLMFVFSACNSDLYVASRTLYGLAIDNKAPKIFAVT 424
              P+++AI NSG+  LP IFN  +L+ + SA NS++YV SR L+GLA  N AP+ F  T
Sbjct: 370 ---PFIIAIQNSGVSLLPSIFNGVILITIISAGNSNVYVGSRILFGLAHSNLAPQFFTRT 426

Query: 425 NRWGVPYYSLLMSSCFCLLAYMSVSSGSAKIFNYFVNVVSIFGLLSWISILITYLCFFRA 484
            + GVP+ ++L +S F  LA++ +++   K+FN+ +++V+I G  +W+ I ++++ F +A
Sbjct: 427 TKTGVPFVAVLFTSLFGSLAFLELTTDGDKVFNWLLSIVAIAGFFAWLLISLSHIRFMKA 486

Query: 485 VKAQNVDRSRFAYRAPFQPYGSYFTLAFCILIAFIKNFTVFLNHHFDYKNFITGYIGIPV 544
           ++ + + R+   ++A F P+ +Y+  AF ILI  I+ FT F    F+  +F+  YI + +
Sbjct: 487 LEYRGISRNSLPFKAIFMPWLAYYATAFIILIILIQGFTAF-APRFNVSDFVASYISLLL 545

Query: 545 FVISYFGYKFVKKTKI-WKPEEVDLYTFKAAIDE 577
           FVI +  ++ +KK +I WK E++DL + +  I++
Sbjct: 546 FVIIWGVFQAMKKCRIFWKVEDIDLDSDRKDIED 579

>Skud_14.71 Chr14 (127310..129148) [1839 bp, 612 aa] {ON} YEL063C
           (REAL)
          Length = 612

 Score =  329 bits (843), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 183/507 (36%), Positives = 288/507 (56%), Gaps = 16/507 (3%)

Query: 80  KDEHTRLRKDLKARHISMIAXXXXXXXXXXXXXXXXXYTAGPMSMFIAYAFVGVLVFFTM 139
           +D+H  +++ LK RHI MIA                   AGP+   I+Y F+G +V+F  
Sbjct: 103 EDKH--VKRALKQRHIGMIALGGTIGTGLFVGISTPLSKAGPVGSLISYIFMGTVVYFIT 160

Query: 140 AALGEMASYIPL-DGFTSYASRYCDPALGFAVGYAYLCKYLILPPNQLTAAALVIQYWLD 198
            +LGEMA++IP+    T ++ R+  PA G A GY Y   + I    +++    VIQYW D
Sbjct: 161 QSLGEMATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVEVSVIGQVIQYWTD 220

Query: 199 REQVNPGVWITIFLVIIVAMNFIGVKFFGEFEFWLSTFKVIVMIGLIILLFVIMLGGGPT 258
           +  V   VWI IF V+I  MNF  VK +GEFEFW+++ KV+ ++G +I   VI+ GG   
Sbjct: 221 K--VPLAVWIAIFWVLITLMNFFPVKVYGEFEFWVASVKVLAIMGYLIYALVIVCGGS-H 277

Query: 259 HDRLGFRFYDHPGAFKPYSKSIDGSKGKXXXXXXXXXXXXXXXXGIELTGIVAAEAANPR 318
              +GFR++ +PGA+ P   S D ++G+                G EL GI A EAANPR
Sbjct: 278 QGPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPR 337

Query: 319 KSIPKAIKLTMYRIIVFYLVTIFLLGMCVAYDDPLLXXXXXXXXXXXXXPYVVAIINSGI 378
           K++P+AI   ++RI++FY++++F +G+ V Y++P L             P+V++I N+G 
Sbjct: 338 KTVPRAINKVVFRIVLFYIMSLFFIGLLVPYNEPRLSASSAVIASS---PFVISIQNAGT 394

Query: 379 KALPHIFNACVLMFVFSACNSDLYVASRTLYGLAIDNKAPKIFAVTNRWGVPYYSLLMSS 438
            ALP IFNA VL+ V SA NS++YV SR LY LA    APK F    + GVPY  +L ++
Sbjct: 395 YALPDIFNAVVLITVISAANSNVYVGSRVLYSLAQTGNAPKQFGYVTKQGVPYLGVLSTA 454

Query: 439 CFCLLAYMSVSSGSAKIFNYFVNVVSIFGLLSWISILITYLCFFRAVKAQNVDRSRFAYR 498
              LLA++ V++ +   FN+ +N+ ++ GL +W+ I + ++ F +A++ + + R    ++
Sbjct: 455 ALGLLAFLVVNNNANTAFNWLINISTLAGLCAWLFISLAHIRFMQALEQRGISRDDLPFK 514

Query: 499 APFQPYGSYFTLAFCILIAFIKNFTVFLNHHFDYKNFITGYIGIPVFVISYFGYKFVKKT 558
           A   PYG+Y+   F  +I FI+ F  F    F   +F T YI + +  + + G +   K 
Sbjct: 515 AKLMPYGAYYAAFFVTVIIFIQGFQAFC--PFKVSDFFTSYISLILLAVVFTGCQLYYKC 572

Query: 559 K-IWKPEEVDLYT----FKAAIDEEEE 580
           + IWK E++D+ T     +A I E++E
Sbjct: 573 RFIWKLEDIDIDTDRREIEAIIWEDDE 599

>KLTH0F02398g Chr6 complement(202746..204413) [1668 bp, 555 aa] {ON}
           similar to uniprot|P04817 Saccharomyces cerevisiae
           YEL063C CAN1 Plasma membrane arginine permease requires
           phosphatidyl ethanolamine (PE) for localization
           exclusively associated with lipid rafts mutation confers
           canavanine resistance
          Length = 555

 Score =  327 bits (837), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 192/537 (35%), Positives = 296/537 (55%), Gaps = 11/537 (2%)

Query: 46  DKKDGLDINDMDNLST-VSSRLEDSE-KQDDYMDDGKDEHTRLRKDLKARHISMIAXXXX 103
           +K+  L  N++  +    SS L D   +Q   +D    +   +++ LK RH+SMIA    
Sbjct: 7   EKQPQLHKNEIKVMEEGESSSLADGVLEQQSQIDTASSQERGIQRALKPRHVSMIALGGT 66

Query: 104 XXXXXXXXXXXXXYTAGPMSMFIAYAFVGVLVFFTMAALGEMASYIPL-DGFTSYASRYC 162
                          AGP+   I+Y F+G L FF   +LGEMA++IP+   FT +  R+ 
Sbjct: 67  IGTGLFVGIANPLRDAGPVGSLISYLFMGSLAFFVTQSLGEMATFIPVASSFTVFTRRFL 126

Query: 163 DPALGFAVGYAYLCKYLILPPNQLTAAALVIQYWLDREQVNPGVWITIFLVIIVAMNFIG 222
            PALG A GY Y   + I    +L+    +IQYW     V    WI IF V I   N + 
Sbjct: 127 SPALGAANGYMYCFSWCITFALELSIVGEIIQYW--TLGVPNAAWIIIFWVPISLSNLVS 184

Query: 223 VKFFGEFEFWLSTFKVIVMIGLIILLFVIMLGGGPTHDRLGFRFYDHPGAFKPYSKSIDG 282
           VKF+GEF+FW++  KVI ++G +I    ++ G G T   +GFR++ +PG +     S   
Sbjct: 185 VKFYGEFQFWIALIKVIAIVGFLIYCLCMVCGAGKTGP-VGFRYWRNPGPWGDGIISKSK 243

Query: 283 SKGKXXXXXXXXXXXXXXXXGIELTGIVAAEAANPRKSIPKAIKLTMYRIIVFYLVTIFL 342
           S+G+                G EL G+ A E+ANPRK++PKAI+    RI++FY+ ++F 
Sbjct: 244 SEGRFLGWVSSLVNAAFTYQGTELVGVSAGESANPRKTVPKAIRKVFLRILLFYVGSLFF 303

Query: 343 LGMCVAYDDPLLXXXXXXXXXXXXXPYVVAIINSGIKALPHIFNACVLMFVFSACNSDLY 402
           +G+ V ++DP L             P+++AI NSG +ALP IFNA +L  + SA NS++Y
Sbjct: 304 IGLLVPFNDPKLDSTANYSASS---PFIIAIQNSGTRALPDIFNAVILTTIISAANSNVY 360

Query: 403 VASRTLYGLAIDNKAPKIFAVTNRWGVPYYSLLMSSCFCLLAYMSVSSGSAKIFNYFVNV 462
           V SR LYGLA +  APKI    NR GVPY  + + S F  L Y+SVSSGSAK F++ +N+
Sbjct: 361 VGSRVLYGLAKEGLAPKIIGRINRHGVPYICVGIVSLFGFLGYLSVSSGSAKAFDWLLNI 420

Query: 463 VSIFGLLSWISILITYLCFFRAVKAQNVDRSRFAYRAPFQPYGSYFTLAFCILIAFIKNF 522
            +I G  +W+ I + ++ F +A+K Q + R    ++A   P+G+Y+   F +LI  I+ F
Sbjct: 421 TAIAGFFAWLFISLCHIRFMQALKYQGISRDDLPFKAKLMPWGAYYAAFFILLIIIIQGF 480

Query: 523 TVFLNHHFDYKNFITGYIGIPVFVISYFGYKFVKKTK-IWKPEEVDLYTFKAAIDEE 578
           T F    F+  NF   Y+ + +F+  +  ++ + K++ I K E+VD+ + +  I+ E
Sbjct: 481 TAF-APKFNVSNFFAAYVSVFLFIAVWVIFQVIFKSRLIHKVEDVDIDSDRREIEAE 536

>NCAS0B08570 Chr2 (1644264..1645862) [1599 bp, 532 aa] {ON} 
          Length = 532

 Score =  326 bits (835), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 177/514 (34%), Positives = 292/514 (56%), Gaps = 11/514 (2%)

Query: 67  EDSEKQDDYMDDGKD-EHTRLRKDLKARHISMIAXXXXXXXXXXXXXXXXXYTAGPMSMF 125
           +DS+ +++  +   + E   +R++LK RH+ MIA                   AGP+   
Sbjct: 7   QDSKMKEEIREISVEVEAETVRRELKQRHMGMIALGGTIGTGLFIGVSTPLMNAGPVGAL 66

Query: 126 IAYAFVGVLVFFTMAALGEMASYIPL-DGFTSYASRYCDPALGFAVGYAYLCKYLILPPN 184
           IAY F+  L +    +LGEMA++IP+   FT ++ R+  PA G A GY Y   + I    
Sbjct: 67  IAYLFMATLAYSVTQSLGEMATFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITFAL 126

Query: 185 QLTAAALVIQYWLDREQVNPGVWITIFLVIIVAMNFIGVKFFGEFEFWLSTFKVIVMIGL 244
           +L+    VIQ+W     V    WI+IF V++  MN   VK++GEFEFW++  KV+ ++G 
Sbjct: 127 ELSVVGQVIQFW--TFAVPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGF 184

Query: 245 IILLFVIMLGGGPTHDRLGFRFYDHPGAFKPYSKSIDGSKGKXXXXXXXXXXXXXXXXGI 304
           +I  F ++ G G T   +GFR++ HPGAF P   + D ++ +                G 
Sbjct: 185 LIYCFCMVCGAGVTGP-VGFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTFQGT 243

Query: 305 ELTGIVAAEAANPRKSIPKAIKLTMYRIIVFYLVTIFLLGMCVAYDDPLLXXXXXXXXXX 364
           EL GI A EAANPRK++P+AIK  ++RI+ FY++++F +G+ V YDD  L          
Sbjct: 244 ELVGITAGEAANPRKTVPRAIKKVVFRILFFYILSLFFIGLLVPYDDWKLTSTDSYVSAS 303

Query: 365 XXXPYVVAIINSGIKALPHIFNACVLMFVFSACNSDLYVASRTLYGLAIDNKAPKIFAVT 424
              P+++AI NSG   LPHIFNA ++  + SA NS++YV SR +YGL+    AP I + T
Sbjct: 304 ---PFIIAIENSGTHVLPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRT 360

Query: 425 NRWGVPYYSLLMSSCFCLLAYMSVSSGSAKIFNYFVNVVSIFGLLSWISILITYLCFFRA 484
            + GVP+ ++L++S F  LAYM  S+G  K FN+ +N+  + G  +W+ I ++++ F +A
Sbjct: 361 TQHGVPWVAVLVTSLFGALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQA 420

Query: 485 VKAQNVDRSRFAYRAPFQPYGSYFTLAFCILIAFIKNFTVFLNHHFDYKNFITGYIGIPV 544
           ++ + + R    ++A + P  +Y+ + F  LI  I+ FT F    ++  +F+T YI + +
Sbjct: 421 LEMRGISRDDLPFKAKWMPGLAYYGVFFMTLIIIIQGFTSFCP--WNGIDFLTAYISVFM 478

Query: 545 FVISYFGYK-FVKKTKIWKPEEVDLYTFKAAIDE 577
           F+  +  ++ + +   IW+ E+VD+ T + A++E
Sbjct: 479 FIAIWIAFQAWFRCRLIWRVEDVDIDTDRRAVEE 512

>TDEL0C06180 Chr3 (1120158..1121909) [1752 bp, 583 aa] {ON} Anc_1.83
           YEL063C
          Length = 583

 Score =  327 bits (837), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 189/536 (35%), Positives = 290/536 (54%), Gaps = 21/536 (3%)

Query: 75  YMDDGKDEHTRLRKDLKARHISMIAXXXXXXXXXXXXXXXXXYTAGPMSMFIAYAFVGVL 134
           ++ +G+     +++ LK RHI MIA                   AGP+   IAY F+  L
Sbjct: 66  FVKEGQVHEAEVKRALKQRHIGMIALGGTIGTGLFIGISTPLSNAGPVGGLIAYLFMATL 125

Query: 135 VFFTMAALGEMASYIPL-DGFTSYASRYCDPALGFAVGYAYLCKYLILPPNQLTAAALVI 193
           V+  + +LGEMA++IP+   FT ++SR+  PA G A GY Y   + I    +L+    +I
Sbjct: 126 VYSVVQSLGEMATFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQII 185

Query: 194 QYWLDREQVNPGVWITIFLVIIVAMNFIGVKFFGEFEFWLSTFKVIVMIGLIILLFVIML 253
           ++W     V    WITIF V++   N   VK++GEFEFW++  KVI ++G II    ++ 
Sbjct: 186 EFW--TTAVPMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVC 243

Query: 254 GGGPTHDRLGFRFYDHPGAFKPYSKSIDGSKGKXXXXXXXXXXXXXXXXGIELTGIVAAE 313
           G G T   +GFR++ +PGA+ P   S D ++G+                G EL GI A E
Sbjct: 244 GAGITGP-VGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGE 302

Query: 314 AANPRKSIPKAIKLTMYRIIVFYLVTIFLLGMCVAYDDPLLXXXXXXXXXXXXXPYVVAI 373
           AANPRKS+P+AIK  ++RI+VFY      +G+ V Y+DP L             P+++AI
Sbjct: 303 AANPRKSVPRAIKKVVFRILVFYYPIAVFIGLLVPYNDPKLNSSDSYVSSS---PFIIAI 359

Query: 374 INSGIKALPHIFNACVLMFVFSACNSDLYVASRTLYGLAIDNKAPKIFAVTNRWGVPYYS 433
            NSG K LPHIFNA VL  + SA NS++YV SR +YGLA    AP  F  TN  GVPY++
Sbjct: 360 ENSGTKVLPHIFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFA 419

Query: 434 LLMSSCFCLLAYMSVSSGSAKIFNYFVNVVSIFGLLSWISILITYLCFFRAVKAQNVDRS 493
           +  +S F  LAYM +S+G A  FN+ +N+  + G  +W+ I   ++ F +A+K + + R 
Sbjct: 420 VFFTSAFGALAYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRD 479

Query: 494 RFAYRAPFQPYGSYFTLAFCILIAFIKNFTVFLNHHFDYKNFITGYIGIPVFVISYFGYK 553
              ++A F P+ +Y+ L F ++I  I+ FT F    F   +F   Y+ + +F+  + G +
Sbjct: 480 DLPFKAKFMPWLAYYALFFMVVIILIQGFTAF-APTFSGVDFAAAYVSVFLFIAIWLGAQ 538

Query: 554 FVKKTKIW-KPEEVDLYTFKAAIDEEEEQGKIADAERRERLKNSKTKGWDWFYEKV 608
              + +I+ + +EVD+ T     D  + +  + D E  + L       WD F+  V
Sbjct: 539 IWFRCRIFHRLDEVDIDT-----DRRDIEAVVWDDEPPKTL-------WDKFWNIV 582

>Ecym_1087 Chr1 complement(180832..182544) [1713 bp, 570 aa] {ON}
           similar to Ashbya gossypii AFR668W
          Length = 570

 Score =  326 bits (835), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 182/532 (34%), Positives = 295/532 (55%), Gaps = 22/532 (4%)

Query: 47  KKDGLDINDMDNLSTVSSRLEDSEKQDDYMDDGKDEHTRLRKDLKARHISMIAXXXXXXX 106
           K +G+ IN  +N+S V S          Y +D  D    +++DLK RH+SMI+       
Sbjct: 37  KNEGIFINQ-ENMSEVESL---------YGNDDPD----VKRDLKPRHMSMISLGGTIGT 82

Query: 107 XXXXXXXXXXYTAGPMSMFIAYAFVGVLVFFTMAALGEMASYIPL-DGFTSYASRYCDPA 165
                       AGP+   +AY F+G + F    +LGEMA++IP+   FT Y  R+  PA
Sbjct: 83  GLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVTQSLGEMATFIPVTSSFTMYTQRFLSPA 142

Query: 166 LGFAVGYAYLCKYLILPPNQLTAAALVIQYWLDREQVNPGVWITIFLVIIVAMNFIGVKF 225
           LG A GY Y   + +    +L+    +IQYW     V   VWI +F +++ A N I V+F
Sbjct: 143 LGAANGYLYWFSWCVTFALELSIIGQLIQYW--TFAVPLSVWIVVFWILLTASNMIPVRF 200

Query: 226 FGEFEFWLSTFKVIVMIGLIILLFVIMLGGGPTHDRLGFRFYDHPGAFKPYSKSIDGSKG 285
           +GE EFW++  KV+ + G +I   V M+ GG +   LGFR++ +PG +     S +  + 
Sbjct: 201 YGEIEFWIAALKVLSIFGFLIYALV-MVCGGSSEGALGFRYWKNPGPWGMGMISSNKYEA 259

Query: 286 KXXXXXXXXXXXXXXXXGIELTGIVAAEAANPRKSIPKAIKLTMYRIIVFYLVTIFLLGM 345
           +                G EL GI A E+ NPRK++PKAI    +RI+ FY++++F +G+
Sbjct: 260 RFLGWVSSLIKAAFTYQGTELVGITAGESKNPRKTVPKAINKVFFRILFFYILSLFFVGL 319

Query: 346 CVAYDDPLLXXXXXXXXXXXXXPYVVAIINSGIKALPHIFNACVLMFVFSACNSDLYVAS 405
            V Y DP L             P+V+AI NSG K LP +FN  +L+ + SA NS++Y+ S
Sbjct: 320 LVPYTDPRLSTTSDSDINTS--PFVMAIQNSGTKVLPSVFNGVILVTILSAGNSNIYIGS 377

Query: 406 RTLYGLAIDNKAPKIFAVTNRWGVPYYSLLMSSCFCLLAYMSVSSGSAKIFNYFVNVVSI 465
           R LYGL+    AP +F  TN+ GVP+Y++L SS F  LAY+++S  + K+F++ + + ++
Sbjct: 378 RVLYGLSKSGLAPSLFKKTNKQGVPFYAVLTSSIFGCLAYLNISQNAKKVFDWLLTITAV 437

Query: 466 FGLLSWISILITYLCFFRAVKAQNVDRSRFAYRAPFQPYGSYFTLAFCILIAFIKNFTVF 525
            G  +W+ I ++++ F + +K + + R+   ++A F P+G+Y+   F  +I  I+ F  F
Sbjct: 438 AGFFAWLLISLSHIRFMQVLKDRGISRNDLPFKAKFMPWGAYYAAFFITVIILIQGFDSF 497

Query: 526 LNHHFDYKNFITGYIGIPVFVISYFGYKFVKKTK-IWKPEEVDLYTFKAAID 576
               F +  FI  YI + +F++ + G++ + KT+ I + E+VD+ T +  ID
Sbjct: 498 -APEFVFSEFIADYISVFLFIVCWLGFQVLFKTRLILRKEDVDIDTDRREID 548

>Smik_14.67 Chr14 complement(114969..116690) [1722 bp, 573 aa] {ON}
           YNL270C (REAL)
          Length = 573

 Score =  326 bits (835), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 181/534 (33%), Positives = 297/534 (55%), Gaps = 13/534 (2%)

Query: 47  KKDGLDINDMDNLSTVSSRLEDSEKQDDYMDDGKDEHTRLRKDLKARHISMIAXXXXXXX 106
           + DG D  +   ++  SS   DS K+ +       E   +++ LK RHI MIA       
Sbjct: 32  RYDGQDTEEA--VAGKSSINNDSAKETETSPRKGGE---VKRKLKQRHIGMIALGGTIGT 86

Query: 107 XXXXXXXXXXYTAGPMSMFIAYAFVGVLVFFTMAALGEMASYIPL-DGFTSYASRYCDPA 165
                       AGP+   I+Y F+G +++    +LGEMA++IP+   F+ +A R+  PA
Sbjct: 87  GLIIGIGPPLAHAGPVGALISYLFMGTVIYSVTQSLGEMATFIPVTSSFSVFAQRFLSPA 146

Query: 166 LGFAVGYAYLCKYLILPPNQLTAAALVIQYWLDREQVNPGVWITIFLVIIVAMNFIGVKF 225
           LG   GY Y   +      +L+    +IQYW D   V    WI IF  ++  MN   VK+
Sbjct: 147 LGATNGYMYWLSWCFTFALELSVLGQIIQYWTD--AVPLVAWIVIFWCLLTLMNMFPVKY 204

Query: 226 FGEFEFWLSTFKVIVMIGLIILLFVIMLGGGPTHDRLGFRFYDHPGAFKPYSKSIDGSKG 285
           +GEFEF +++ KVI ++G I   F I+ G G +   +GFR++ +PGA+ P   S + ++G
Sbjct: 205 YGEFEFCIASIKVIALLGFIFFSFCIVCGAGQSGGPIGFRYWRNPGAWGPGIISKNKNEG 264

Query: 286 KXXXXXXXXXXXXXXXXGIELTGIVAAEAANPRKSIPKAIKLTMYRIIVFYLVTIFLLGM 345
           +                G EL GI A EAANPR+++P+AIK  + RI+VFY++++F +G+
Sbjct: 265 RFLGWVSSLINAAFTYQGTELVGITAGEAANPRRAVPRAIKKVVVRILVFYILSLFFIGL 324

Query: 346 CVAYDDPLLXXXXXXXXXXXXXPYVVAIINSGIKALPHIFNACVLMFVFSACNSDLYVAS 405
            V Y+DP L             P++++I NSG K LP IFNA VL+ + SA NS++Y+ S
Sbjct: 325 LVPYNDPKLDSEGTFVSSS---PFMISIENSGTKVLPDIFNAVVLITILSAGNSNVYIGS 381

Query: 406 RTLYGLAIDNKAPKIFAVTNRWGVPYYSLLMSSCFCLLAYMSVSSGSAKIFNYFVNVVSI 465
           R LY L+ ++ AP+  +   + GVPY+++L +S F  LA++  S+GS K+FN+ +N+  +
Sbjct: 382 RVLYSLSKNSLAPRFLSNVTKGGVPYFAVLSTSAFGFLAFLETSAGSGKVFNWLLNITGV 441

Query: 466 FGLLSWISILITYLCFFRAVKAQNVDRSRFAYRAPFQPYGSYFTLAFCILIAFIKNFTVF 525
            G  +W+ I ++++ F +A+K + + R    YRA   P+ +Y+   F  LI  I+ FT F
Sbjct: 442 AGFFAWLLISLSHIRFMQAIKKRGISRDDLPYRARMMPFLAYYASFFIALIVLIQGFTAF 501

Query: 526 LNHHFDYKNFITGYIGIPVFVISYFGYKFVKKTK-IWKPEEVDLYTFKAAIDEE 578
               F   +FI  YI + +F+  +  ++   K + +WK ++VD+ + +  I+E+
Sbjct: 502 -APTFQPIDFIAAYISVFLFIAIWLLFQVWFKCRFVWKLQDVDIDSDRRDIEEQ 554

>CAGL0J08162g Chr10 complement(803679..805472) [1794 bp, 597 aa]
           {ON} highly similar to uniprot|P32487 Saccharomyces
           cerevisiae YNL268w LYP1 or uniprot|P04817 Saccharomyces
           cerevisiae YEL063c CAN1 or uniprot|P38971 Saccharomyces
           cerevisiae YNL270c ALP1
          Length = 597

 Score =  326 bits (836), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 181/503 (35%), Positives = 282/503 (56%), Gaps = 13/503 (2%)

Query: 84  TRLRKDLKARHISMIAXXXXXXXXXXXXXXXXXYTAGPMSMFIAYAFVGVLVFFTMAALG 143
           TR+++ LK RHI MIA                   +GP+   IAY F+G +++F   +LG
Sbjct: 89  TRVKRALKQRHIGMIALGGTIGTGLFVGISTPLSNSGPVGALIAYIFMGTIIYFVTQSLG 148

Query: 144 EMASYIPL-DGFTSYASRYCDPALGFAVGYAYLCKYLILPPNQLTAAALVIQYWLDREQV 202
           EMA++IP+    T ++ R+  PA G A GY Y   + I    +++    VIQYW  +  V
Sbjct: 149 EMATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVEVSVIGQVIQYWTFK--V 206

Query: 203 NPGVWITIFLVIIVAMNFIGVKFFGEFEFWLSTFKVIVMIGLIILLFVIMLGGGPTHDRL 262
               WI IF V+I  MNF  VK +GEFEFW+++ KVI ++G +I   +I+ GG      +
Sbjct: 207 PLAAWIGIFWVLITLMNFFPVKIYGEFEFWVASIKVIAIVGYLIYALIIVCGGS-HQGPI 265

Query: 263 GFRFYDHPGAFKPYSKSIDGSKGKXXXXXXXXXXXXXXXXGIELTGIVAAEAANPRKSIP 322
           GFR++ +PGA      S D  + +                G EL GI A EAANPRKS+P
Sbjct: 266 GFRYWRNPGAMGAGIISSDLGEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVP 325

Query: 323 KAIKLTMYRIIVFYLVTIFLLGMCVAYDDPLLXXXXXXXXXXXXXPYVVAIINSGIKALP 382
           +AI   ++RI++FY++++F +G+ V Y+DP L             P+V++I N+G K LP
Sbjct: 326 RAINKVVFRIVLFYIMSLFFVGLLVPYNDPRLSASSAVIASS---PFVISIQNAGTKVLP 382

Query: 383 HIFNACVLMFVFSACNSDLYVASRTLYGLAIDNKAPKIFAVTNRWGVPYYSLLMSSCFCL 442
            IFNA VL+ V SA NS++YV SR LY LA    APK FA   R GVPY  ++ ++   L
Sbjct: 383 DIFNAVVLVTVISAANSNVYVGSRVLYALAQSGNAPKQFAYVTRHGVPYLGVICTALLGL 442

Query: 443 LAYMSVSSGSAKIFNYFVNVVSIFGLLSWISILITYLCFFRAVKAQNVDRSRFAYRAPFQ 502
           LA++ V+  +   FN+ +N+ ++ GL +W+ I + ++ F +A+K + + R    ++A F 
Sbjct: 443 LAFLVVNHNANTAFNWLINISTLAGLCAWLFISLAHIRFMQALKFRGISRDDLPFKAKFM 502

Query: 503 PYGSYFTLAFCILIAFIKNFTVFLNHHFDYKNFITGYIGIPVFVISYFGYKFVKKTK-IW 561
           P+G+Y+   F  +I FI+ F  F    FD   F T YI + + V+ + G +   + + +W
Sbjct: 503 PWGAYYASFFVTVIIFIQGFQAF-APKFDVSEFFTAYISLILLVVLFAGCQLYYRCRFLW 561

Query: 562 KPEEVDLYTFKAAID----EEEE 580
           K E++D+ + +  ID    E++E
Sbjct: 562 KLEDIDIDSDRREIDAIVWEDDE 584

>NDAI0F04190 Chr6 complement(1012142..1013941) [1800 bp, 599 aa]
           {ON} 
          Length = 599

 Score =  326 bits (835), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 173/509 (33%), Positives = 288/509 (56%), Gaps = 13/509 (2%)

Query: 84  TRLRKDLKARHISMIAXXXXXXXXXXXXXXXXXYTAGPMSMFIAYAFVGVLVFFTMAALG 143
           T++++ LK RH+ MIA                   +GP+   IAY F+G +++F   +LG
Sbjct: 91  TQVKRALKQRHLGMIALGGTIGTGLFIGIATPLTNSGPVGSLIAYLFMGSIIYFITQSLG 150

Query: 144 EMASYIPL-DGFTSYASRYCDPALGFAVGYAYLCKYLILPPNQLTAAALVIQYWLDREQV 202
           EMA++IP+    T ++ R+  PA G A GY Y   + I    +++    VI+YW D+  V
Sbjct: 151 EMATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITFAVEISVVGQVIEYWTDK--V 208

Query: 203 NPGVWITIFLVIIVAMNFIGVKFFGEFEFWLSTFKVIVMIGLIILLFVIMLGGGPTHDRL 262
               WI IF V+I  +NF  VK +GE EFW++  KV+ ++G ++   +I+ GG  +   +
Sbjct: 209 PLAAWIAIFWVLITLLNFFPVKVYGEIEFWIAFIKVLAIMGYLLYALIIVCGGS-SQGPI 267

Query: 263 GFRFYDHPGAFKPYSKSIDGSKGKXXXXXXXXXXXXXXXXGIELTGIVAAEAANPRKSIP 322
           GFR++ +PG + P   S D + G+                G EL GI A EAANPRK++P
Sbjct: 268 GFRYWRNPGPWGPGIISKDVNTGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVP 327

Query: 323 KAIKLTMYRIIVFYLVTIFLLGMCVAYDDPLLXXXXXXXXXXXXXPYVVAIINSGIKALP 382
           +AI   ++RI +FY++++F +GM V Y+D  L             P+V++I N+G K LP
Sbjct: 328 RAINKVVFRIALFYIMSLFFIGMLVPYNDERLASTSAVIASS---PFVISIQNAGTKVLP 384

Query: 383 HIFNACVLMFVFSACNSDLYVASRTLYGLAIDNKAPKIFAVTNRWGVPYYSLLMSSCFCL 442
            IFNA V++ + SA NS++YV SR LY LA+   APK FA   R+GVPY  ++++S   L
Sbjct: 385 DIFNAIVMITIISAANSNVYVGSRVLYALALSGNAPKQFAFVTRYGVPYLGVIVTSALGL 444

Query: 443 LAYMSVSSGSAKIFNYFVNVVSIFGLLSWISILITYLCFFRAVKAQNVDRSRFAYRAPFQ 502
           LA++ V++ +   FN+ +N+ ++ GL +W+ I I+++ F +A+K + + R    ++A   
Sbjct: 445 LAFLVVNNNANTAFNWLINISTLAGLCAWLFISISHIRFMQALKFRGISRDDLPFKAKLM 504

Query: 503 PYGSYFTLAFCILIAFIKNFTVFLNHHFDYKNFITGYIGIPVFVISYFGYKFVKKTK-IW 561
           P+G+Y+   F  +I FI+ F  F + H+D   F T YI + +  + + G +   + +  W
Sbjct: 505 PFGAYYATFFVTVIIFIQGFQAF-SPHWDTTAFFTSYISLIILAVLFIGCQIFYRCRFFW 563

Query: 562 KPEEVDLYT----FKAAIDEEEEQGKIAD 586
           + E++D+ +     +A I E++E   + D
Sbjct: 564 RVEDIDIDSDRREIEAVIWEDDEPKTLWD 592

>Skud_15.515 Chr15 complement(924662..926542) [1881 bp, 626 aa] {ON}
           YOR348C (REAL)
          Length = 626

 Score =  326 bits (836), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 186/554 (33%), Positives = 300/554 (54%), Gaps = 23/554 (4%)

Query: 46  DKKDGLDINDMDNLSTVSSR-------LEDSEKQDDYMDDGKDEHTRLRKDLKARHISMI 98
           +K D + +  +    + SS        + D + +     DG +E  +L++ L++RH+ +I
Sbjct: 58  EKDDDIRMEKISKDQSASSNGTIHEELVMDVDLEKSPSADGDNEPRKLKQGLQSRHVQLI 117

Query: 99  AXXXXXXXXXXXXXXXXXYTAGPMSMFIAYAFVGVLVFFTMAALGEMASYIPLDGFTSYA 158
           A                 +T GP  +FI+Y  +  +++  M ALGEM  ++P DG  S  
Sbjct: 118 ALGGAIGTGLLVGTSSTLHTCGPGGLFISYIIISAVIYPIMCALGEMVCFLPGDGSDSAG 177

Query: 159 S------RYCDPALGFAVGYAYLCKYLILPPNQLTAAALVIQYWLDREQVNPGVWITIFL 212
           S      RY D +LGFA G+ Y   Y+IL   + TAA+ V++YW     V  GVWIT+FL
Sbjct: 178 STANLVTRYVDASLGFATGWNYFYCYVILVAAECTAASGVVEYW--TTAVPKGVWITVFL 235

Query: 213 VIIVAMNFIGVKFFGEFEFWLSTFKVIVMIGLIILLFVIMLGGGPTHDRLGFRFYDHPGA 272
           +++V +NF  VK +GE EFW ++ K++ ++GLIIL F++  GGGP HDRLGFR++ HPGA
Sbjct: 236 LVVVLLNFSAVKVYGESEFWFASIKILCIVGLIILSFILFWGGGPKHDRLGFRYWQHPGA 295

Query: 273 FKPYSKSIDGSKGKXXXXXXXXXXXXXX-XXGIELTGIVAAEAANPRKSIPKAIKLTMYR 331
           F  +     GS G                  G EL  + +AE A+ R++I KA +  ++R
Sbjct: 296 FAHHLTG--GSLGNFTDIYTGIIKGAFAFILGPELVCMTSAECADQRRNIAKASRRFVWR 353

Query: 332 IIVFYLVTIFLLGMCVAYDDPLLXXXXXXXX-XXXXXPYVVAIINSGIKALPHIFNACVL 390
           +I FY++    + + V Y+DP+L              P+V+ I N+GIK LPHI N C+L
Sbjct: 354 LIFFYVLGTLSISVIVPYNDPVLVNALAQGKPGAGSSPFVIGIQNAGIKVLPHIINGCIL 413

Query: 391 MFVFSACNSDLYVASRTLYGLAIDNKAPKIFAVTNRWGVPYYSLLMSSCFCLLAYMSVSS 450
              +SA N+ ++ ++R+L  +A   +APK     NRWGVPY ++  S     LAY++VSS
Sbjct: 414 TSAWSAANAFMFASTRSLLTMAQTGQAPKCLGKINRWGVPYVAVAASFLCSCLAYLNVSS 473

Query: 451 GSAKIFNYFVNVVSIFGLLSWISILITYLCFFRAVKAQNVDRSRFAYRAPFQPYGSYFTL 510
            +A +FN+F N+ +I G L WI   I YL F +A+    +   R  ++   QPY  +F+L
Sbjct: 474 STADVFNWFSNISTISGFLGWICGCIAYLRFRKAIFYNGL-YDRLPFKTWGQPYTVWFSL 532

Query: 511 AFCILIAFIKNFTVFLNHHFDYKNFITGYIGIPVFVISYFGYKFVKKT--KIWKP-EEVD 567
               +I     + +F+  ++   +FI  Y+ +P+F++ + G+K   +T  + W P  E+D
Sbjct: 533 IVVSIITITNGYAIFIPKYWKVADFIAAYVTLPIFLVLWLGHKLYTRTWHQWWLPVSEID 592

Query: 568 LYTFKAAIDEEEEQ 581
           +      I+E+  +
Sbjct: 593 VTRGLVEIEEKSRE 606

>KNAG0F00480 Chr6 (73545..75338) [1794 bp, 597 aa] {ON} 
          Length = 597

 Score =  324 bits (831), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 186/542 (34%), Positives = 295/542 (54%), Gaps = 27/542 (4%)

Query: 60  STVSSRLEDSEKQDDYMDDGKDE------HTRLRKDLKARHISMIAXXXXXXXXXXXXXX 113
           S   SRL +S   D    DG DE       T++++ LK RHI MIA              
Sbjct: 61  SLTRSRL-NSRVDDGAESDGSDELEAEVHETKVKRALKQRHIGMIALGGTIGTGLFVGIS 119

Query: 114 XXXYTAGPMSMFIAYAFVGVLVFFTMAALGEMASYIPL-DGFTSYASRYCDPALGFAVGY 172
                AGP+   IAY F+G +++F   +LGEMA++IP+    T ++ R+  PA G A GY
Sbjct: 120 TPLSVAGPVGSLIAYIFMGTIIYFVTQSLGEMATFIPVTSSITVFSKRFLSPAFGVANGY 179

Query: 173 AYLCKYLILPPNQLTAAALVIQYWLDREQVNPGVWITIFLVIIVAMNFIGVKFFGEFEFW 232
            Y   + I    +++    VIQYW   + V    WI IF V++  MNF  VK +GE EFW
Sbjct: 180 MYWFNWAITYAVEISVIGQVIQYW--TKAVPLAAWIAIFWVLVTLMNFFPVKVYGEVEFW 237

Query: 233 LSTFKVIVMIGLIILLFVIMLGG---GPTHDRLGFRFYDHPGAFKPYSKSIDGSKGKXXX 289
           ++  KV+ ++G +I   VI+ GG   GP    +GFR++ HPGAF P   S + + GK   
Sbjct: 238 IAFVKVLAIVGYLIYALVIVCGGSHQGP----IGFRYWRHPGAFGPGIISKNKNTGKFLG 293

Query: 290 XXXXXXXXXXXXXGIELTGIVAAEAANPRKSIPKAIKLTMYRIIVFYLVTIFLLGMCVAY 349
                        G EL GI A EAANPRK++P+AI   ++RI++FY++++F +GM + Y
Sbjct: 294 WVASLINAAFTYQGTELVGITAGEAANPRKTVPRAINKVVFRIVLFYIMSLFFIGMLLPY 353

Query: 350 DDPLLXXXXXXXXXXXXXPYVVAIINSGIKALPHIFNACVLMFVFSACNSDLYVASRTLY 409
           +D  L             P+V++I N+  K LP IFNA V++ V SA NS++YV SR LY
Sbjct: 354 NDKRLSAQDAVIASS---PFVISIKNAHTKVLPDIFNAVVMVTVMSAANSNVYVGSRVLY 410

Query: 410 GLAIDNKAPKIFAVTNRWGVPYYSLLMSSCFCLLAYMSVSSGSAKIFNYFVNVVSIFGLL 469
            LA+   APK F+   R+GVPY  ++ ++   LLA++ V++ +   FN+ +N+ ++ GL 
Sbjct: 411 ALALTGNAPKQFSYVTRYGVPYLGVVCTASLGLLAFLVVNNNANTAFNWLINISTLAGLC 470

Query: 470 SWISILITYLCFFRAVKAQNVDRSRFAYRAPFQPYGSYFTLAFCILIAFIKNFTVFLNHH 529
           +W+ I + ++ F +A+K + + R    ++A   P+G+Y+   F  +I FI+ +  F    
Sbjct: 471 AWLFISLAHIRFMQALKFRGISRDDLPFKAKLMPWGAYYAAFFVTVIIFIQGYQAFC--P 528

Query: 530 FDYKNFITGYIGIPVFVISYFGYKFVKKTK-IWKPEEVDLYTFKAAID----EEEEQGKI 584
           +D   F T YI + +  +   G +   + + + K E++D+ T +  I+    E++E   +
Sbjct: 529 WDVSTFFTSYISLILLAVLVVGCQLYYRGRFLLKLEDIDIDTDRREIESIVWEDDEPKTL 588

Query: 585 AD 586
            D
Sbjct: 589 WD 590

>Kpol_2000.65 s2000 (134897..136684) [1788 bp, 595 aa] {ON}
           (134897..136684) [1788 nt, 596 aa]
          Length = 595

 Score =  323 bits (829), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 177/501 (35%), Positives = 284/501 (56%), Gaps = 9/501 (1%)

Query: 68  DSEKQDDYMDDGKDEHTRLRKDLKARHISMIAXXXXXXXXXXXXXXXXXYTAGPMSMFIA 127
             ++ + Y+D G  +   ++++LK RHI MIA                   AGP+   IA
Sbjct: 71  SGDEDEPYVDQGVVQDAEVKRELKQRHIGMIALGGTIGTGLFIGISTPLKNAGPVGSLIA 130

Query: 128 YAFVGVLVFFTMAALGEMASYIPL-DGFTSYASRYCDPALGFAVGYAYLCKYLILPPNQL 186
           Y F+  +VF    +LGEMA++IP+   FT ++SR+  P++G A GY Y   + I    +L
Sbjct: 131 YLFMATIVFSVTQSLGEMATFIPVTSSFTVFSSRFISPSIGAANGYMYWFSWAITFALEL 190

Query: 187 TAAALVIQYWLDREQVNPGVWITIFLVIIVAMNFIGVKFFGEFEFWLSTFKVIVMIGLII 246
           +    +IQ+W D   V    WI I+  I+  MN   VKF+GEFEFW+++ KVI ++G +I
Sbjct: 191 SVVGQIIQFWTD--AVPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLI 248

Query: 247 LLFVIMLGGGPTHDRLGFRFYDHPGAFKPYSKSIDGSKGKXXXXXXXXXXXXXXXXGIEL 306
               ++ G G T   +GFR++ +PG + P   S   ++G+                G EL
Sbjct: 249 YCLCMVCGAGVT-GPVGFRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTEL 307

Query: 307 TGIVAAEAANPRKSIPKAIKLTMYRIIVFYLVTIFLLGMCVAYDDPLLXXXXXXXXXXXX 366
            GI A EAANPRK++P+AIK   +RI++FY++++F +G+ V +DDP L            
Sbjct: 308 VGITAGEAANPRKTVPRAIKKVSFRILIFYILSLFFIGLLVPFDDPKLSSDDSYVSSS-- 365

Query: 367 XPYVVAIINSGIKALPHIFNACVLMFVFSACNSDLYVASRTLYGLAIDNKAPKIFAVTNR 426
            P+++AI NSG K LPHIFNA +L  + SA NS++YV SR ++GLA    AP+ F +T +
Sbjct: 366 -PFIIAIQNSGTKVLPHIFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTK 424

Query: 427 WGVPYYSLLMSSCFCLLAYMSVSSGSAKIFNYFVNVVSIFGLLSWISILITYLCFFRAVK 486
            GVPY ++L +S F  LA++ VSSG AK FN+ +N+V + G  +W+ I I ++ F + ++
Sbjct: 425 HGVPYIAVLFTSAFGALAFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLE 484

Query: 487 AQNVDRSRFAYRAPFQPYGSYFTLAFCILIAFIKNFTVFLNHHFDYKNFITGYIGIPVFV 546
            + + R    ++A   P+ +Y+ + F I+I  I+ FT F    F+  +F+  YI + +F 
Sbjct: 485 HRGISRDDLPFKAALMPWLAYYAIFFMIIIIIIQGFTAF-APTFNGSDFVAAYISVFLFF 543

Query: 547 ISYFGYKFVKKTKI-WKPEEV 566
             +  ++   + K+ W  +EV
Sbjct: 544 FLWVSFQLYFRCKLYWSLDEV 564

>Smik_14.68 Chr14 (117603..119438) [1836 bp, 611 aa] {ON} YEL063C
           (REAL)
          Length = 611

 Score =  324 bits (830), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 177/502 (35%), Positives = 281/502 (55%), Gaps = 14/502 (2%)

Query: 85  RLRKDLKARHISMIAXXXXXXXXXXXXXXXXXYTAGPMSMFIAYAFVGVLVFFTMAALGE 144
            +++ LK RHI MIA                   AGP+   IAY F+G +++F   +LGE
Sbjct: 105 HVKRALKQRHIGMIALGGTIGTGLFVGISTPLSNAGPVGSLIAYIFMGTVIYFITQSLGE 164

Query: 145 MASYIPL-DGFTSYASRYCDPALGFAVGYAYLCKYLILPPNQLTAAALVIQYWLDREQVN 203
           MA++IP+    T ++ R+  PA G + GY Y   + I    +++    VIQYW D+  V 
Sbjct: 165 MATFIPVTSSITVFSKRFLSPAFGVSNGYMYWFNWAITYAVEVSVIGQVIQYWTDK--VP 222

Query: 204 PGVWITIFLVIIVAMNFIGVKFFGEFEFWLSTFKVIVMIGLIILLFVIMLGGGPTHDRLG 263
              WI IF V+I  MNF  VK +GEFEFW+++ KV+ ++G +I   VI+ GG      +G
Sbjct: 223 LAAWIAIFWVLITLMNFFPVKVYGEFEFWVASVKVLAIVGYLIYALVIVCGGS-HQGPIG 281

Query: 264 FRFYDHPGAFKPYSKSIDGSKGKXXXXXXXXXXXXXXXXGIELTGIVAAEAANPRKSIPK 323
           FR++ +PGA+ P   S + S+G+                G EL GI A EAANPRK++P+
Sbjct: 282 FRYWRNPGAWGPGIISKNKSEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVPR 341

Query: 324 AIKLTMYRIIVFYLVTIFLLGMCVAYDDPLLXXXXXXXXXXXXXPYVVAIINSGIKALPH 383
           AI   ++RI++FY++++F +G+ V Y++P L             P+V++I N+G  ALP 
Sbjct: 342 AINKVVFRIVIFYIMSLFFIGLLVPYNEPRLSPSSAVIASS---PFVISIQNAGTYALPD 398

Query: 384 IFNACVLMFVFSACNSDLYVASRTLYGLAIDNKAPKIFAVTNRWGVPYYSLLMSSCFCLL 443
           IFNA VL+ V SA NS++YV SR LY LA    APK F    + GVPY  +L ++   LL
Sbjct: 399 IFNAVVLITVISAANSNVYVGSRVLYSLAQSGNAPKQFGYVTKQGVPYMGVLSTAALGLL 458

Query: 444 AYMSVSSGSAKIFNYFVNVVSIFGLLSWISILITYLCFFRAVKAQNVDRSRFAYRAPFQP 503
           A++ V++ +   FN+ +++ ++ GL +W+ I + ++ F +A+K + + R    ++A   P
Sbjct: 459 AFLVVNNNANTAFNWLISISTLAGLCAWLFISLAHIRFMQALKQRGISRDDLPFKAKLMP 518

Query: 504 YGSYFTLAFCILIAFIKNFTVFLNHHFDYKNFITGYIGIPVFVISYFGYKFVKKTK-IWK 562
           YG+Y+   F  +I FI+ F  F    F    F T YI + +  + +   +   K + IWK
Sbjct: 519 YGAYYASFFVTIIIFIQGFQAFC--PFSVSEFFTSYISLILLAVVFISCQLYYKCRFIWK 576

Query: 563 PEEVDLYT----FKAAIDEEEE 580
            E++D+ +     +A I E++E
Sbjct: 577 LEDIDIDSDRREIEAIIWEDDE 598

>TPHA0B04470 Chr2 complement(1047097..1048896) [1800 bp, 599 aa]
           {ON} Anc_1.84 YNL268W
          Length = 599

 Score =  323 bits (828), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 184/554 (33%), Positives = 301/554 (54%), Gaps = 22/554 (3%)

Query: 52  DINDMDNLSTVSSRLEDSEKQDDYMDDGKDEHTRLRKDLKARHISMIAXXXXXXXXXXXX 111
           +++  DN S  +  L+ S+ ++     G  + TR+++ LK RHI MIA            
Sbjct: 64  NVSVADNSSAANGDLDLSDTEEA----GHVQDTRVKRALKQRHIGMIALGGTIGTGLFVG 119

Query: 112 XXXXXYTAGPMSMFIAYAFVGVLVFFTMAALGEMASYIPL-DGFTSYASRYCDPALGFAV 170
                  AGP+   IAY F+G +++F   +LGEMA++IP+    T ++ R+  PA G   
Sbjct: 120 ISTPLGNAGPVGALIAYIFMGSIIYFITQSLGEMATFIPVTSSITVFSKRFLSPAFGVTN 179

Query: 171 GYAYLCKYLILPPNQLTAAALVIQYWLDREQVNPGVWITIFLVIIVAMNFIGVKFFGEFE 230
           GY Y   + I    +++    VIQYW D   V    WI IF V +  +NF  VK +GE E
Sbjct: 180 GYMYWFNWAITYAVEISVVGQVIQYWTD--AVPLAAWIAIFWVFVTLLNFFPVKVYGEVE 237

Query: 231 FWLSTFKVIVMIGLIILLFVIMLGGGPTHDRLGFRFYDHPGAFKPYSKSIDGSKGKXXXX 290
           FW+++ KV+ +IG +I   VI+ GG  +   +GFR++ +PG + P   S D ++G+    
Sbjct: 238 FWVASIKVLAIIGYLIYALVIVCGGS-SQGPIGFRYWRNPGPWGPGIISKDVNEGRFLGW 296

Query: 291 XXXXXXXXXXXXGIELTGIVAAEAANPRKSIPKAIKLTMYRIIVFYLVTIFLLGMCVAYD 350
                       G EL GI A EAANPRKS+P+AI   ++RI +FY++++F +G+ V Y+
Sbjct: 297 VSSLINAAFTYQGTELVGITAGEAANPRKSVPRAINKVVFRIALFYIMSLFFIGLLVPYN 356

Query: 351 DPLLXXXXXXXXXXXXXPYVVAIINSGIKALPHIFNACVLMFVFSACNSDLYVASRTLYG 410
           D  L             P+V++I N+G  ALP IFNA V++ + SA NS++YV SR LY 
Sbjct: 357 DHTLSSGDSYIASS---PFVISIQNAGTYALPDIFNAVVMLTIISAANSNVYVGSRVLYA 413

Query: 411 LAIDNKAPKIFAVTNRWGVPYYSLLMSSCFCLLAYMSVSSGSAKIFNYFVNVVSIFGLLS 470
           LA    APK FA   + GVP+  +++++   LLA++ V++ +   FN+ +N+ ++ GL +
Sbjct: 414 LAQTGNAPKQFAYVTKHGVPWLGVIVTASLGLLAFLVVNNNANTAFNWLINISTLAGLCA 473

Query: 471 WISILITYLCFFRAVKAQNVDRSRFAYRAPFQPYGSYFTLAFCILIAFIKNFTVFLNHHF 530
           W  I ++++ F +A+K + + R    ++A   P+G+Y++  F  +I FI+ F  F    +
Sbjct: 474 WFFIALSHIRFMQALKYRGISRDDLPFKAKLMPWGAYYSAFFVFVIIFIQGFEAF--TPW 531

Query: 531 DYKNFITGYIGIPVFVISYFGYKFVKKTK-IWKPEEVDLYTFKAAIDEEEEQGKIADAER 589
           D   F T YI + + V+ + G +   + + + K E++D+ T     D  E +  I + + 
Sbjct: 532 DTTTFFTSYISLILLVVVFIGCQLYYRCRFLLKVEDIDIDT-----DRREIEAIIWEDDE 586

Query: 590 RERLKNSKTKGWDW 603
               KN   K W W
Sbjct: 587 P---KNLWEKFWAW 597

>SAKL0F09790g Chr6 (750158..751834) [1677 bp, 558 aa] {ON} similar
           to uniprot|P15380 Saccharomyces cerevisiae YOR348C PUT4
           proline-specific permease (also capable of transporting
           alanine and glycine) putative proline- specific permease
          Length = 558

 Score =  322 bits (824), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 186/527 (35%), Positives = 288/527 (54%), Gaps = 12/527 (2%)

Query: 61  TVSSRLEDSEKQDDYMDDGKDEHTRLRKDLKARHISMIAXXXXXXXXXXXXXXXXXYTAG 120
           T S  L   E Q   ++  K +   L K L +RHI +IA                 +  G
Sbjct: 24  TYSGTLNQLESQ---LEGTKCDENNLEKGLSSRHIQLIALGGCIGTGLFVGTSSTLHNCG 80

Query: 121 PMSMFIAYAFVGVLVFFTMAALGEMASYIPLDG-FTSYASRYCDPALGFAVGYAYLCKYL 179
           P+ +F+++  +  +V+  M  L EM  Y+P  G      SRY DP+LGFA G+ Y   Y 
Sbjct: 81  PLPLFLSFVIISFIVYPVMNTLAEMICYLPQQGTVPELTSRYVDPSLGFAAGWNYAYSYS 140

Query: 180 ILPPNQLTAAALVIQYWLDREQVNPGVWITIFLVIIVAMNFIGVKFFGEFEFWLSTFKVI 239
           IL   +L+AAA V+QYW D+  V   VWITIFLVI+V +NF  VKF+GE EFW ++ K+I
Sbjct: 141 ILVATELSAAAGVVQYWTDKVHV--AVWITIFLVIVVGLNFAPVKFYGESEFWFASLKII 198

Query: 240 VMIGLIILLFVIMLGGGPTHDRLGFRFYDHPGAFKPYSKSIDGSKGKXX-XXXXXXXXXX 298
            ++GL+I+  VI  GG P+HDRLGFR++++PG F  +     G+ G+             
Sbjct: 199 CILGLLIVSIVIFFGGAPSHDRLGFRYWNNPGPFAYHITG--GNTGRFLDIWTAIIKSGF 256

Query: 299 XXXXGIELTGIVAAEAANPRKSIPKAIKLTMYRIIVFYLVTIFLLGMCVAYDDP-LLXXX 357
                 EL G+   EA + R++I KA +  ++RII FY+ +   +G  ++ DDP L+   
Sbjct: 257 AFILSPELIGLACVEAKDTRRNIEKASRRFIWRIIFFYITSTLCIGFILSRDDPKLIQAL 316

Query: 358 XXXXXXXXXXPYVVAIINSGIKALPHIFNACVLMFVFSACNSDLYVASRTLYGLAIDNKA 417
                     P+V  I N+GI  L HI NA +L   +S+ NS +Y +SR++  LA    A
Sbjct: 317 TSDAPGAASSPFVQGISNAGIPVLNHIINAVILSSAWSSANSFMYASSRSILALAKQGDA 376

Query: 418 PKIFAVTNRWGVPYYSLLMSSCFCLLAYMSVSSGSAKIFNYFVNVVSIFGLLSWISILIT 477
           PK+F   NR GVPY ++ +S+    L Y++ SS SA++F +  N+ +I G + W  I IT
Sbjct: 377 PKVFTRINRLGVPYNAVALSTAVSCLTYLNASSSSAQVFTWLSNICTISGFIGWALIGIT 436

Query: 478 YLCFFRAVKAQNVDRSRFAYRAPFQPYGSYFTLAFCILIAFIKNFTVFLNHHFDYKNFIT 537
           YL F +A+   N+   R  +++  QPY +YF + F +L+     +  F+  +++  +F+ 
Sbjct: 437 YLRFRKAIFYNNL-YERVPFKSALQPYFTYFFVVFVVLLCLTNGYATFIPKYWNASDFVA 495

Query: 538 GYIGIPVFVISYFGYKFVKKTKIWKP-EEVDLYTFKAAIDEEEEQGK 583
            YI +P+F + Y G+K   KT+ + P  E+D+ T  A  +EE +  +
Sbjct: 496 AYITLPIFFLLYLGHKIWFKTRWYIPFREIDVITGLADAEEEAKMTQ 542

>Skud_14.70 Chr14 complement(124390..126111) [1722 bp, 573 aa] {ON}
           YNL270C (REAL)
          Length = 573

 Score =  322 bits (825), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 179/518 (34%), Positives = 286/518 (55%), Gaps = 11/518 (2%)

Query: 63  SSRLEDSEKQDDYMDDGKDEHTRLRKDLKARHISMIAXXXXXXXXXXXXXXXXXYTAGPM 122
           SS   D  K  +     + E   +++ LK RHI MIA                   AGP+
Sbjct: 46  SSIENDGAKGTETSPRSRGE---VQRKLKERHIGMIALGGTIGTGLIIGIGPPLAHAGPV 102

Query: 123 SMFIAYAFVGVLVFFTMAALGEMASYIPL-DGFTSYASRYCDPALGFAVGYAYLCKYLIL 181
              I+Y F+G +++    +LGEMA++IP+   F+ +A R+  PALG   GY Y   +   
Sbjct: 103 GALISYLFMGTVIYSVTQSLGEMATFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWCFT 162

Query: 182 PPNQLTAAALVIQYWLDREQVNPGVWITIFLVIIVAMNFIGVKFFGEFEFWLSTFKVIVM 241
              +L+    +IQYW     V    WI IF  ++  MN   VK++GEFEF +++ KVI +
Sbjct: 163 FALELSVLGQIIQYW--THAVPLAAWIVIFWCLLTLMNMFPVKYYGEFEFCIASIKVITL 220

Query: 242 IGLIILLFVIMLGGGPTHDRLGFRFYDHPGAFKPYSKSIDGSKGKXXXXXXXXXXXXXXX 301
           +G II  F I+ G G     +GFR++ +PGA+ P   S + ++G+               
Sbjct: 221 LGFIIFSFCIVCGAGQPDGPIGFRYWRNPGAWGPGIISSNKNEGRFLGWVSSLINAAFTY 280

Query: 302 XGIELTGIVAAEAANPRKSIPKAIKLTMYRIIVFYLVTIFLLGMCVAYDDPLLXXXXXXX 361
            G EL GI A EAANPRK++P+AIK  + RI+VFY++++F +G+ V Y+DP L       
Sbjct: 281 QGTELVGITAGEAANPRKAVPRAIKKVVIRILVFYILSLFFIGLLVPYNDPKLDSDGTFV 340

Query: 362 XXXXXXPYVVAIINSGIKALPHIFNACVLMFVFSACNSDLYVASRTLYGLAIDNKAPKIF 421
                 P++++I NSG K LP IFNA VL+ +FSA NS++Y+ SR LY L+ ++ APK  
Sbjct: 341 SAS---PFMISIENSGTKVLPDIFNAVVLITIFSAGNSNVYIGSRVLYSLSKNSLAPKCL 397

Query: 422 AVTNRWGVPYYSLLMSSCFCLLAYMSVSSGSAKIFNYFVNVVSIFGLLSWISILITYLCF 481
           +   R GVPY ++L++S F  LA++  S+GS K FN+ +N+  + G  +W+ I  +++ F
Sbjct: 398 SNVTRGGVPYLAVLLTSLFGFLAFLETSAGSGKAFNWLLNITGVAGFFAWLLISFSHIRF 457

Query: 482 FRAVKAQNVDRSRFAYRAPFQPYGSYFTLAFCILIAFIKNFTVFLNHHFDYKNFITGYIG 541
            +A+K + + R    Y+A   P+ +Y+   F  LI  I+ FT F    F   +F+  YI 
Sbjct: 458 MQAIKKRGISRDDLPYKARMMPFLAYYASFFIALIVLIQGFTAF-APTFQPVDFVAAYIS 516

Query: 542 IPVFVISYFGYKFVKKTK-IWKPEEVDLYTFKAAIDEE 578
           + +F I +  ++   K + I K +++D+ + +  I+E+
Sbjct: 517 VFLFAIIWLSFQLWFKCRLICKLQDIDIDSDRREIEEQ 554

>NDAI0E03800 Chr5 (829594..831459) [1866 bp, 621 aa] {ON} Anc_7.44
          Length = 621

 Score =  323 bits (827), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 183/533 (34%), Positives = 295/533 (55%), Gaps = 21/533 (3%)

Query: 55  DMDNLSTVSSRLEDSEKQDDYMDDGKDEHT---RLRKDLKARHISMIAXXXXXXXXXXXX 111
             D L T S  + DS   +   + GK+  +    L++ LK+RHI +IA            
Sbjct: 62  SQDELQTTSPTIIDSIDDEAEKEQGKERSSSNGELKQGLKSRHIQLIALGGTIGTSLLVG 121

Query: 112 XXXXXYTAGPMSMFIAYAFVGVLVFFTMAALGEMASYIPLDGFTSYAS------RYCDPA 165
                   GP  +FI+Y  +   V+  M ALGEM  ++P +G  S  S      +Y DP+
Sbjct: 122 TSSALANCGPAGLFISYLIISTFVYPIMNALGEMVCFLPGNGSDSAGSAAHLVHKYVDPS 181

Query: 166 LGFAVGYAYLCKYLILPPNQLTAAALVIQYWLDREQVNPGVWITIFLVIIVAMNFIGVKF 225
           LGFA  + Y   ++IL   +++AA+ VI+YW   E V  G WITIFL +IV +NF+ V  
Sbjct: 182 LGFAASWNYYYCFVILVAAEVSAASGVIEYWAWAEHVPKGAWITIFLSLIVILNFLPVNV 241

Query: 226 FGEFEFWLSTFKVIVMIGLIILLFVIMLGGGPTHDR-LGFRFYDHPGAFKPYSKSIDGSK 284
           +GE EFW ++ K++ + GLIIL F++  GGGP  D  LGFR++ +PG+F  +   I G  
Sbjct: 242 YGESEFWFASIKILCITGLIILSFILFWGGGPKSDGILGFRYWKNPGSFAHH---ITGGG 298

Query: 285 GKXXXXXXXXXXXX--XXXXGIELTGIVAAEAANPRKSIPKAIKLTMYRIIVFYLVTIFL 342
           G                   G EL  + ++E A+ R++I KA K  ++R++ FY++    
Sbjct: 299 GGNFLDIYTGIIKGGFSVILGPELVCLTSSECADQRRNIAKASKRFVWRLMFFYILGSLS 358

Query: 343 LGMCVAYDDPLLXXXXXXXXXXX-XXPYVVAIINSGIKALPHIFNACVLMFVFSACNSDL 401
           +G+ VAY+DP+L              P+V+ I N+GI+A+PHI N C+L   +SA N+ +
Sbjct: 359 IGVIVAYNDPVLQNALAQSKAGAGSSPFVIGIQNAGIRAVPHIVNFCILTSAWSAGNAYM 418

Query: 402 YVASRTLYGLAIDNKAPKIFAVTNRWGVPYYSLLMSSCFCLLAYMSVSSGSAKIFNYFVN 461
           + +SR+L  +A +  APKIF   N+ GVPY ++  S     LAY++VSS +A +FN+F N
Sbjct: 419 FASSRSLLTMARNGNAPKIFCRINQLGVPYTAVGASLLLSCLAYLNVSSSTADVFNWFSN 478

Query: 462 VVSIFGLLSWISILITYLCFFRAVKAQNVDRSRFAYRAPFQPYGSYFTLAFCILIAFIKN 521
           + +I G + WI   + Y+ F +A+    +   R  +RA  Q Y  +++L +  LI     
Sbjct: 479 ISTISGFIGWICACVAYIRFRKAITYNKLTH-RIPFRAKGQQYTIWYSLFWVSLITLTNG 537

Query: 522 FTVFLNHHFDYKNFITGYIGIPVFVISYFGYKFVKKT--KIW-KP-EEVDLYT 570
           + +F+  +++ K+FI  YI +P+F++ + G+K   +T  K W +P +++D+YT
Sbjct: 538 YAIFIPRNWNVKDFIAAYITLPIFIVLWIGHKVFTRTLLKAWLRPIDKIDVYT 590

>KLLA0C02343g Chr3 complement(203552..205297) [1746 bp, 581 aa] {ON}
           similar to uniprot|P04817 Saccharomyces cerevisiae
           YEL063C CAN1 Plasma membrane arginine permease requires
           phosphatidyl ethanolamine (PE) for localization
           exclusively associated with lipid rafts mutation confers
           canavanine resistance
          Length = 581

 Score =  322 bits (824), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 171/507 (33%), Positives = 287/507 (56%), Gaps = 8/507 (1%)

Query: 57  DNLSTVSSRLEDSEKQDDYMDDGKDEHTRLRKDLKARHISMIAXXXXXXXXXXXXXXXXX 116
           DN  T+ +  +DS +  D   +G      +++ LK RH+SMIA                 
Sbjct: 46  DNNLTLEAIDDDSSRMFD--PEGSIGQAEVKRALKPRHVSMIALGGTIGTGLFISISGPL 103

Query: 117 YTAGPMSMFIAYAFVGVLVFFTMAALGEMASYIPL-DGFTSYASRYCDPALGFAVGYAYL 175
           + AGP+   IA+  +G L +    +LGEMA++IP+   FT ++ R+  PA+G A GY Y 
Sbjct: 104 WNAGPVGSLIAFMLIGTLAYSVTQSLGEMATFIPVTSSFTVFSQRFISPAVGAANGYMYW 163

Query: 176 CKYLILPPNQLTAAALVIQYWLDREQVNPGVWITIFLVIIVAMNFIGVKFFGEFEFWLST 235
             + I    +L+    +IQYW D   +    WI IF V++V+ N   VK++GEFEFW+++
Sbjct: 164 FSWAITFALELSIVGQIIQYWTDAVPLE--AWIAIFWVLLVSFNMFPVKWYGEFEFWVAS 221

Query: 236 FKVIVMIGLIILLFVIMLGGGPTHDRLGFRFYDHPGAFKPYSKSIDGSKGKXXXXXXXXX 295
            KVI +IG +I    ++ G GP    +GFR++  PG +     + + +K +         
Sbjct: 222 IKVIAIIGFLIYSLCMVCGAGP-EGPIGFRYWRKPGPWGNGIIAKNVNKARFLGWVSSLI 280

Query: 296 XXXXXXXGIELTGIVAAEAANPRKSIPKAIKLTMYRIIVFYLVTIFLLGMCVAYDDPLLX 355
                  G EL GI A E  NPRK++P+AI    +RI++FY+ ++F +G+ V Y+DP L 
Sbjct: 281 SAAFTYQGTELVGITAGETKNPRKAVPRAINKVFFRILIFYIGSLFFIGLLVPYNDPKLE 340

Query: 356 XXXXXXXXXXXXPYVVAIINSGIKALPHIFNACVLMFVFSACNSDLYVASRTLYGLAIDN 415
                       P+++AI+N     LPHIFNA +L  + SA NS++YV SR L+GL+ +N
Sbjct: 341 GSDNGSYIAQS-PFLIAILNCRTPVLPHIFNAVILTTIISAGNSNVYVGSRILFGLSKNN 399

Query: 416 KAPKIFAVTNRWGVPYYSLLMSSCFCLLAYMSVSSGSAKIFNYFVNVVSIFGLLSWISIL 475
            APK F+ T + GVP+ ++L+++ F  LAY++VS+ + ++F++ +N+ +I G ++W+ I 
Sbjct: 400 LAPKFFSKTTKHGVPFIAVLITAVFGFLAYLNVSNDAQEVFDWLLNITAIAGFITWLLIS 459

Query: 476 ITYLCFFRAVKAQNVDRSRFAYRAPFQPYGSYFTLAFCILIAFIKNFTVFLNHHFDYKNF 535
           I+++ F + +K + + R    Y+A F PY +Y+   F  +I  I+ FT F   HF+  +F
Sbjct: 460 ISHIRFMQTLKHRGISRDDLPYKAKFMPYAAYYAAFFITVIIIIQGFTAF-APHFNVSDF 518

Query: 536 ITGYIGIPVFVISYFGYKFVKKTKIWK 562
              YI + +F I +  ++ + +TK+++
Sbjct: 519 FAAYISVFLFFIVWAIFQTIYRTKLFR 545

>KLLA0F23419g Chr6 complement(2187386..2189107) [1722 bp, 573 aa]
           {ON} similar to uniprot|P15380 Saccharomyces cerevisiae
           YOR348C PUT4 proline-specific permease (also capable of
           transporting alanine and glycine) putative proline-
           specific permease
          Length = 573

 Score =  319 bits (817), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 199/575 (34%), Positives = 304/575 (52%), Gaps = 33/575 (5%)

Query: 46  DKKDGLDINDMDNLSTVSSRLEDSEKQDDYMDDGKDEHTRLRKDLKARHISMIAXXXXXX 105
           DK+ G  + ++D    ++S   DSEK     +  +     L+K LK+ HI +IA      
Sbjct: 17  DKQTG-QVYELD----LTSYSNDSEKNGSLPNKPQSGDHNLKKGLKSAHIQLIAIGGCIG 71

Query: 106 XXXXXXXXXXXYTAGPMSMFIAYAFVGVLVFFTMAALGEMASYIPL--------DGFTSY 157
                      Y  GP  +FI+Y  +  +++  M AL EM  ++P            ++ 
Sbjct: 72  TGLFVGTSSTLYKCGPAGLFISYCIMSTIIYPVMNALAEMVCFLPGLPDENETGGSISTL 131

Query: 158 ASRYCDPALGFAVGYAYLCKYLILPPNQLTAAALVIQYWLDREQVNPGVWITIFLVIIVA 217
            +RY D +LGFAVG+ Y+  Y+IL   + TAA+ V+ YW     V    WITIFL IIV 
Sbjct: 132 CTRYVDSSLGFAVGWNYVYCYVILVAAECTAASGVVTYW--TTAVPKAAWITIFLGIIVV 189

Query: 218 MNFIGVKFFGEFEFWLSTFKVIVMIGLIILLFVIMLGGGPTHDRLGFRFYDHPGAFKPYS 277
           +N   V+F+G  E    + K+  ++G+II+  V+  GGGP HDRLGFRF+  PGA+  + 
Sbjct: 190 LNCTAVEFYGTSEAIFCSLKIFCILGIIIVSIVLFFGGGPNHDRLGFRFWKDPGAWAYHL 249

Query: 278 KSIDGSKGKXXXXXXXXXXXXXX-XXGIELTGIVAAEAANPRKSIPKAIKLTMYRIIVFY 336
              DG  G+                 G EL  + + EA + R++I KA +  ++R+I FY
Sbjct: 250 A--DGGAGRLSDIITGVIRAGFAFILGPELVVLTSTEAQDSRRNIEKAARRFVWRLIFFY 307

Query: 337 LVTIFLLGMCVAYDDP-LLXXXXXXXXXXXXXPYVVAIINSGIKALPHIFNACVLMFVFS 395
            V+    G+ V+ +DP LL             P+V+ I N+GIK LPHI N C+L   +S
Sbjct: 308 CVSSLCAGVIVSRNDPVLLNALSQGKPGAGSSPFVIGIQNAGIKVLPHIINVCILSSAWS 367

Query: 396 ACNSDLYVASRTLYGLAIDNKAPKIFAVTNRWGVPYYSLLMSSCFCLLAYMSVSSGSAKI 455
           + NS +Y  +R+L  L+ +  APKIF   NRWGVPY  +  ++ F  LAY++VSS +A +
Sbjct: 368 SGNSFMYATTRSLLSLSQEGYAPKIFNRVNRWGVPYTGVAFATAFSCLAYLNVSSSTADV 427

Query: 456 FNYFVNVVSIFGLLSWISILITYLCFFRAVKAQNVDRSRFAYRAPFQPYGSYFTLAFCIL 515
           FN+F N+ +I G L WI   + YL F +AV   N+   R  ++ PFQPY ++F +    +
Sbjct: 428 FNWFSNISTISGFLGWICSGVAYLRFRKAVFFNNL-YDRLPFKTPFQPYFTWFYIILIAI 486

Query: 516 IAFIKNFTVFLNHHFDYKNFITGYIGIPVFVISYFGYKFVKKTKIWKP-----EEVDLYT 570
           I  I  +  F+  H++YK+FI  YI +P+F+I + G+K    T+ W        E+D+ T
Sbjct: 487 ICLINGYESFV--HWNYKDFIAAYITLPLFLILWLGHK--AYTRTWSQWMISVSEIDVTT 542

Query: 571 FKAAIDEEEEQGKIADAERRERLKNSKTKGWDWFY 605
               + E EE+ K  +A RR   +N   K  +W +
Sbjct: 543 ---GLREIEEETKELNA-RRIPPRNLWEKILEWLF 573

>KNAG0E00390 Chr5 (61730..63529) [1800 bp, 599 aa] {ON} Anc_7.44
           YOR348C
          Length = 599

 Score =  319 bits (818), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 188/573 (32%), Positives = 305/573 (53%), Gaps = 31/573 (5%)

Query: 51  LDINDMDNLS--TVSSRLEDSEKQ-DDYMDDGKDEHTRLRKDLKARHISMIAXXXXXXXX 107
           +D+    + S  T+S +L D +   D + ++G      L++ LK+RHI MIA        
Sbjct: 44  VDVESQQSTSSATISEKLGDGDGDADPFANEGS-----LQQGLKSRHIQMIALGGAIGTG 98

Query: 108 XXXXXXXXXYTAGPMSMFIAYAFVGVLVFFTMAALGEMASYIPLDGFTSYAS------RY 161
                       GP  +FI+Y  +  +V+  M   GEM  Y+P +G  +  S      RY
Sbjct: 99  LFVGTSSTLALCGPAGLFISYIIISSVVYPIMCGFGEMVCYLPGNGNDASGSAAHLVARY 158

Query: 162 CDPALGFAVGYAYLCKYLILPPNQLTAAALVIQYWLDREQVNPGVWITIFLVIIVAMNFI 221
            D +LGFA  + Y   Y+IL   + TAA+ V++YW     V  GVWI IFL I+V +NF 
Sbjct: 159 VDKSLGFATAWNYYYCYIILVAAECTAASGVVEYW--TVAVPKGVWILIFLGIVVILNFG 216

Query: 222 GVKFFGEFEFWLSTFKVIVMIGLIILLFVIMLGGGPTHDRLGFRFYDHPGAFKPYSKSID 281
            VK++GE EFW ++ K++ ++GLIIL F++  GGGP HDRLGFR++  PGAF  +   + 
Sbjct: 217 PVKYYGEAEFWFASIKILCIVGLIILSFILFWGGGPNHDRLGFRYWQRPGAFTEHI--MK 274

Query: 282 GSKGKXXXXXXXXXXXXXX-XXGIELTGIVAAEAANPRKSIPKAIKLTMYRIIVFYLVTI 340
           G  G+                 G EL  + +AE  + R++I KA +  ++R++ FY++  
Sbjct: 275 GGFGRFLDIYSGVIKGGFAFILGPELVCLTSAECEDQRRNIAKAARRFIWRLMFFYVLGT 334

Query: 341 FLLGMCVAYDDP-LLXXXXXXXXXXXXXPYVVAIINSGIKALPHIFNACVLMFVFSACNS 399
             + + VAY+DP L+             P+V+ I N+GI+ LPHI NAC+L   +SA N+
Sbjct: 335 LAISVIVAYNDPSLVSALASGKPGAGSSPFVIGIQNAGIRVLPHIINACILSSAWSAGNA 394

Query: 400 DLYVASRTLYGLAIDNKAPKIFAVTNRWGVPYYSLLMSSCFCLLAYMSVSSGSAKIFNYF 459
            ++ ++R+L  +A +  AP++F   NR+GVPY ++ +S     LA+++VSS +A +FN+F
Sbjct: 395 FMFASTRSLLTMARNGDAPRVFGKINRFGVPYVAISLSGGLSCLAFLNVSSSTADVFNWF 454

Query: 460 VNVVSIFGLLSWISILITYLCFFRAVKAQNVDRSRFAYRAPFQPYGSYFTLAFCILIAFI 519
            N+ +I G + WI   + Y+ F +A+    +   R  ++   QPY  Y++L    LI   
Sbjct: 455 SNISTISGFIGWICGCVAYIRFRKAIFFNGM-YDRLPFKTWGQPYAVYYSLFVISLITLT 513

Query: 520 KNFTVFLNHHFDYKNFITGYIGIPVFVISYFGYKFVKKT---KIWKPEEVDLYTFKAAID 576
             +  F+  ++   +F+  YI +P+FV+ + G+K   +T   + W+   VD       + 
Sbjct: 514 NGYATFIPKNWKGSDFVAAYITLPIFVVLWVGHKLWTRTFTKRWWR--RVDQIDVTTGLV 571

Query: 577 EEEEQGKIADAERRERLKNSKTKGWDWFYEKVL 609
           + EE+ KI D  R E      +  W  F + VL
Sbjct: 572 DIEERTKILDETRVE-----PSTRWQKFMDAVL 599

>NCAS0A00600 Chr1 complement(109246..110880) [1635 bp, 544 aa] {ON} 
          Length = 544

 Score =  317 bits (813), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 182/541 (33%), Positives = 294/541 (54%), Gaps = 20/541 (3%)

Query: 52  DINDMDNLSTVSSRLEDSEKQDDYMDDGKDEHTRLRKDLKARHISMIAXXXXXXXXXXXX 111
            ++  D  +T+S+  +D EKQ D           ++++LK RHISMIA            
Sbjct: 12  QVDSNDTPTTISTLDDDQEKQQD-----------VKRELKKRHISMIALGGTIGTGLFLG 60

Query: 112 XXXXXYTAGPMSMFIAYAFVGVLVFFTMAALGEMASYIPLDG-FTSYASRYCDPALGFAV 170
                  AGP+   IAY F+G +VF    +LGEM ++IP+   FT +A R+  PA G A 
Sbjct: 61  IARPLIIAGPIGALIAYLFMGTVVFSVTQSLGEMCTFIPVTASFTVFAQRFLSPAFGAAN 120

Query: 171 GYAYLCKYLILPPNQLTAAALVIQYWLDREQVNPGVWITIFLVIIVAMNFIGVKFFGEFE 230
           GY Y   + +    +L+    +IQ+W     V    WI+I  V++   N   V+ +GE E
Sbjct: 121 GYMYWFSWAMTFALELSVVGQIIQFW--TMAVPLAAWISIVWVLLTISNLFPVRIYGEIE 178

Query: 231 FWLSTFKVIVMIGLIILLFVIMLGGGPTHDRLGFRFYDHPGAFKPYSKSIDGSKGKXXXX 290
           FW+++ KV+ ++G II    I+ G G T   +GFR++ +PG +     S + ++ +    
Sbjct: 179 FWIASVKVLAILGFIIYGICIICGAGVTGP-VGFRYWKNPGPWGMGIISSNVNEARFFGW 237

Query: 291 XXXXXXXXXXXXGIELTGIVAAEAANPRKSIPKAIKLTMYRIIVFYLVTIFLLGMCVAYD 350
                       G EL GI A E   PRK++PKAIK  ++RI+VFY+ ++ ++G+ V Y+
Sbjct: 238 VSSLINAAFTFQGTELVGITAGEVQEPRKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYN 297

Query: 351 DPLLXXXXXXXXXXXXXPYVVAIINSGIKALPHIFNACVLMFVFSACNSDLYVASRTLYG 410
           DP L             P+++ I N+G K LPHIFNA +L+ + SA NS++Y+ SR LYG
Sbjct: 298 DPKLQSNDSYVSSS---PFIITIQNAGTKILPHIFNAVILITIISAGNSNVYIGSRILYG 354

Query: 411 LAIDNKAPKIFAVTNRWGVPYYSLLMSSCFCLLAYMSVSSGSAKIFNYFVNVVSIFGLLS 470
           LA +  APK F  T++ GVPY ++L +S F  LAYM  ++G  K F + +N+V + G  +
Sbjct: 355 LAKNKAAPKFFTNTSKAGVPYVTVLFTSMFGSLAYMETTTGGDKAFTWLLNIVGVAGFFA 414

Query: 471 WISILITYLCFFRAVKAQNVDRSRFAYRAPFQPYGSYFTLAFCILIAFIKNFTVFLNHHF 530
           W+ I  +++ F +A+K + + R+   Y+A   P+ +Y+ + F ++I  I+ FT F    F
Sbjct: 415 WLLISCSHIRFMKALKQRGISRNDLPYKAMLMPWLAYYAVFFMVIIIVIQGFTSF-APKF 473

Query: 531 DYKNFITGYIGIPVFVISYFGYKFVKKTK-IWKPEEVDLYTFKAAIDEEEEQGKIADAER 589
              NF   YI + +F+I +  ++   K + +WK ++VDL T +  I+EE     + D  +
Sbjct: 474 KVANFFAAYISVFLFIIFWVAFQIWFKCRLVWKLQDVDLDTDRRDIEEEVWSDDVEDKNK 533

Query: 590 R 590
            
Sbjct: 534 N 534

>SAKL0C02728g Chr3 (255022..256710) [1689 bp, 562 aa] {ON} similar
           to uniprot|P32487 Saccharomyces cerevisiae YNL268w LYP1
           lysine-specific high-affinity permease
          Length = 562

 Score =  317 bits (811), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 178/516 (34%), Positives = 279/516 (54%), Gaps = 22/516 (4%)

Query: 61  TVSSRLED---SEKQDDYMDDGKD----------EHTRLRKDLKARHISMIAXXXXXXXX 107
           +VS +LED   SE    Y   G +            T +++ LK RHISMIA        
Sbjct: 18  SVSKKLEDYVSSETLPIYSHSGDNAPCEKGEGDCRETEVKRALKPRHISMIALGGTIGTG 77

Query: 108 XXXXXXXXXYTAGPMSMFIAYAFVGVLVFFTMAALGEMASYIPL-DGFTSYASRYCDPAL 166
                      +GP+   IAY F+G +V+F   +LGEMA++IP+    T ++ R+  PA 
Sbjct: 78  LFVGIASPLSESGPVGALIAYIFIGSIVYFVTQSLGEMATFIPVTSSITVFSKRFLSPAF 137

Query: 167 GFAVGYAYLCKYLILPPNQLTAAALVIQYWLDREQVNPGVWITIFLVIIVAMNFIGVKFF 226
           G A GY Y   + I    ++     VIQYW D   V    WI IF V++   NF  VKF+
Sbjct: 138 GVANGYMYWFNWAITYAVEIAVVGQVIQYWTD--AVPLAAWIAIFWVLVTLANFFPVKFY 195

Query: 227 GEFEFWLSTFKVIVMIGLIILLFVIMLGGGPTHDRLGFRFYDHPGAFKPYSKSIDGSKGK 286
           GE EFW+++ KVI ++G +I   VI+ GG      +GFR++ +PG + P   S D ++G+
Sbjct: 196 GEVEFWVASVKVIAIVGYLIYALVIVCGGS-HQGPIGFRYWRNPGPWGPGIISKDVNEGR 254

Query: 287 XXXXXXXXXXXXXXXXGIELTGIVAAEAANPRKSIPKAIKLTMYRIIVFYLVTIFLLGMC 346
                           G EL GI A EAANPRK++P+AI    +RI+ FY++++F +G+ 
Sbjct: 255 FLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVPRAINKVFFRILFFYILSLFFIGLL 314

Query: 347 VAYDDPLLXXXXXXXXXXXXXPYVVAIINSGIKALPHIFNACVLMFVFSACNSDLYVASR 406
           V YDD  L             P+V++I N+G K LPHIFNA V++ + SA NS++YV SR
Sbjct: 315 VPYDDLRLSNTTAVIASS---PFVISIQNAGTKVLPHIFNAIVMITIISAANSNVYVGSR 371

Query: 407 TLYGLAIDNKAPKIFAVTNRWGVPYYSLLMSSCFCLLAYMSVSSGSAKIFNYFVNVVSIF 466
            LY LA+   APK F    + GVPY  +++++   LLA++ V++ + + FN+ VN+ ++ 
Sbjct: 372 VLYSLALSGNAPKQFGYVTKQGVPYLGVIVTALLGLLAFLVVNNNANEAFNWLVNISTLA 431

Query: 467 GLLSWISILITYLCFFRAVKAQNVDRSRFAYRAPFQPYGSYFTLAFCILIAFIKNFTVFL 526
           GL +W+ I ++++ F + +K + + R    ++A   P+G+Y+   F  +I  I+ F  F 
Sbjct: 432 GLCAWLFISLSHVRFMQCLKHRGISREDLPFKAKLMPWGAYYAAFFIGVIIIIQGFKAF- 490

Query: 527 NHHFDYKNFITGYIGIPVFVISYFGYKFVKKTK-IW 561
              F   +F T YI + +  + + G +   + + IW
Sbjct: 491 TPKFRVSDFFTSYISLILLAVLFLGCQLFYRCRFIW 526

>NDAI0F04200 Chr6 (1016214..1017914) [1701 bp, 566 aa] {ON} 
          Length = 566

 Score =  316 bits (810), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 179/537 (33%), Positives = 293/537 (54%), Gaps = 15/537 (2%)

Query: 47  KKDGLDINDMDNLSTVSSRLEDSEKQDDYMDDGKDEHTRLRKDLKARHISMIAXXXXXXX 106
           ++  L  N+  N  T +   E+  + +      KDE+  +++DL  RHI+MIA       
Sbjct: 27  EQHDLQGNEDKNTPTTTPSKENVSENE------KDEYHEVKRDLSKRHIAMIALGGTIGT 80

Query: 107 XXXXXXXXXXYTAGPMSMFIAYAFVGVLVFFTMAALGEMASYIPLDG-FTSYASRYCDPA 165
                       +GP+   IAY F+G +V+    +LGEMA++IP+   FT ++ R+  PA
Sbjct: 81  GLFLGIANPLMISGPVGSLIAYLFLGTVVYSVTQSLGEMATFIPVTASFTIFSHRFLSPA 140

Query: 166 LGFAVGYAYLCKYLILPPNQLTAAALVIQYWLDREQVNPGVWITIFLVIIVAMNFIGVKF 225
           LG A GY Y   + +    +L+    +IQ+W     V    WI+IF VI+   N   V+ 
Sbjct: 141 LGAANGYMYWFSWAMTFALELSVVGQIIQFW--TFAVPLPAWISIFWVILTISNLFPVRI 198

Query: 226 FGEFEFWLSTFKVIVMIGLIILLFVIMLGGGPTHDRLGFRFYDHPGAFKPYSKSIDGSKG 285
           +GE EFW++  KV  ++G II  F I+ G G T   +GFR++ +PG +     S + ++ 
Sbjct: 199 YGEIEFWIAFLKVNAILGFIIYCFCIVCGAGKTGP-VGFRYWRNPGPWGTGIISSNIAEA 257

Query: 286 KXXXXXXXXXXXXXXXXGIELTGIVAAEAANPRKSIPKAIKLTMYRIIVFYLVTIFLLGM 345
           +                G EL GI A EAANPR+++PKAI+  ++RI+VFY++++F +G+
Sbjct: 258 RFLGWASSLINAAFTFQGTELVGITAGEAANPRQTVPKAIRKVVFRILVFYILSLFFIGL 317

Query: 346 CVAYDDPLLXXXXXXXXXXXXXPYVVAIINSGIKALPHIFNACVLMFVFSACNSDLYVAS 405
            V YDD  L             P+++AI NSG K LPHIFN  +L+ + SA NS++Y+ S
Sbjct: 318 LVPYDDVKLKSENSYVSSS---PFIIAIENSGTKILPHIFNGVILVTIISAGNSNVYIGS 374

Query: 406 RTLYGLAIDNKAPKIFAVTNRWGVPYYSLLMSSCFCLLAYMSVSSGSAKIFNYFVNVVSI 465
           R L+GLA +   PK+FA T + GVP ++++ +S F  LA+M  S+G  + F + +NVV +
Sbjct: 375 RLLFGLAKNGTGPKLFAKTTKSGVPVFAVVFTSLFGALAFMETSTGGDEAFQWLLNVVGV 434

Query: 466 FGLLSWISILITYLCFFRAVKAQNVDRSRFAYRAPFQPYGSYFTLAFCILIAFIKNFTVF 525
            G  SW+ I   ++ F + ++++ + R+   ++A F PY +Y+     I+I F + FT F
Sbjct: 435 AGFFSWLLISFAHIRFMQCLQSRGISRNDLPFKAKFMPYLAYYATIVMIIIIFFQGFTAF 494

Query: 526 LNHHFDYKNFITGYIGIPVFVISYFGYKFVKKTK-IWKPEEVDLYTFKAAIDEEEEQ 581
               FD  NF   YI + +F I +  ++   K + +WK  ++D+   +  I++   Q
Sbjct: 495 -APKFDVLNFFASYISVFLFFIFWGSFQLWFKCRYVWKLVDIDIDKDRREIEDRVWQ 550

>NCAS0A00610 Chr1 (111522..113345) [1824 bp, 607 aa] {ON} 
          Length = 607

 Score =  317 bits (813), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 175/505 (34%), Positives = 280/505 (55%), Gaps = 12/505 (2%)

Query: 84  TRLRKDLKARHISMIAXXXXXXXXXXXXXXXXXYTAGPMSMFIAYAFVGVLVFFTMAALG 143
           T +++ LK RHI MIA                   +GP+   IAY F+G +++    +LG
Sbjct: 99  TEVKRALKQRHIGMIALGGTIGTGLFVGISVPLTNSGPVGSLIAYLFMGSIIYSITQSLG 158

Query: 144 EMASYIPL-DGFTSYASRYCDPALGFAVGYAYLCKYLILPPNQLTAAALVIQYWLDREQV 202
           EMA++IP+    T ++ R+  PA G A GY Y   + I    +++    VI+YW   ++V
Sbjct: 159 EMATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVEISVVGQVIEYW--TKKV 216

Query: 203 NPGVWITIFLVIIVAMNFIGVKFFGEFEFWLSTFKVIVMIGLIILLFVIMLGGGPTHDRL 262
               WI IF V +  MNF  VK +GE EFW++  KV+ + G ++   +I+ GG  +   +
Sbjct: 217 PLAAWIAIFWVFVTLMNFFPVKVYGEIEFWIAFMKVLAIAGYLLYALIIVCGGS-SQGPI 275

Query: 263 GFRFYDHPGAFKPYSKSIDGSKGKXXXXXXXXXXXXXXXXGIELTGIVAAEAANPRKSIP 322
           GFR++ +PG +     S D +  +                G EL GI A EAANPRKS+P
Sbjct: 276 GFRYWRNPGPWGAGIISKDKNTSRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVP 335

Query: 323 KAIKLTMYRIIVFYLVTIFLLGMCVAYDDPLLXXXXXXXXXXXXXPYVVAIINSGIKALP 382
           +AI   ++RI +FY++++F +G+ V YDDP L             P+V++I N+G K LP
Sbjct: 336 RAINKVVFRIALFYIMSLFFIGLLVPYDDPRLSSDSAVVASS---PFVISIQNAGTKILP 392

Query: 383 HIFNACVLMFVFSACNSDLYVASRTLYGLAIDNKAPKIFAVTNRWGVPYYSLLMSSCFCL 442
            IFNA V++ V SA NS++YV SR LY LA    APK FA   R GVPY  +L ++   L
Sbjct: 393 DIFNAIVMITVISAANSNVYVGSRVLYALAQTGNAPKQFAYVTRHGVPYLGVLCTAALGL 452

Query: 443 LAYMSVSSGSAKIFNYFVNVVSIFGLLSWISILITYLCFFRAVKAQNVDRSRFAYRAPFQ 502
           LA++ V++ +   FN+ +N+ ++ GL +W+ I I+++ F +A+K + + R    ++A F 
Sbjct: 453 LAFLVVNNNANTAFNWLINISTLAGLCAWLFISISHIRFMQALKFRGISRDDLPFKAKFM 512

Query: 503 PYGSYFTLAFCILIAFIKNFTVFLNHHFDYKNFITGYIGIPVFVISYFGYKFVKKTK-IW 561
           P+ +Y+   F  +I FI+ F  F + HFD   F T YI + +  + + G +   + +  W
Sbjct: 513 PWAAYYATFFVTVIIFIQGFQAF-SPHFDVTAFFTAYISLIILAVLFIGCQIYYRCRFFW 571

Query: 562 KPEEVDLYTFKAAIDE---EEEQGK 583
           K E++D+ T +  I+E   E+++ K
Sbjct: 572 KLEDIDIDTDRREIEEVIWEDDEPK 596

>NCAS0E02260 Chr5 (437115..438896) [1782 bp, 593 aa] {ON} Anc_7.44
          Length = 593

 Score =  317 bits (811), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 197/591 (33%), Positives = 322/591 (54%), Gaps = 40/591 (6%)

Query: 46  DKKDGLD--INDMD-NLSTVSSRL-EDSEKQ----------DDYMDDGKDEHTRLRKDLK 91
           DK D  D  I+++D   +T++ +L +D  K+          D+      +E+ +L++ LK
Sbjct: 16  DKADKSDPIISEVDIEANTITEQLTKDKHKETIDYSETSSLDEEKQQQPEENGKLKQGLK 75

Query: 92  ARHISMIAXXXXXXXXXXXXXXXXXYTAGPMSMFIAYAFVGVLVFFTMAALGEMASYIPL 151
           +RH+ +IA                  T GP  +F +Y  +   ++  M A GEM  Y+P 
Sbjct: 76  SRHVQLIALGGTIGTGLLVGSSQTLATCGPAGLFTSYLIICTFIYPIMNAFGEMVCYLPG 135

Query: 152 DGFTSYAS------RYCDPALGFAVGYAYLCKYLILPPNQLTAAALVIQYWLDREQVNPG 205
           +G  S  S      +Y D +LGFA  + Y   ++IL   + TAAA V++YW    +V  G
Sbjct: 136 NGSDSAGSSAYLVEKYVDRSLGFASSWNYYYCFVILVATECTAAAGVVEYWAWALKVPKG 195

Query: 206 VWITIFLVIIVAMNFIGVKFFGEFEFWLSTFKVIVMIGLIILLFVIMLGGGPTHDRLGFR 265
            WITIFL  +VA+N + V F+GE EFW ++ K++ ++GLIIL F++  GGGP+HDRLGFR
Sbjct: 196 AWITIFLFCVVALNMLPVNFYGESEFWFASIKILCILGLIILSFILFWGGGPSHDRLGFR 255

Query: 266 FYDHPGAFKPYSKSIDGSKGK-XXXXXXXXXXXXXXXXGIELTGIVAAEAANPRKSIPKA 324
           ++  PGAF  +    DG+ G                  G EL  + ++E  + R++I KA
Sbjct: 256 YWQRPGAFADHIT--DGTGGNFLDVYTGVIKGGFAFVLGPELVSLTSSECHDQRRNIAKA 313

Query: 325 IKLTMYRIIVFYLVTIFLLGMCVAYDDP-LLXXXXXXXXXXXXXPYVVAIINSGIKALPH 383
            +  ++R+++FY++    + + VAY+DP L              P+V+ I N+GIK LPH
Sbjct: 314 SRRFVWRLMIFYVLGSLSISVIVAYNDPNLQNALAQSKPGAGSSPFVIGIQNAGIKVLPH 373

Query: 384 IFNACVLMFVFSACNSDLYVASRTLYGLAIDNKAPKIFAVTNRWGVPYYSLLMSSCFCLL 443
           I N C++   +SA N+ ++ +SR+L  +A    APK F+  NR+GVPY ++  S  FC L
Sbjct: 374 IINVCIMTSAWSAGNAYMFASSRSLLTMASHGHAPKFFSKINRFGVPYVAVGFSFLFCCL 433

Query: 444 AYMSVSSGSAKIFNYFVNVVSIFGLLSWISILITYLCFFRAVKAQNVDRSRFAYRAPFQP 503
           AY++VSS +A +FN+F N+ +I G + WI   + Y+ F +A+   ++   R  Y+   Q 
Sbjct: 434 AYLNVSSSTANVFNWFSNISTISGFIGWICACVAYIRFRKAIIFNDL-YDRLPYKGFAQK 492

Query: 504 YGSYFTLAFCILIAFIKNFTVFLNHHFDYKNFITGYIGIPVFVISYFGYKFVKKTKIWKP 563
           Y  +++L    LI     + +F+   +DYK+FI  YI +PVF++ + G+K V  T+ W+ 
Sbjct: 493 YLIWYSLFMVSLITLTNGYQIFIPRFWDYKDFIAAYITLPVFIVLWIGHKLV--TRSWRQ 550

Query: 564 -----EEVDLYTFKAAIDEEEEQGKIADAERRERLKNSKTKGWDWFYEKVL 609
                +++D++T    ++E EE     D E+R    N+    WD F + +L
Sbjct: 551 WYIPVDKIDVFT---GLEEIEELTNELD-EKRVPPNNA----WDKFLDALL 593

>Kpol_367.7 s367 (23929..25683) [1755 bp, 584 aa] {ON}
           (23929..25683) [1755 nt, 585 aa]
          Length = 584

 Score =  314 bits (804), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 185/553 (33%), Positives = 295/553 (53%), Gaps = 27/553 (4%)

Query: 53  INDMDNLSTVSSRLEDSEKQDDYMDDGKDEHTRLRKDLKARHISMIAXXXXXXXXXXXXX 112
           IN++D  S    ++  S+   +   +G     +L++ L +RH+  IA             
Sbjct: 28  INELDLESLTREKITRSDSSSEVEAEGNG---KLKQGLSSRHVQFIALGGTIGTGLFVGT 84

Query: 113 XXXXYTAGPMSMFIAYAFVGVLVFFTMAALGEMASYIPLDGFTSYAS------RYCDPAL 166
                T GP  + I+Y  +  +++  M ALGEM  Y+P +G  S  S      RY D +L
Sbjct: 85  SVTLKTVGPGGLVISYIIISTVIYPIMNALGEMVCYLPGNGEDSAGSVAHLVGRYVDKSL 144

Query: 167 GFAVGYAYLCKYLILPPNQLTAAALVIQYWLDREQVNPGVWITIFLVIIVAMNFIGVKFF 226
            FA G+ Y   ++IL   + TAA+ V+ YW     V   VWITIFL I+  +NF  VK+F
Sbjct: 145 AFATGWNYYYCFVILVAAECTAASGVVTYW--TTSVPTAVWITIFLGIVTLLNFSAVKYF 202

Query: 227 GEFEFWLSTFKVIVMIGLIILLFVIMLGGGPTHDRLGFRFYDHPGAFKPYSKSIDGSKGK 286
           GE EFW ++ K++ ++GLI++ F++  GGGP+H RLGF ++  PG F  +     GS G 
Sbjct: 203 GETEFWFASIKILCILGLILVSFILFWGGGPSHVRLGFHYWKDPGTFAHHITG--GSWGS 260

Query: 287 XX-XXXXXXXXXXXXXXGIELTGIVAAEAANPRKSIPKAIKLTMYRIIVFYLVTIFLLGM 345
                            G EL  + ++E  + R++I KA K  ++R++ FY++    + +
Sbjct: 261 FLDIYTGIIKGAFAFILGPELVALTSSECNDQRRNIAKASKRFIWRLMFFYILGTLSISV 320

Query: 346 CVAYDDP-LLXXXXXXXXXXXXXPYVVAIINSGIKALPHIFNACVLMFVFSACNSDLYVA 404
            VAY+DP LL             P+V+ I N+GIK LPHI NAC+L   +SA NS ++ +
Sbjct: 321 IVAYNDPVLLNALEEGKEGAASSPFVIGIQNAGIKVLPHIINACILSSAWSAGNSFMFAS 380

Query: 405 SRTLYGLAIDNKAPKIFAVTNRWGVPYYSLLMSSCFCLLAYMSVSSGSAKIFNYFVNVVS 464
           SR+L  +A +  APKIF   NR+GVPYYS+ +S+    LA+++VSS +A++F++F N+ +
Sbjct: 381 SRSLMTMAHNGSAPKIFCKVNRFGVPYYSVGLSAMLSCLAFLNVSSSTAQVFDWFSNIST 440

Query: 465 IFGLLSWISILITYLCFFRAVKAQNVDRSRFAYRAPFQPYGSYFTLAFCILIAFIKNFTV 524
           I G L WI  +I YL F +A+   N+   R  ++   QPY  +++L    +I     +  
Sbjct: 441 ISGFLGWICAIIAYLRFRKAIFYNNM-YDRLPFKTFGQPYLIWYSLLVISVITLTNGYQT 499

Query: 525 FLNHHFDYKNFITGYIGIPVFVISYFGYKFVKKTKIWKP--------EEVDLYTFKAAID 576
           F+   +   +F+  YI +P+F+I + G+KF  + K   P        +E+D+ T    + 
Sbjct: 500 FIPRFWSGSDFVAAYITLPLFLILWVGHKFWARYKHAVPLLKLYYPVDEIDVIT---GLA 556

Query: 577 EEEEQGKIADAER 589
           E EE  +  D  R
Sbjct: 557 EAEEVAEKLDMNR 569

>Kwal_33.13401 s33 complement(206763..208442) [1680 bp, 559 aa] {ON}
           YEL063C (CAN1) - arginine permease [contig 118] FULL
          Length = 559

 Score =  313 bits (802), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 177/531 (33%), Positives = 287/531 (54%), Gaps = 9/531 (1%)

Query: 51  LDINDMDNLSTVSSRLEDSEKQDDYMDDGKDEHTRLRKDLKARHISMIAXXXXXXXXXXX 110
           L+  +M + +  +   E    QD  +         +++ LK RH+SMIA           
Sbjct: 18  LEDYEMGSFAEEALDQEAQSSQDSQLGSSGHGRNAVQRQLKPRHVSMIALGGTIGTGLFI 77

Query: 111 XXXXXXYTAGPMSMFIAYAFVGVLVFFTMAALGEMASYIPL-DGFTSYASRYCDPALGFA 169
                   AGP+   I+Y F+G + +    +LGEMA++IP+   FT +  R+    LG A
Sbjct: 78  GIESPLRNAGPVGALISYLFMGSIAYCVTQSLGEMATFIPVTSSFTVFTRRFLSLPLGAA 137

Query: 170 VGYAYLCKYLILPPNQLTAAALVIQYWLDREQVNPGVWITIFLVIIVAMNFIGVKFFGEF 229
            GY Y   + +    +L+    +I+YW     V    WI IF V I   N + VKF+GEF
Sbjct: 138 NGYMYCFSWSVTYALELSIVGQIIEYW--TSAVPNAAWIAIFWVPITLSNLVPVKFYGEF 195

Query: 230 EFWLSTFKVIVMIGLIILLFVIMLGGGPTHDRLGFRFYDHPGAFKPYSKSIDGSKGKXXX 289
           +FW++  KV+ +IG ++    ++ G G T   +GFR++ +PG +     S D  +G+   
Sbjct: 196 QFWIALIKVVAIIGFLVYCLCMVCGAGKTGP-VGFRYWRNPGPWGDGIISHDIHEGRFLG 254

Query: 290 XXXXXXXXXXXXXGIELTGIVAAEAANPRKSIPKAIKLTMYRIIVFYLVTIFLLGMCVAY 349
                        G EL GI A E+ANPRK++PKAI    +RI++FY+ ++F +G+ V +
Sbjct: 255 WVSSLVNAAFTYQGTELVGISAGESANPRKTVPKAINKVFFRILLFYVGSLFFIGLLVPF 314

Query: 350 DDPLLXXXXXXXXXXXXXPYVVAIINSGIKALPHIFNACVLMFVFSACNSDLYVASRTLY 409
           +D  L             P+++AI NSG K LP IFNA +L  + SA NS++YV SR LY
Sbjct: 315 NDEKLTSSDSYSAGS---PFIIAIQNSGTKILPDIFNAVILATIISAANSNVYVGSRVLY 371

Query: 410 GLAIDNKAPKIFAVTNRWGVPYYSLLMSSCFCLLAYMSVSSGSAKIFNYFVNVVSIFGLL 469
           GLA +  AP+ FA TNR GVP  ++L  + F  L Y+SVS+G++K F++ +N+ +I G  
Sbjct: 372 GLAKERLAPRFFARTNRHGVPDVAVLFVANFGFLGYLSVSNGASKAFDWLLNITAIAGFF 431

Query: 470 SWISILITYLCFFRAVKAQNVDRSRFAYRAPFQPYGSYFTLAFCILIAFIKNFTVFLNHH 529
           SW+ I + ++ F +A+K Q + R    ++A   P+G+Y++  F  LI  I+ FT  L   
Sbjct: 432 SWLFISLCHVRFMQALKLQGISRDDLPFKAKLMPWGAYYSAFFITLIIIIQGFTS-LAPT 490

Query: 530 FDYKNFITGYIGIPVFVISYFGYKFVKKTK-IWKPEEVDLYTFKAAIDEEE 579
           F+  NF   YI + +F++ +  ++   +T+ I + E VD+ + +  +D ++
Sbjct: 491 FNVSNFFAAYISVFMFLVIWAVFQCWYRTRIIHRIEHVDIDSDRREVDAQQ 541

>ZYRO0F16632g Chr6 complement(1371112..1372935) [1824 bp, 607 aa]
           {ON} similar to uniprot|P32487 Saccharomyces cerevisiae
           YNL268W LYP1 Lysine permease one of three amino acid
           permeases (Alp1p Can1p Lyp1p) responsible for uptake of
           cationic amino acids
          Length = 607

 Score =  312 bits (800), Expect = 8e-98,   Method: Compositional matrix adjust.
 Identities = 174/500 (34%), Positives = 276/500 (55%), Gaps = 10/500 (2%)

Query: 79  GKDEHTRLRKDLKARHISMIAXXXXXXXXXXXXXXXXXYTAGPMSMFIAYAFVGVLVFFT 138
           GK   T++++ LK RH+ MIA                   +GP+   IAY F+G +V+F 
Sbjct: 95  GKFHDTQVKRALKPRHLGMIALGGTIGTGLFVGISEPLSRSGPVGSLIAYIFMGSVVYFV 154

Query: 139 MAALGEMASYIPL-DGFTSYASRYCDPALGFAVGYAYLCKYLILPPNQLTAAALVIQYWL 197
             +LGEMA++IP+    T +  R+  PALG + GY Y   + I    +L+    +IQYW 
Sbjct: 155 TQSLGEMATFIPVTSSITVFTKRFLSPALGVSNGYMYWFNWAITFATELSVTGQIIQYWT 214

Query: 198 DREQVNPGVWITIFLVIIVAMNFIGVKFFGEFEFWLSTFKVIVMIGLIILLFVIMLGGGP 257
              +V    WI IF VI+  +NF  VK +GE EFW+S+ KV+ ++G +I   VI+ GG  
Sbjct: 215 --YKVPLAAWIPIFWVIVAVLNFFPVKIYGEIEFWVSSVKVLAIVGYLIYALVIVCGGS- 271

Query: 258 THDRLGFRFYDHPGAFKPYSKSIDGSKGKXXXXXXXXXXXXXXXXGIELTGIVAAEAANP 317
               +GFR++ H  AF     S +  + +                G EL GI A EAANP
Sbjct: 272 RQGPIGFRYWRHGYAFGDGYISKNKDEARFLGWVSSLINAAFTYQGTELVGISAGEAANP 331

Query: 318 RKSIPKAIKLTMYRIIVFYLVTIFLLGMCVAYDDPLLXXXXXXXXXXXXXPYVVAIINSG 377
           RK++P+AI   ++RI +FY++++F +G+ V Y+D  L             P+V++++N+G
Sbjct: 332 RKTVPRAINKVIFRIALFYILSLFFIGLLVPYNDKRLSDGSAIIASS---PFVISMLNAG 388

Query: 378 IKALPHIFNACVLMFVFSACNSDLYVASRTLYGLAIDNKAPKIFAVTNRWGVPYYSLLMS 437
             ALP IFNA +L+ V SA NSD+Y+ASR LY LA    APK F   NR+GVPY  + ++
Sbjct: 389 TSALPDIFNAVILITVLSAANSDVYIASRVLYALAGQGNAPKQFTYVNRYGVPYLGVFVT 448

Query: 438 SCFCLLAYMSVSSGSAKIFNYFVNVVSIFGLLSWISILITYLCFFRAVKAQNVDRSRFAY 497
                LA++ VS+ +   FN+ +N+ ++ GL +W  I   ++ F +A+K + + R    +
Sbjct: 449 CLVGWLAFLVVSNNANTAFNWLINISTLAGLTAWFFICFAHIRFMQALKHKGISRDDLPF 508

Query: 498 RAPFQPYGSYFTLAFCILIAFIKNFTVFLNHHFDYKNFITGYIGIPVFVISYFGYKFVKK 557
           +A F P+G+Y+   F  LI FI+ +  F    +D K+F T YI + +F + Y G     +
Sbjct: 509 KARFMPWGAYYAAFFVGLIIFIQGYDAFT--PWDTKSFFTSYISLILFGVLYLGCLIYYR 566

Query: 558 TKIW-KPEEVDLYTFKAAID 576
            ++  K E++D+ T +  ++
Sbjct: 567 GRLLIKIEDIDIDTDRKEVE 586

>Suva_14.73 Chr14 complement(130474..131967) [1494 bp, 497 aa] {ON}
           YNL268W (REAL)
          Length = 497

 Score =  308 bits (790), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 165/462 (35%), Positives = 271/462 (58%), Gaps = 8/462 (1%)

Query: 119 AGPMSMFIAYAFVGVLVFFTMAALGEMASYIPL-DGFTSYASRYCDPALGFAVGYAYLCK 177
           AGP+   I+Y F+G +++    +LGEMA++IP+   F+ +A R+  PALG   GY Y   
Sbjct: 23  AGPVGALISYIFMGTVIYSVTQSLGEMATFIPVTSSFSVFAQRFLSPALGATNGYMYWLS 82

Query: 178 YLILPPNQLTAAALVIQYWLDREQVNPGVWITIFLVIIVAMNFIGVKFFGEFEFWLSTFK 237
           +      +L+    +IQYW D   ++   WI IF  ++  MN   VK++GEFEF +++ K
Sbjct: 83  WCFTFALELSVLGQIIQYWTDAVPLS--AWIVIFWCLLTLMNMFPVKYYGEFEFCIASIK 140

Query: 238 VIVMIGLIILLFVIMLGGGPTHDRLGFRFYDHPGAFKPYSKSIDGSKGKXXXXXXXXXXX 297
           VI ++G II  F ++ G G     +GFR++ +PGA+ P   S D ++G+           
Sbjct: 141 VIALLGFIIYSFCMVCGAGQPDGPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINA 200

Query: 298 XXXXXGIELTGIVAAEAANPRKSIPKAIKLTMYRIIVFYLVTIFLLGMCVAYDDPLLXXX 357
                G EL GI A EAANPRK++P+AIK  + RI+VFY++++F +G+ V Y+DP L   
Sbjct: 201 AFTYQGTELVGITAGEAANPRKAVPRAIKKVVVRILVFYIMSLFFIGLLVPYNDPKLDSD 260

Query: 358 XXXXXXXXXXPYVVAIINSGIKALPHIFNACVLMFVFSACNSDLYVASRTLYGLAIDNKA 417
                     P++++I NSG K LP IFNA VL+ + SA NS++Y+ SR LY L+ ++ A
Sbjct: 261 GSFVSAS---PFMISIENSGTKVLPDIFNAVVLITIVSAGNSNVYIGSRVLYSLSKNDLA 317

Query: 418 PKIFAVTNRWGVPYYSLLMSSCFCLLAYMSVSSGSAKIFNYFVNVVSIFGLLSWISILIT 477
           P+  ++  + GVPY+++L +S F  LA++  S+GS K FN+ +N+  + G  +W+ I  +
Sbjct: 318 PRFLSIVTKGGVPYFAVLATSVFGFLAFLETSAGSGKAFNWLLNITGVAGFFAWLLISFS 377

Query: 478 YLCFFRAVKAQNVDRSRFAYRAPFQPYGSYFTLAFCILIAFIKNFTVFLNHHFDYKNFIT 537
           ++ F +A+  + + R+   Y+A   PY +Y+   F  LI  I+ FT F    F   +F+ 
Sbjct: 378 HIRFMQAISKRGISRNDLPYKARMMPYLAYYASFFIALIVLIQGFTAF-APSFQPVDFVA 436

Query: 538 GYIGIPVFVISYFGYK-FVKKTKIWKPEEVDLYTFKAAIDEE 578
            YI + +FV  +F ++ + K   I K ++VD+ + +  I+E+
Sbjct: 437 AYISVFLFVAIWFSFQLWFKCPIILKLQDVDIDSDRREIEEQ 478

>AFR667C Chr6 complement(1657505..1659196) [1692 bp, 563 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL268W
           (LYP1)
          Length = 563

 Score =  310 bits (795), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 176/546 (32%), Positives = 289/546 (52%), Gaps = 15/546 (2%)

Query: 48  KDGLDINDMDNLSTVSSRLEDSEKQDDYMDDGKDEHTRLRKDLKARHISMIAXXXXXXXX 107
           K G  + +   L +V+      E  +D+ ++G  + T +++ LKARHISMIA        
Sbjct: 19  KKGKTLENDIELQSVTP--ATGEFPEDHTEEGDYQETEVKRALKARHISMIALGGTIGTG 76

Query: 108 XXXXXXXXXYTAGPMSMFIAYAFVGVLVFFTMAALGEMASYIPL-DGFTSYASRYCDPAL 166
                     TAGP+   +AY F+G +V+    +LGEMA++IP+    T ++ R+  PA 
Sbjct: 77  LFIVIASPLRTAGPVGSLLAYIFIGTVVYSITQSLGEMATFIPVTSSVTVFSKRFLSPAF 136

Query: 167 GFAVGYAYLCKYLILPPNQLTAAALVIQYWLDREQVNPGVWITIFLVIIVAMNFIGVKFF 226
           G A GY Y   + I    +L+    +IQYW DR  +    WI IF V++  +NF  V+F+
Sbjct: 137 GVANGYMYWFNWAITFAVELSVVGQIIQYWTDRVPI--AAWIVIFWVLVTLVNFFPVRFY 194

Query: 227 GEFEFWLSTFKVIVMIGLIILLFVIMLGGGPTHDRLGFRFYDH-PGAFKPYSKSIDGSKG 285
           GE EFW+++ KV+ ++G +I  F+I+ GG      +G       P      S      + 
Sbjct: 195 GEIEFWIASVKVLTIVGYLIYAFIIVCGGS-KQGPIGLPATGGIPARGARASSRTTRKRH 253

Query: 286 KXXXXXXXXXXXXXXXXGIELTGIVAAEAANPRKSIPKAIKLTMYRIIVFYLVTIFLLGM 345
                            G EL GI A E+ NPRK++PKAI    +RI+ FY+ ++  +G+
Sbjct: 254 GFLGWVSSLIKAAFTYQGTELVGITAGESTNPRKNVPKAINKVFFRILFFYIGSLLFVGL 313

Query: 346 CVAYDDPLLXXXXXXXXXXXXXPYVVAIINSGIKALPHIFNACVLMFVFSACNSDLYVAS 405
            V YDDP L             P+V++I N+G K LP IFNA VL+ V SA NS++Y+ S
Sbjct: 314 LVPYDDPRLNSESSTDVNAS--PFVISIKNAGTKILPDIFNAVVLITVISAANSNVYIGS 371

Query: 406 RTLYGLAIDNKAPKIFAVTNRWGVPYYSLLMSSCFCLLAYMSVSSGSAKIFNYFVNVVSI 465
           R  Y LA+   APK  A   + GVPY+ +L++S   L++++ ++  ++  F++ VN+ ++
Sbjct: 372 RVAYSLALAGNAPKQLAFVTKQGVPYFGVLITSLMGLMSFLVLNHNASTAFDWLVNISTL 431

Query: 466 FGLLSWISILITYLCFFRAVKAQNVDRSRFAYRAPFQPYGSYFTLAFCILIAFIKNFTVF 525
            GL +W+ I + ++ F + +K + + R    ++A F P+ +Y+   F  +I FI+ +T F
Sbjct: 432 AGLCAWLFISLAHIRFMQCLKHRGISRDDLPFKAKFMPWAAYYATFFVTVIIFIQGYTAF 491

Query: 526 LNHHFDYKNFITGYIGIPVFVISYFGYKFVKKTK-IWKPEEVDLYTFKAAID----EEEE 580
               FD   F T YI + + ++ + G +   K + +W  E++D+ + +  ID    EE+E
Sbjct: 492 -TPKFDVTTFFTSYISLFLMLLVFIGCQIYYKCRFLWAVEDIDIDSDRREIDAIVWEEDE 550

Query: 581 QGKIAD 586
              I D
Sbjct: 551 PKNIWD 556

>KAFR0D00700 Chr4 complement(120768..122492) [1725 bp, 574 aa] {ON} 
          Length = 574

 Score =  310 bits (794), Expect = 3e-97,   Method: Compositional matrix adjust.
 Identities = 182/534 (34%), Positives = 297/534 (55%), Gaps = 18/534 (3%)

Query: 54  NDMDNLSTVSSRLEDSEKQDDYM-DDGKDEHTRLRKDLKARHISMIAXXXXXXXXXXXXX 112
           +DM  ++ +      S  +D+ M + G      ++++LK RHI MIA             
Sbjct: 29  DDMKKINIIQQTDASSTTEDEEMLNSGSVHDAEVKRELKQRHIGMIALGGTIGTGLFIGI 88

Query: 113 XXXXYTAGPMSMFIAYAFVGVLVFFTMAALGEMASYIPL-DGFTSYASRYCDPALGFAVG 171
                 +GP+   IAY FVG L +    +LGEMA++IP+   FT +ASR+  P++G AVG
Sbjct: 89  STPLEDSGPVGSLIAYIFVGTLTYAVTQSLGEMATFIPVTSSFTVFASRFLSPSIGAAVG 148

Query: 172 YAYLCKYLILPPNQLTAAALVIQYWLDREQVNPGVWITIFLVIIVAMNFIGVKFFGEFEF 231
           Y Y   + +    +L+    ++ YW     V    WI+IF VI+ A+N   VKF+GE EF
Sbjct: 149 YMYWFSWAVTFALELSVVGQIVDYW--TFAVPIAAWISIFWVILTALNMFPVKFYGEIEF 206

Query: 232 WLSTFKVIVMIGLIILLFVIMLGGGPTHDRLGFRFYDHPGAFKP--YSKSIDGSK----G 285
           W++  KV+ ++G +I    ++ G G T   +GFR++ +PG +     S  ++ SK    G
Sbjct: 207 WVAAVKVVAIVGFLIYCLCMVCGAGVTGP-VGFRYWRNPGPWGDGLTSNGVEISKNKNTG 265

Query: 286 KXXXXXXXXXXXXXXXXGIELTGIVAAEAANPRKSIPKAIKLTMYRIIVFYLVTIFLLGM 345
           +                G EL GI A EAANPRK++P+AIK  ++RI++FY+ ++F +G+
Sbjct: 266 RFLGWFNSLINAAFTYQGTELVGITAGEAANPRKTVPRAIKKVVFRILLFYIGSLFFIGL 325

Query: 346 CVAYDDPLLXXXXXXXXXXXXXPYVVAIINSGIKALPHIFNACVLMFVFSACNSDLYVAS 405
            V +DDP L             P+++AI NSG K LP IFNA +L+ + SA NS++YV S
Sbjct: 326 LVPFDDPKLSSDDSYVSSS---PFIIAIENSGTKILPDIFNAIILITIISAGNSNIYVGS 382

Query: 406 RTLYGLAIDNKAPKIFAVTNRWGVPYYSLLMSSCFCLLAYMSVSSGSAKIFNYFVNVVSI 465
           R L+ LA    APKI + T + GVP+ S+L ++ F +LAYM  + G   +F++ VN+ +I
Sbjct: 383 RILFSLAKTGLAPKILSRTTKKGVPWVSVLATAVFGVLAYMETTQGGQTVFDWLVNITAI 442

Query: 466 FGLLSWISILITYLCFFRAVKAQNVDRSRFAYRAPFQPYGSYFTLAFCILIAFI-KNFTV 524
            G  +W+ ILI+++ F + +K + + R    ++A   P  +Y+ + FC++I  I + FT 
Sbjct: 443 AGFWAWLFILISHIRFMQVLKFRGISRDDLPFKANLMPGLAYYAV-FCMVIIIIFQGFTA 501

Query: 525 FLNHHFDYKNFITGYIGIPVFVISYFGYKFVKKTK-IWKPEEVDLYTFKAAIDE 577
           F    FD  +F   YI + +F + +  ++   K + IWK E+VD+ + +  +++
Sbjct: 502 F-TPTFDVSDFFAAYISVILFFLIWGAFQLWFKCRWIWKLEDVDIDSNRRDVEK 554

>AFR156W Chr6 (717642..719318) [1677 bp, 558 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YOR348C (PUT4)
          Length = 558

 Score =  309 bits (791), Expect = 5e-97,   Method: Compositional matrix adjust.
 Identities = 178/552 (32%), Positives = 289/552 (52%), Gaps = 27/552 (4%)

Query: 46  DKKDGLDINDMDN------LSTVSSR--LEDSEKQDDYMDDGKDEHTRLRKDLKARHISM 97
           D+     I   DN      + T  SR  LE+ E Q         E+  L K L++RHI +
Sbjct: 3   DRASSASIEKADNGGYMHKVKTPHSRTSLEELETQS-----AGSEYNTLHKGLQSRHIQL 57

Query: 98  IAXXXXXXXXXXXXXXXXXYTAGPMSMFIAYAFVGVLVFFTMAALGEMASYIPLDG-FTS 156
           IA                 +  G   + +++  +  +V+  M +L EM  Y+P  G    
Sbjct: 58  IALGGCIGTGLFVGTSWTLHNCGAAPLLLSFILISTIVYPIMCSLAEMICYLPQQGSVPE 117

Query: 157 YASRYCDPALGFAVGYAYLCKYLILPPNQLTAAALVIQYWLDREQVNPGVWITIFLVIIV 216
             SRY DP+LGFA G+ Y   Y IL   +L+AAA V+ YW     V    WITIFLV++V
Sbjct: 118 LVSRYVDPSLGFATGWNYAYAYAILVAAELSAAASVVSYW--DNPVPMAAWITIFLVVVV 175

Query: 217 AMNFIGVKFFGEFEFWLSTFKVIVMIGLIILLFVIMLGGGPTHDRLGFRFYDHPGAFKPY 276
            +NF  VK++GE EFW ++ K+I ++GL+++  VI  GG P HDR GFR++ +PG   P+
Sbjct: 176 GLNFTAVKYYGEAEFWFASIKLICILGLLVVSVVIFFGGAPNHDRTGFRYWKNPG---PF 232

Query: 277 SKSI-DGSKGKXX-XXXXXXXXXXXXXXGIELTGIVAAEAANPRKSIPKAIKLTMYRIIV 334
           + S+  GS G+                   EL GI   EA + R++  KA +  +YRII 
Sbjct: 233 AMSLAPGSTGRFLDVWRAVIKSAFAFILSPELIGIACVEAQDTRRNTEKASRRFIYRIIF 292

Query: 335 FYLVTIFLLGMCVAYDDP-LLXXXXXXXXXXXXXPYVVAIINSGIKALPHIFNACVLMFV 393
           FY+    ++G+ ++  DP L+             P+V  I N+GI  L H+ N  +L   
Sbjct: 293 FYVSCALMIGVILSRTDPKLIEALETGAPGAASSPFVQGIANAGIPVLDHVINVAILSSA 352

Query: 394 FSACNSDLYVASRTLYGLAIDNKAPKIFAVTNRWGVPYYSLLMSSCFCLLAYMSVSSGSA 453
           +SA NS +Y ++R +  LA +  APK     NR+GVPY ++++ +    LAY++V + SA
Sbjct: 353 WSAGNSFMYASTRMVLALAREGNAPKFLTKINRYGVPYNAVIVCTLVACLAYLNVKTTSA 412

Query: 454 KIFNYFVNVVSIFGLLSWISILITYLCFFRAVKAQNVDRSRFAYRAPFQPYGSYFTLAFC 513
            +F +  N+ +I G + W ++ I ++ F R +   N+ +SR  Y+ P QPY +Y+     
Sbjct: 413 NVFQWLSNICTISGFIGWFAMGIAFIRFRRGIVFNNL-QSRIPYQGPLQPYIAYYFTFMT 471

Query: 514 ILIAFIKNFTVFLNHHFDYKNFITGYIGIPVFVISYFGYKFVKKTKIWKP-EEVDLYTFK 572
           +++     F VFL   ++  +F+  Y+ +P++++ Y G+K   +T+ + P E++D+ T  
Sbjct: 472 VVVCLTNGFHVFLKGRWNVVDFVAAYVTLPIYLVLYLGHKLWFRTRWYIPVEQIDVIT-- 529

Query: 573 AAIDEEEEQGKI 584
             + E EE+ K+
Sbjct: 530 -GLVEAEEESKM 540

>KLTH0F02420g Chr6 (205827..207692) [1866 bp, 621 aa] {ON} similar
           to uniprot|P32487 Saccharomyces cerevisiae YNL268W LYP1
           Lysine permease one of three amino acid permeases (Alp1p
           Can1p Lyp1p) responsible for uptake of cationic amino
           acids
          Length = 621

 Score =  309 bits (791), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 169/520 (32%), Positives = 287/520 (55%), Gaps = 18/520 (3%)

Query: 67  EDSEKQDDYMDDGKDEHTRLRKDLKARHISMIAXXXXXXXXXXXXXXXXXYTAGPMSMFI 126
            D+E  +  M +GK     +++ LK RH+SMIA                   +GP+   I
Sbjct: 101 SDTESGEGDMQEGK-----VKRALKPRHVSMIALGGTIGTGLFVGIASPLSYSGPVGALI 155

Query: 127 AYAFVGVLVFFTMAALGEMASYIPL-DGFTSYASRYCDPALGFAVGYAYLCKYLILPPNQ 185
           AY F+G +V+F   ++GEMA++IP+    T ++SR+  PA G A GY Y   + I    +
Sbjct: 156 AYIFMGTVVYFVTQSMGEMATFIPVTSSITVFSSRFLSPAFGVANGYMYWFNWAITFAVE 215

Query: 186 LTAAALVIQYWLDREQVNPGVWITIFLVIIVAMNFIGVKFFGEFEFWLSTFKVIVMIGLI 245
           L+    VI+YW   E V    WI IF V++   NF  V+F+GE EFW+++ KV+ ++G +
Sbjct: 216 LSVTGQVIEYW--TEAVPRAAWIAIFWVLVTLANFFPVQFYGEVEFWVASIKVLAIVGYL 273

Query: 246 ILLFVIMLGGGPTHDRLGFRFYDHPGAFKPYSKSIDGSKGKXXXXXXXXXXXXXXXXGIE 305
           I   VI+ GG      +GFR++ +PG +     S D  +G+                G E
Sbjct: 274 IYALVIVCGGS-KQGPIGFRYWRNPGPWGAGIISKDKDEGRFLGWVASLINASFTYQGTE 332

Query: 306 LTGIVAAEAANPRKSIPKAIKLTMYRIIVFYLVTIFLLGMCVAYDDPLLXXXXXXXXXXX 365
           L GI A EAANPR+++P+AI    +RI+ FY++++F +G+ V Y+   L           
Sbjct: 333 LVGITAGEAANPRRTVPRAINKVFFRILFFYILSLFFVGLLVPYNHSSLDKTTTVIASS- 391

Query: 366 XXPYVVAIINSGIKALPHIFNACVLMFVFSACNSDLYVASRTLYGLAIDNKAPKIFAVTN 425
             P+V++I N+G +ALP IFNA VL+ + SA NS++YV SR L+ LA    APK+F+   
Sbjct: 392 --PFVISIQNAGTRALPDIFNAVVLVTIISAANSNVYVGSRVLFSLAHTGIAPKVFSSVT 449

Query: 426 RWGVPYYSLLMSSCFCLLAYMSVSSGSAKIFNYFVNVVSIFGLLSWISILITYLCFFRAV 485
             GVP+  ++++S   LLA++ V+  + + FN+ +N+ ++ GL +W+ I I+++ F + +
Sbjct: 450 PQGVPFMGVIVTSLLGLLAFLVVNHNANEAFNWLINISTLAGLCAWLFISISHIRFMQCL 509

Query: 486 KAQNVDRSRFAYRAPFQPYGSYFTLAFCILIAFIKNFTVFLNHHFDYKNFITGYIGIPVF 545
           K + + R    +++   PYG+Y+   +  +I F++ F  F + HF    F T YI + + 
Sbjct: 510 KQRGISRDDLPFKSKLMPYGAYYAAFWVTVIIFVQGFQAF-SPHFKVTEFFTSYISLMLL 568

Query: 546 VISYFGYKFVKKTKIW-KPEEVDLYTFKAAID----EEEE 580
           V+ + G +   + + + + E++D+ + +   D    E++E
Sbjct: 569 VVVFCGAQLFYRCRFFNRLEDIDIDSDRREADALIWEDDE 608

>ZYRO0C18502g Chr3 complement(1448075..1449802) [1728 bp, 575 aa]
           {ON} similar to uniprot|P15380 Saccharomyces cerevisiae
           YOR348C PUT4 proline-specific permease (also capable of
           transporting alanine and glycine) putative proline-
           specific permease
          Length = 575

 Score =  303 bits (777), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 181/542 (33%), Positives = 290/542 (53%), Gaps = 16/542 (2%)

Query: 52  DINDMDNLSTVSSRLEDSEKQD-DYMDDGKDEHTRLRKDLKARHISMIAXXXXXXXXXXX 110
           D+   +N  T S + +D E+   D + D K  H ++++ LK+RH+ +IA           
Sbjct: 25  DMKVKENFVTESIQEDDLERGSIDVLIDEKPSH-QMQRGLKSRHMQLIALGCAIGTGLFI 83

Query: 111 XXXXXXYTAGPMSMFIAYAFVGVLVFFTMAALGEMASYIPLDGFTSY---ASRYCDPALG 167
                  T GP  + I+Y  +   V+  M  L EM    P+ G  S    A  Y +  L 
Sbjct: 84  GTGGALSTCGPAPLLISYIIMSFFVWTIMHQLTEMVVLTPIPGEASMYALARAYLNRPLS 143

Query: 168 FAVGYAYLCKYLILPPNQLTAAALVIQYWLDREQVNPGVWITIFLVIIVAMNFIGVKFFG 227
           F  G+       ++ P+++TA+ L+IQYW D    N  ++++IF+VI +A+  + VK FG
Sbjct: 144 FMCGWNLFYAQAMIAPSEITASTLLIQYWTD---ANSAIFVSIFIVITIAVTALPVKVFG 200

Query: 228 EFEFWLSTFKVIVMIGLIILLFVIMLGGGPT-HDRLGFRFYDHPGAFKPYSKSIDGSKGK 286
           E EFW+S  K+I + GLIIL  VI  GGGP  H  LGF ++ HPGAFKP+  +  G+ GK
Sbjct: 201 ESEFWVSMIKLITITGLIILGVVIFFGGGPNQHHVLGFHYWKHPGAFKPHIST--GNTGK 258

Query: 287 XXXX-XXXXXXXXXXXXGIELTGIVAAEAANPRKSIPKAIKLTMYRIIVFYLVTIFLLGM 345
                              E     +AEA  PR+++P+A    ++R+++FY+    ++G+
Sbjct: 259 FLAVWTAIIKSGFAFILSPETLTSCSAEADRPRRNMPRAANRFVWRLMLFYIGGALVVGV 318

Query: 346 CVAYDDP-LLXXXXXXXXXXXXXPYVVAIINSGIKALPHIFNACVLMFVFSACNSDLYVA 404
            V YD+  LL             P+V+ I   GIK LPHI NA +L   +SA  +++Y A
Sbjct: 319 TVGYDNQNLLSAIASGQSNAAASPFVIGIKEVGIKVLPHIINAAILTGAYSAGTAEMYGA 378

Query: 405 SRTLYGLAIDNKAPKIFAVTNRWGVPYYSLLMSSCFCLLAYMSVSSGSAKIFNYFVNVVS 464
           SR L+ +A+   APKIFA  NR+GVPYYS+++ SCFC LAY++ S+ ++++F +  N+ +
Sbjct: 379 SRMLHSMALKGNAPKIFARVNRYGVPYYSIIVPSCFCFLAYLNCSNSASQVFTWLTNIST 438

Query: 465 IFGLLSWISILITYLCFFRAVKAQNVDRSRFAYRAPFQPYGSYFTLAFCILIAFIKNFTV 524
           I G +SW+ + ITY+ F R +   +++  R  +R PFQ   +YF+  F ++++    + V
Sbjct: 439 ISGFISWVFVSITYVRFRRVIDYLDLN-DRIKFRKPFQRIFAYFSGCFFVILSLTNGYAV 497

Query: 525 FLNHHFDYKNFITGYIGIP-VFVISYFGYKFVKKTKIWKPEEVDLYTF-KAAIDEEEEQG 582
           F   ++   +F   YI I  V V+   G  + K+ +    EE+      K  + +EEE  
Sbjct: 498 FTKGNWSVSDFFANYITIGFVVVLFIMGTAYYKEWRFRDMEEIRSELIPKIDMADEEESN 557

Query: 583 KI 584
           +I
Sbjct: 558 EI 559

>Kwal_33.13411 s33 (210461..212143) [1683 bp, 560 aa] {ON} YNL268W
           (LYP1) - lysine permease [contig 117] FULL
          Length = 560

 Score =  301 bits (770), Expect = 7e-94,   Method: Compositional matrix adjust.
 Identities = 168/510 (32%), Positives = 279/510 (54%), Gaps = 13/510 (2%)

Query: 77  DDGKDEHTRLRKDLKARHISMIAXXXXXXXXXXXXXXXXXYTAGPMSMFIAYAFVGVLVF 136
           D+G  +  ++++ LK RH+SMIA                  +AGP+   IAY F+G +V+
Sbjct: 45  DEGDLQEGQVKRALKPRHVSMIALGGTIGTGLFVGIASPLSSAGPVGALIAYIFMGSIVY 104

Query: 137 FTMAALGEMASYIPL-DGFTSYASRYCDPALGFAVGYAYLCKYLILPPNQLTAAALVIQY 195
           F   ++GEMA++IP+    T +++R+  PA G A GY Y   + I    +++    VIQY
Sbjct: 105 FVTQSMGEMATFIPVTSSITVFSNRFLSPAFGVANGYMYWFNWAITYAVEISVIGQVIQY 164

Query: 196 WLDREQVNPGVWITIFLVIIVAMNFIGVKFFGEFEFWLSTFKVIVMIGLIILLFVIMLGG 255
           W   + V    WI IF V I   NF  V+F+GE EFW+++ KVI ++G ++   +I+ GG
Sbjct: 165 W--TKAVPLAAWIGIFWVAITLANFFPVRFYGEVEFWVASIKVIAIVGYLLYALIIVCGG 222

Query: 256 GPTHDRLGFRFYDHPGAFKPYSKSIDGSKGKXXXXXXXXXXXXXXXXGIELTGIVAAEAA 315
                 +GFR++ +PG +     S D  KG+                G EL GI A EAA
Sbjct: 223 S-KQGPIGFRYWRNPGPWGDGIISGDKDKGRFLGWVASLINASFTYQGTELVGITAGEAA 281

Query: 316 NPRKSIPKAIKLTMYRIIVFYLVTIFLLGMCVAYDDPLLXXXXXXXXXXXXXPYVVAIIN 375
           NPRK++PKAI    +RI+ FY++++F +G+ V Y+ P L             P+V++I +
Sbjct: 282 NPRKTVPKAINKVFFRILFFYILSLFFVGLLVPYNHPGLDKHTSVIASS---PFVISIQS 338

Query: 376 SGIKALPHIFNACVLMFVFSACNSDLYVASRTLYGLAIDNKAPKIFAVTNRWGVPYYSLL 435
           +G + LP IFNA VL+ + SA NS++YV SR L+ LA    APK F+     GVPY  ++
Sbjct: 339 AGTRILPDIFNAVVLVTIISAANSNVYVGSRILFSLAHTGIAPKQFSYVTNQGVPYLGVI 398

Query: 436 MSSCFCLLAYMSVSSGSAKIFNYFVNVVSIFGLLSWISILITYLCFFRAVKAQNVDRSRF 495
            ++   LLA++ V   + + FN+ +N+ ++ GL +W+ I I+++ F + +K + + R   
Sbjct: 399 CTALLGLLAFLVVDDNANEGFNWLINISTLAGLCAWLFISISHIRFMQCLKQRGISRDDL 458

Query: 496 AYRAPFQPYGSYFTLAFCILIAFIKNFTVFLNHHFDYKNFITGYIGIPVFVISYFGYKFV 555
            +++   PYG+Y+   +  +I F++ F  F    F    F TGYI + +  + +   +  
Sbjct: 459 PFKSKLMPYGAYYAAFWVAVIIFVQGFQAFC-PKFKVAEFFTGYISLILLAVVFCLAQLY 517

Query: 556 KKTKIW-KPEEVDLYTFKAAID----EEEE 580
            + + + + E++D+ + +  ID    EEEE
Sbjct: 518 YRCRFFNRLEDIDIDSDRREIDALIWEEEE 547

>KNAG0C00790 Chr3 (138911..140650) [1740 bp, 579 aa] {ON} 
          Length = 579

 Score =  301 bits (770), Expect = 1e-93,   Method: Compositional matrix adjust.
 Identities = 175/521 (33%), Positives = 283/521 (54%), Gaps = 18/521 (3%)

Query: 72  QDDYMDDGKDEHTRLRKDLKARHISMIAXXXXXXXXXXXXXXXXXYTAGPMSMFIAYAFV 131
           Q  Y+ D +     ++++LK RHI MIA                   AGP+   I+Y F+
Sbjct: 64  QTGYVHDAE-----VKRELKQRHIGMIALGATIGTGLFIGLSTPLKQAGPVGALISYIFM 118

Query: 132 GVLVFFTMAALGEMASYIPL-DGFTSYASRYCDPALGFAVGYAYLCKYLILPPNQLTAAA 190
           G LV+    +LGEMA++IP+   FT +A R+  P++G A GY Y   + +    +L+   
Sbjct: 119 GTLVYSVTQSLGEMATFIPVTSSFTVFAQRFLSPSIGAATGYMYWFSWAVTFALELSVIG 178

Query: 191 LVIQYWLDREQVNPGVWITIFLVIIVAMNFIGVKFFGEFEFWLSTFKVIVMIGLIILLFV 250
            VIQYW     V    WI+IF V+I A N   VK++GE EFW++  KVI ++G ++    
Sbjct: 179 QVIQYW--TYAVPLAAWISIFWVVITAGNMFPVKYYGEVEFWIAFIKVIAIVGFLLYCLC 236

Query: 251 IMLGGGPTHDRLGFRFYDHPGAFKPYSKSIDGSKGKXXXXXXXXXXXXXXXXGIELTGIV 310
           ++ G G T   +GFR++ +PG + P   S D ++ +                G EL GI 
Sbjct: 237 MVCGAGVTGP-VGFRYWRNPGPWGPGIISKDKNEARFLGWVSSLINGAFTYQGTELVGIS 295

Query: 311 AAEAANPRKSIPKAIKLTMYRIIVFYLVTIFLLGMCVAYDDPLLXXXXXXXXXXXXXPYV 370
           A EAANPRK++P+AIK  ++RI+ FY+ ++F +G+ V Y+D  L             P++
Sbjct: 296 AGEAANPRKAVPRAIKKVVFRILFFYIGSLFFIGLLVPYNDDALNNTDSYVASS---PFI 352

Query: 371 VAIINSGIKALPHIFNACVLMFVFSACNSDLYVASRTLYGLAIDNKAPKIFAVTNRWGVP 430
           +AI NSG   LPHIFNA +   + SA NS++YV SR L+GL+ +  APKI + T + GVP
Sbjct: 353 IAIKNSGTPVLPHIFNAVIACTIVSAGNSNVYVGSRILFGLSKNKLAPKILSRTTKGGVP 412

Query: 431 YYSLLMSSCFCLLAYMSVSSGSAKIFNYFVNVVSIFGLLSWISILITYLCFFRAVKAQNV 490
           + ++L++S    LAYM  S+G    FN+ +N+ ++ G  +W+ I ++++ F +A+K + +
Sbjct: 413 WIAVLVTSVVGALAYMETSTGGQNAFNWLLNITAVAGFFTWLFISLSHIRFMQALKYRGI 472

Query: 491 DRSRFAYRAPFQPYGSYFTLAFCILIAFIKNFTVFLNHHFDYKNFITGYIGIPVFVISYF 550
            R    ++A   P  +Y+      +I  I+ FT F    F   +F   YI I +F+  + 
Sbjct: 473 SRDDLPFKAALMPGLAYYASFLMFVIIIIQGFTAF-APKFSGSDFAAAYISIFLFIGIWC 531

Query: 551 GYKFVKKTK-IWKPEEVDLYT----FKAAIDEEEEQGKIAD 586
            ++ + + + I K E+VD+ T     +A + E+ E   + D
Sbjct: 532 LFQIIFRCRFIHKVEDVDIDTDRRDIEAVVWEDAEPKTVWD 572

>KLLA0C02365g Chr3 (208462..210201) [1740 bp, 579 aa] {ON} similar
           to uniprot|P32487 Saccharomyces cerevisiae YNL268W LYP1
           Lysine permease one of three amino acid permeases (Alp1p
           Can1p Lyp1p) responsible for uptake of cationic amino
           acids
          Length = 579

 Score =  301 bits (770), Expect = 1e-93,   Method: Compositional matrix adjust.
 Identities = 169/494 (34%), Positives = 273/494 (55%), Gaps = 14/494 (2%)

Query: 48  KDGLDINDMDNLSTVSSRLEDSEKQDDYMDDGKDEHTRLRKDLKARHISMIAXXXXXXXX 107
           +D ++++D+     VSS L D  + ++   +G    T +++ LK RH+SMIA        
Sbjct: 41  EDSIELSDVQ----VSSELYDHAESEE--GEGDFHETEVKRALKPRHVSMIALGGTIGTG 94

Query: 108 XXXXXXXXXYTAGPMSMFIAYAFVGVLVFFTMAALGEMASYIPL-DGFTSYASRYCDPAL 166
                      +GP+   IAY F+G +V+F   +LGEMA++IP+    T ++ R+  PA 
Sbjct: 95  LFVGIAKPLSLSGPVGSLIAYIFMGSVVYFVTQSLGEMATFIPVTSSITVFSKRFLSPAF 154

Query: 167 GFAVGYAYLCKYLILPPNQLTAAALVIQYWLDREQVNPGVWITIFLVIIVAMNFIGVKFF 226
           G A GY Y   + I    +L+    +I YW D   V    WI IF V++ A NF  VK++
Sbjct: 155 GVANGYMYWFNWAITYAVELSVLGQIINYWTD--AVPLAAWIAIFWVLLTAANFFPVKWY 212

Query: 227 GEFEFWLSTFKVIVMIGLIILLFVIMLGGGPTHDRLGFRFYDHPGAFKPYSKSIDGSKGK 286
           GEFEF +++ KVI ++G ++   +I+ GG  +   +GFR++ +PG +   + + + +K +
Sbjct: 213 GEFEFCVASIKVIAIVGYLLYALIIVCGGS-SQGPIGFRYWRNPGPWGTGTIAKNVNKAR 271

Query: 287 XXXXXXXXXXXXXXXXGIELTGIVAAEAANPRKSIPKAIKLTMYRIIVFYLVTIFLLGMC 346
                           G EL GI A EA+NPRK++PKAI    +RI+VFY+ ++F +G+ 
Sbjct: 272 FLGWVGSLVNASFTYQGTELVGITAGEASNPRKTVPKAINKVFFRILVFYIGSLFFVGLL 331

Query: 347 VAYDDPLLXXXXXXXXXXXXXPYVVAIINSGIKALPHIFNACVLMFVFSACNSDLYVASR 406
           V Y+ P L             P+V++I N+G K LP IFNA VL+ + SA NS++YV SR
Sbjct: 332 VPYNSPQLESNSAVIASS---PFVISIQNAGTKVLPDIFNAVVLVTILSAGNSNVYVGSR 388

Query: 407 TLYGLAIDNKAPKIFAVTNRWGVPYYSLLMSSCFCLLAYMSVSSGSAKIFNYFVNVVSIF 466
            LY LA+   APK F+   + GVPY  ++ ++   LLA+++ +  +   FN+ +N+ ++ 
Sbjct: 389 VLYSLALSGNAPKQFSYVTKQGVPYLGVICTALLGLLAFLATNENANTAFNWLINISTLA 448

Query: 467 GLLSWISILITYLCFFRAVKAQNVDRSRFAYRAPFQPYGSYFTLAFCILIAFIKNFTVFL 526
           GL +W  I + ++ F + +K + + R    ++A   P+G+Y+   F  LI FI+ FT F 
Sbjct: 449 GLCAWFFISVAHIRFMQCLKLRGISRDSLPFKAKLMPWGAYYAAFFVGLIVFIQGFTAFA 508

Query: 527 NHHFDYKNFITGYI 540
              FD   F T YI
Sbjct: 509 -PRFDVSEFFTAYI 521

>Smik_6.482 Chr6 complement(795927..797603) [1677 bp, 558 aa] {ON}
           YPL265W (REAL)
          Length = 558

 Score =  298 bits (763), Expect = 7e-93,   Method: Compositional matrix adjust.
 Identities = 184/545 (33%), Positives = 275/545 (50%), Gaps = 29/545 (5%)

Query: 56  MDNLSTVSSRLEDSEKQDDYMDDGKDEH------------------TRLRKDLKARHISM 97
           M  +   S+  ++  K   Y +D  +EH                  T+L++ LK RHI M
Sbjct: 1   MSEIGDESTNSQEKVKPKIYEEDVDEEHDIVSVEETVKRGVLHNDRTKLKQGLKERHIKM 60

Query: 98  IAXXXXXXXXXXXXXXXXXYTAGPMSMFIAYAFVGVLVFFTMAALGEMASYIPLDGFT-S 156
           +                     GP+ + IAY FVG++V     A+ E+AS++P  G T  
Sbjct: 61  LTLVGVFGTGLFLSSGGTLKKTGPVGLLIAYLFVGIVVGCNQIAIAEVASFMPATGATIR 120

Query: 157 YASRYCDPALGFAVGYAYLCKYLILPPNQLTAAALVIQYWLDREQVNPGVWITIFLVIIV 216
           +A ++ D ++GF  G+  +  Y  L P +L+A A++++YW D   V+P V+IT+F ++ V
Sbjct: 121 HAEQFIDESVGFTFGW--ISTYSSLMPGELSATAVIMRYWTD---VSPAVFITVFGILFV 175

Query: 217 AMNFIGVKFFGEFEFWLSTFKVIVMIGLIILLFVIMLGGGPTHDRLGFRFYDHPGAFKPY 276
             N   ++F+GE E+     K++++  LII   VI LGG    +RLGF ++  PG F  Y
Sbjct: 176 VTNIYTIRFYGELEYIFGWLKLVLIFILIISGLVIDLGGTKGQERLGFHYWREPGPFANY 235

Query: 277 SKSIDGSKGKXXXXXXXXXXXXXXXXGIELTGIVAAEAANPRKSIPKAIKLTMYRIIVFY 336
              + G  GK                GI+   I+A E  N R +I    K    RIIV Y
Sbjct: 236 L--VGGHIGKFVGFWAAISSVVYSYSGIQNIAILAGETKNSRHAIFHGAKNVFLRIIVLY 293

Query: 337 LVTIFLLGMCVAYDDPLLXXXXXXXXXXXXXPYVVAIINSGIKALPHIFNACVLMFVFSA 396
           LVT+F+L + V Y+D L+             P+V+A+  +GIK LPHI NA +L   +SA
Sbjct: 294 LVTVFILTLIVPYNDKLIATGTGTARSS---PFVIAMNRAGIKVLPHIVNALILTSAWSA 350

Query: 397 CNSDLYVASRTLYGLAIDNKAPKIFAVTNRWGVPYYSLLMSSCFCLLAYMSVSSGSAKIF 456
            N  +   SR L+ LA  N+APKIF  T++ G+PY  ++  S F  LAYMS S  SA +F
Sbjct: 351 GNLAIIEGSRNLFCLATKNQAPKIFLRTSKRGIPYVGVIFISSFLPLAYMSCSKSSATVF 410

Query: 457 NYFVNVVSIFGLLSWISILITYLCFFRAVKAQNVDRSRFAYRAPFQPYGSYFTLAFCILI 516
            +F  +VS   LL WI I   ++   RA+KAQ   RS   Y  P  P+ ++F+     + 
Sbjct: 411 GWFQELVSSNTLLRWILISANHIHMDRALKAQGYSRSDLPYSTPMGPFAAWFSGIMSFIF 470

Query: 517 AFIKNFTVFLNHHFDYKNFITGYIGIPVFVISYFGYKFVKKTKIWKPEEVDLYTFKAAID 576
                F  F++ HFD ++F T Y  IP+ +  +  +K  KKTK  +P EVDL +    I 
Sbjct: 471 LLTGGFYNFIHGHFDIESFFTRYFIIPLAIGLFTFWKLFKKTKYLRPHEVDLESIFDDIK 530

Query: 577 EEEEQ 581
           E  E 
Sbjct: 531 ENPEH 535

>Kwal_8.590 s8 complement(17220..19109) [1890 bp, 629 aa] {ON}
           YOR348C (PUT4) - putative proline-specific permease
           [contig 311] FULL
          Length = 629

 Score =  299 bits (765), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 188/568 (33%), Positives = 288/568 (50%), Gaps = 35/568 (6%)

Query: 47  KKDGLDINDMDNLSTVSSRLEDSEKQ--DDYMDDGKD---------EHTRLRKDLKARHI 95
           KK+  ++N         + LE+ E    DD++   +D         E    R+ L  R +
Sbjct: 75  KKEAFELN--------VTSLEEGETATIDDFVLQNRDSPKSQSLSLEERIARRKLLPRQV 126

Query: 96  SMIAXXXXXXXXXXXXXXXXXYTAGPMSMFIAYAFVGVLVFFTMAALGEMASYIPLDG-F 154
           SMI                     GP S+ IA+    V+       +  M +Y+P+ G F
Sbjct: 127 SMIGIGGAIGTALFVSIGTKIIQGGPGSLLIAFCLWSVVFIGLSKCMCVMVTYLPVTGSF 186

Query: 155 TSYASRYCDPALGFAVGYAYLCKYLILPPNQLTAAALVIQYWLDREQVNPGVWITIFLVI 214
             +  R+ D + GFAVG+ Y          ++TA  LV++YW D+  +     I++ +++
Sbjct: 187 VHFTERFVDQSCGFAVGWTYFVCQAANVCFEITAVCLVVEYWTDK--IPKAALISMLIIL 244

Query: 215 IVAMNFIGVKFFGEFEFWLSTFKVIVMIGLIILLFVIMLGGGPTHDRLGFRFYDHPGAFK 274
             ++N   V FFGE EF+LS  KV++ IGLII   V+M GG P H  LGF+ + +PGAF 
Sbjct: 245 FGSLNLYSVFFFGEGEFYLSIGKVVLAIGLIIFTVVVMAGGNPQHTVLGFKNWSNPGAFA 304

Query: 275 PYSKSIDGSKGKXXXXXXXXXXXXXXXXGIELTGIVAAEAANPRKSIPKAIKLTMYRIIV 334
            Y    DGS G+                G++  G  A+EA NPRK IP + +    R+I+
Sbjct: 305 EYIS--DGSVGRFHGFMSCLVFALYVFWGVDYLGNAASEAMNPRKVIPSSFRKVFGRLII 362

Query: 335 FYLVTIFLLGMCVAYDDP-LLXXXXXXXXXXXXXPYVVAIINSGIKALPHIFNACVLMFV 393
           FY+     +G+ + Y+DP ++             PYV A+   GI+ LPHI N  +L  +
Sbjct: 363 FYIGGAICVGILIPYNDPNMIRAIKEGAVGAGASPYVSAMKTLGIRVLPHIVNILILTSI 422

Query: 394 FSACNSDLYVASRTLYGLAIDNKAPKIFAVTNRWGVPYYSLLMSSCFCLLAYMSVSSGSA 453
            SA NS LY ASR L+ LA+DN+AP+IF VT + GVP Y  +     C LAY+SVS+ + 
Sbjct: 423 ISAGNSSLYSASRVLHRLALDNQAPRIFKVTTKKGVPVYCCIAVLVICGLAYLSVSNSTN 482

Query: 454 KIFNYFVNVVSIFGLLSWISILITYLCFFRAVKAQNVDRSRFAYRAPFQPYGSYFTLAFC 513
            +  +F+NV +    + +I I ++YL F +   AQNVD     Y +   PY ++ +L + 
Sbjct: 483 NVLTWFLNVETAAMAIVYIFICVSYLQFRKGCLAQNVDLKSLPYYSSSLPYLAWHSLFWL 542

Query: 514 ILIAFIKNFTVFLNHHFDYKNFITGYIGIPVFVISYFGYKFVKKTKIWKPEEVDLYTFKA 573
           +L+  +  +TVFL   +D ++F+  Y  IP F++  FG+K  K TK  +P E+DL+T   
Sbjct: 543 VLMLLVNGYTVFLKGSWDTQSFVFSYFMIPFFLVFLFGHKLYKGTKSVRPLEMDLFT--- 599

Query: 574 AIDEEEEQGKIADAERRERLKNSKTKGW 601
            I+E      +AD E R   +N  T  W
Sbjct: 600 GIEE------LAD-EDRYWAENPPTLNW 620

>Suva_13.517 Chr13 (904704..906347) [1644 bp, 547 aa] {ON} YPL265W
           (REAL)
          Length = 547

 Score =  296 bits (757), Expect = 3e-92,   Method: Compositional matrix adjust.
 Identities = 190/531 (35%), Positives = 278/531 (52%), Gaps = 20/531 (3%)

Query: 52  DINDMDNLSTVSSRLEDSEKQDDYMDDGKDEHTRLRKDLKARHISMIAXXXXXXXXXXXX 111
           D+ D D  ST     +++ KQ    +D     T+L++ LK RHI M+             
Sbjct: 19  DVEDCDIRST-----DETLKQGVLHND----RTKLKQGLKERHIKMLTLVGVFGTGLFLS 69

Query: 112 XXXXXYTAGPMSMFIAYAFVGVLVFFTMAALGEMASYIPLDGFT-SYASRYCDPALGFAV 170
                   GP+ + IAY FVG++V     A+ E+AS++P  G T  +A ++ D ++GF  
Sbjct: 70  SGGTLKKTGPVGLLIAYLFVGIVVGCNQIAIAEVASFMPATGATIRHAEQFIDESVGFTF 129

Query: 171 GYAYLCKYLILPPNQLTAAALVIQYWLDREQVNPGVWITIFLVIIVAMNFIGVKFFGEFE 230
           G+  +  Y  L P +L+A A++++YW D   ++P V+ITIF V+ V  N   ++F+GE E
Sbjct: 130 GW--ISTYSSLMPGELSATAVIMRYWTD---ISPAVFITIFGVLFVVTNIYTIRFYGEVE 184

Query: 231 FWLSTFKVIVMIGLIILLFVIMLGGGPTHDRLGFRFYDHPGAFKPYSKSIDGSKGKXXXX 290
           +     K+I++  LII   VI LGG    +RLGF ++  PG F  Y   + GS GK    
Sbjct: 185 YVFGWLKLILIFILIISGLVIDLGGVKGQERLGFHYWRDPGPFAEYI--VGGSIGKFVGF 242

Query: 291 XXXXXXXXXXXXGIELTGIVAAEAANPRKSIPKAIKLTMYRIIVFYLVTIFLLGMCVAYD 350
                       GI+   I+A E  N R +I    K    RIIV YLVT+F+L + V Y+
Sbjct: 243 WSALSSVVYSYSGIQNIAILAGETKNSRHAIYHGAKNVFLRIIVLYLVTVFVLTLIVPYN 302

Query: 351 DPLLXXXXXXXXXXXXXPYVVAIINSGIKALPHIFNACVLMFVFSACNSDLYVASRTLYG 410
           D L+             P+V+A+  +GIK LPHI NA VL   +SA N  +   SR L+ 
Sbjct: 303 DALIASGTGTAKSS---PFVIAMNRAGIKVLPHIVNALVLTSAWSAGNLAIIEGSRNLFC 359

Query: 411 LAIDNKAPKIFAVTNRWGVPYYSLLMSSCFCLLAYMSVSSGSAKIFNYFVNVVSIFGLLS 470
           LA  N+APKIF  T++ G+PY  ++  SCF  LAYMS S  S+ +F +F  +VS   LL 
Sbjct: 360 LATKNQAPKIFLKTSKRGIPYVGVIFISCFLPLAYMSCSESSSTVFGWFQELVSSNTLLR 419

Query: 471 WISILITYLCFFRAVKAQNVDRSRFAYRAPFQPYGSYFTLAFCILIAFIKNFTVFLNHHF 530
           WI I   ++   RA+KAQ   RS   Y  P  PY ++F+     +      F  F++ HF
Sbjct: 420 WILISANHIYMDRALKAQGYSRSDLPYSTPIAPYAAWFSGIMSFIFLLTGGFYNFIHGHF 479

Query: 531 DYKNFITGYIGIPVFVISYFGYKFVKKTKIWKPEEVDLYTFKAAIDEEEEQ 581
           D ++F T Y  IP+ +  +  +K  KKT+  +PEEVDL +    I E  E 
Sbjct: 480 DIESFFTRYFIIPLAIGLFTFWKLFKKTRYLRPEEVDLASIFDDIRENPEH 530

>AFR668W Chr6 (1659910..1661580) [1671 bp, 556 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YEL063C (CAN1) and
           YNL270C (ALP1)
          Length = 556

 Score =  292 bits (748), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 158/481 (32%), Positives = 262/481 (54%), Gaps = 7/481 (1%)

Query: 80  KDEHTRLRKDLKARHISMIAXXXXXXXXXXXXXXXXXYTAGPMSMFIAYAFVGVLVFFTM 139
           K   + ++++LK RH++MI+                   AGP+   +AY FV  + +   
Sbjct: 43  KPNQSDVKRELKPRHVTMISLGGTIGTGLFIGIASPIRNAGPVGSLLAYIFVATMAYCVT 102

Query: 140 AALGEMASYIPL-DGFTSYASRYCDPALGFAVGYAYLCKYLILPPNQLTAAALVIQYWLD 198
            +LGEMA++IP+   FT +ASR+  PALG A GY Y   + I    +++    +I YW D
Sbjct: 103 QSLGEMATFIPVTSSFTVFASRFVSPALGAANGYLYWLSWCITFALEISVIGRLILYWSD 162

Query: 199 REQVNPGVWITIFLVIIVAMNFIGVKFFGEFEFWLSTFKVIVMIGLIILLFVIMLGGGPT 258
              +    W+ IF V++ A+N I VKF+GEFEFW+++ KVI ++  +    V++ GG   
Sbjct: 163 AVPIT--AWMAIFWVLLTAINLIPVKFYGEFEFWIASLKVIAILCFLFYGLVVVCGGSKL 220

Query: 259 HDRLGFRFYDHPGAFKPYSKSIDGSKGKXXXXXXXXXXXXXXXXGIELTGIVAAEAANPR 318
             R+GFR++  PG +     S +    +                G EL G+ A E  NPR
Sbjct: 221 -GRIGFRYWKDPGPWGVGIVSQEIHTAQFLGWVSSLIKAAFTFQGTELVGVTAGETKNPR 279

Query: 319 KSIPKAIKLTMYRIIVFYLVTIFLLGMCVAYDDPLLXXXXXXXXXXXXXPYVVAIINSGI 378
           +++PKAI    +RI++FY+ ++ ++G+ V YDDP L             P+VVAI  +G 
Sbjct: 280 RTVPKAINTVFFRILLFYIGSLLVIGLLVRYDDPQLIQDGSTTNANAS-PFVVAINAAGT 338

Query: 379 KALPHIFNACVLMFVFSACNSDLYVASRTLYGLAIDNKAPKIFAVTNRWGVPYYSLLMSS 438
           K LP I N  +++ + SA NS++YV SR LYGL     AP   + T   GVPY ++L +S
Sbjct: 339 KVLPDIMNGVIMVTIISAGNSNIYVGSRVLYGLGRSGLAPAFISRTTSRGVPYVAVLATS 398

Query: 439 CFCLLAYMSVSSGSAKIFNYFVNVVSIFGLLSWISILITYLCFFRAVKAQNVDRSRFAYR 498
            F  L Y++VSS S  +F++ +++ ++ G  +W+ I ++++ F + +K + + R    ++
Sbjct: 399 MFGALGYLNVSSKSGSVFDWLLSITAVSGFFTWLLISVSHIRFMQCLKKRGISRDDLPFK 458

Query: 499 APFQPYGSYFTLAFCILIAFIKNFTVFLNHHFDYKNFITGYIGIPVFVISYFGYKFVKKT 558
           A F PYG+Y+   F I+I  ++ FT F    F   +F+  YI   +FV+ +  ++F+ K 
Sbjct: 459 AKFMPYGAYYAAFFVIVIILVQGFTAF--TPFSAVDFVAYYISAFIFVVIWLLFQFLFKG 516

Query: 559 K 559
           +
Sbjct: 517 R 517

>TBLA0C01240 Chr3 (270186..272075) [1890 bp, 629 aa] {ON} Anc_1.368
           YOL020W
          Length = 629

 Score =  293 bits (751), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 167/522 (31%), Positives = 284/522 (54%), Gaps = 24/522 (4%)

Query: 77  DDGKDEHTRLRKDLKARHISMIAXXXXXXXXXXXXXXXXXYTAGPMSMFIAYAFVGVLVF 136
           +DG+    +L++ L ARHI +IA                    GP  +  +Y  +  +V+
Sbjct: 95  EDGR--KNKLKQGLNARHIQLIALGGCIGTGLFVGAGITLNKCGPAGLVASYLIISTMVY 152

Query: 137 FTMAALGEMASYIPLDGFTSYAS------RYCDPALGFAVGYAYLCKYLILPPNQLTAAA 190
             M  LGEM  Y+P DG  S  S      RY D +L FA G+ Y   +++L   + TAA+
Sbjct: 153 PIMNVLGEMVCYLPGDGSDSAGSVPHLVKRYLDDSLSFAAGWNYYYCFVMLVAAECTAAS 212

Query: 191 LVIQYWLDREQVNPGVWITIFLVIIVAMNFIGVKFFGEFEFWLSTFKVIVMIGLIILLFV 250
            V++YW   + V    WI +F +II  +N   V+ +GE EFW +  K++ ++GLIIL F+
Sbjct: 213 GVVEYW--TKVVPKPAWIVMFQLIIFGLNMCPVRVYGESEFWFAISKILCIVGLIILSFI 270

Query: 251 IMLGGGPTHDRLGFRFYDHPGAFKPYSKSIDGSKGKXXXXXXXXXXXXXX-XXGIELTGI 309
           +  GGGP HDRLGFR++  PG+F   +   +GS G                  G EL  +
Sbjct: 271 LFWGGGPNHDRLGFRYWITPGSFA--NTITNGSFGNFLDVYKGIILGAFSFILGPELVVL 328

Query: 310 VAAEAANPRKSIPKAIKLTMYRIIVFYLVTIFLLGMCVAYDDPLLXXXXXXXX-XXXXXP 368
            ++E ++PR++I KA K  ++R++ FY++    + + V+Y+DP+L              P
Sbjct: 329 PSSECSDPRRNIKKASKRFIWRLMFFYILGTLSISVIVSYNDPILSTALIQDKPGAGSSP 388

Query: 369 YVVAIINSGIKALPHIFNACVLMFVFSACNSDLYVASRTLYGLAIDNKAPKIFAVTNRWG 428
           +V+ I N+GI  LPHI N C+L+  +S+ N+ L+ +SR+L  +AI+++APK     NR+G
Sbjct: 389 FVIGIQNAGIDVLPHIINVCILISAWSSGNAYLFASSRSLQTMAINSQAPKCLGKINRFG 448

Query: 429 VPYYSLLMSSCFCLLAYMSVSSGSAKIFNYFVNVVSIFGLLSWISILITYLCFFRAVKAQ 488
           VPY ++++S     +AY++ S  ++ +F +F N+ +I G L WI + +TYL F +A++  
Sbjct: 449 VPYVAVIVSIILSCIAYLNCSKSTSDVFKWFTNLSTISGFLGWIIVSVTYLRFRKAIEYH 508

Query: 489 NVDRSRFAYRAPFQPYGSYFTLAFCILIAFIKNFTVFLNHHFDYKNFITGYIGIPVFVIS 548
            + + R  Y    QPY   ++L   I+I     F + +  +++  +FI  Y+ +P+F++ 
Sbjct: 509 GM-KDRLPYTTWGQPYLIIYSLISFIIITITNGFDILIPRNWNVSDFIAAYLTLPIFLMI 567

Query: 549 YFGYKFVK--------KTKIW-KPEEVDLYTFKAAIDEEEEQ 581
           + G+KF K        + + W + E++D+ T    I+ E E+
Sbjct: 568 WIGHKFYKYRFKIFTRQCRWWYQVEDIDVITGLEEIEMESEK 609

>SAKL0F16544g Chr6 complement(1364680..1366383) [1704 bp, 567 aa]
           {ON} similar to gnl|GLV|KLLA0B14685g Kluyveromyces
           lactis KLLA0B14685g and weakly similar to YOR348C
           uniprot|P15380 Saccharomyces cerevisiae YOR348C PUT4
           proline- specific permease (also capable of transporting
           alanine and glycine) putative proline-specific permease
          Length = 567

 Score =  291 bits (746), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 175/544 (32%), Positives = 278/544 (51%), Gaps = 21/544 (3%)

Query: 54  NDMDNLSTVSSRLEDSEKQDDYMDDGKDEHTRLRKDLKARHISMIAXXXXXXXXXXXXXX 113
           + M   +  S      E     + D + +   + + LK+RH+ +IA              
Sbjct: 19  DRMKEKTQFSIHSTGDEVSQGSVLDIESQKPGIVRGLKSRHVQLIALGSAIGTGLFIGSG 78

Query: 114 XXXYTAGPMSMFIAYAFVGVLVFFTMAALGEMASYIPLDGFTSYASR---YCDPALGFAV 170
                 GP  + IAYA + + V+  M  + EM + IPL G ++  S    Y +  L F  
Sbjct: 79  GALSICGPAPLLIAYAVMSLFVWSVMNQMTEMVTLIPLPGESTLYSLLKLYVNKPLSFMC 138

Query: 171 GYAYLCKYLILPPNQLTAAALVIQYWLDREQVNPGVWITIFLVIIVAMNFIGVKFFGEFE 230
           G+       ++ P ++TA AL++QYW D    NP ++I+IFLV+ VA+  + VK FGE E
Sbjct: 139 GWNLFYAQAMIAPAEVTACALLVQYWTD---ANPAIFISIFLVLSVAITMLPVKVFGESE 195

Query: 231 FWLSTFKVIVMIGLIILLFVIMLGGGPTHDR-LGFRFYDHPGAFKPYSKSIDGSKGKXXX 289
           FW+S+ K++ ++GLII+  VI  GGGP  +  LGF ++  PGAFKPY   ++G  GK   
Sbjct: 196 FWVSSIKILTIVGLIIVGVVIFFGGGPAQEHVLGFHYWKKPGAFKPYL--VEGGTGKFLA 253

Query: 290 XXXXXXXXXXXXXGI-ELTGIVAAEAANPRKSIPKAIKLTMYRIIVFYLVTIFLLGMCVA 348
                         + E+    AAEA  PR+++P+A K  +YR+ +FY+  I ++G+ V 
Sbjct: 254 FWTAIIKSGFSFVLVPEIVSSCAAEAVAPRRNMPRACKRFIYRLALFYVFGILVVGVIVG 313

Query: 349 YD-DPLLXXXXXXXXXXXXXPYVVAIINSGIKALPHIFNACVLMFVFSACNSDLYVASRT 407
           YD D LL             P+V+ I  +GI+ LPHI NA +L   +S     LY ASRT
Sbjct: 314 YDNDRLLNAIASGQSSAAASPFVIGIKEAGIRVLPHIINAAILTSAYSCGTGLLYGASRT 373

Query: 408 LYGLAIDNKAPKIFAVTNRWGVPYYSLLMSSCFCLLAYMSVSSGSAKIFNYFVNVVSIFG 467
           L+ +A    AP+I    N++GVPYY   ++S FCLLAY++ S+ S+ +FN+  N+ +I G
Sbjct: 374 LHSMACKGDAPRILTTVNKYGVPYYCTGITSLFCLLAYLNCSNSSSVVFNWLSNIATISG 433

Query: 468 LLSWISILITYLCFFRAVKAQNVDRSRFAYRAPFQPYGSYFTLAFCILIAFIKNFTVFLN 527
            +SW+ + I Y+ F   +    ++  R  +R P+Q   +Y  + F  ++     F VF+ 
Sbjct: 434 FVSWVLVSIAYIRFRNVIDVLKLN-DRIPFRVPYQKPLAYLAMGFFSILTLTNGFAVFIK 492

Query: 528 HHFDYKNFITGYIGIPVFVISYFGYKFVKKTKIWKPEEVDLYTFKAAIDEEEEQGKIADA 587
            ++D  NF   YI +   ++ + G     K   W+  ++       A  E++   KI  A
Sbjct: 493 GNWDTSNFFAAYITLGFVLVLFVGSTIYYKE--WRCRDI-------AEIEQDILPKITLA 543

Query: 588 ERRE 591
           E  E
Sbjct: 544 EAEE 547

>TDEL0E05750 Chr5 (1074448..1076094) [1647 bp, 548 aa] {ON} 
          Length = 548

 Score =  287 bits (735), Expect = 7e-89,   Method: Compositional matrix adjust.
 Identities = 175/519 (33%), Positives = 271/519 (52%), Gaps = 14/519 (2%)

Query: 65  RLEDSEKQDDYMDDG--KDEHTRLRKDLKARHISMIAXXXXXXXXXXXXXXXXXYTAGPM 122
           +LE+    D+ +  G   ++ T+L++ LKARHI M+                     GP+
Sbjct: 23  QLEEGVTLDETIKQGVLHNDRTKLKQGLKARHIKMLTLVGVFGTGLFLSSGGTLKKTGPV 82

Query: 123 SMFIAYAFVGVLVFFTMAALGEMASYIPLDGFT-SYASRYCDPALGFAVGYAYLCKYLIL 181
            M IAY  VG++V     A+ E+AS++P  G T  ++ ++ D A+GF  G+  +  Y  L
Sbjct: 83  GMLIAYVLVGIVVGCNQIAIAEVASFMPATGATIRHSEQFIDEAVGFTFGW--ISTYSSL 140

Query: 182 PPNQLTAAALVIQYWLDREQVNPGVWITIFLVIIVAMNFIGVKFFGEFEFWLSTFKVIVM 241
            P +L+A A+V+ YW D   ++P ++ITIF V+ +  N   ++F+GE E++    K+ ++
Sbjct: 141 MPGELSATAVVMTYWTD---LSPAIFITIFGVLFILTNIYTIRFYGEIEYFFGWLKLALI 197

Query: 242 IGLIILLFVIMLGGGPTHDRLGFRFYDHPGAFKPYSKSIDGSKGKXXXXXXXXXXXXXXX 301
             LII   VI LGG    +RLGF ++ +PG F  Y   + G  GK               
Sbjct: 198 AILIITGLVIDLGG-TKQERLGFHYWRNPGPFAEYL--VGGDTGKFVGFWAALSSVVYSY 254

Query: 302 XGIELTGIVAAEAANPRKSIPKAIKLTMYRIIVFYLVTIFLLGMCVAYDDPLLXXXXXXX 361
            GI+   I+A E  N R +I    K    RII+ YL+T+F+L + V Y+D L+       
Sbjct: 255 SGIQNIAILAGETKNSRHAIFHGAKNVFVRIILLYLITVFVLTLIVPYNDKLIATGSGNA 314

Query: 362 XXXXXXPYVVAIINSGIKALPHIFNACVLMFVFSACNSDLYVASRTLYGLAIDNKAPKIF 421
                 P+V+A+  +GIK LPHI NA +L   +SA N  +   SR L+ LA  N+APKIF
Sbjct: 315 RSS---PFVIAMERAGIKVLPHIVNALILTSAWSAGNLAIIEGSRNLFCLATKNQAPKIF 371

Query: 422 AVTNRWGVPYYSLLMSSCFCLLAYMSVSSGSAKIFNYFVNVVSIFGLLSWISILITYLCF 481
             T++ G+P+  +L  S F  LAYMS S  SA +F++F  +VS   LL WI I   ++  
Sbjct: 372 LKTSKRGIPWVGVLFISSFLPLAYMSCSESSATVFSWFQELVSSNTLLRWILISANHIHM 431

Query: 482 FRAVKAQNVDRSRFAYRAPFQPYGSYFTLAFCILIAFIKNFTVFLNHHFDYKNFITGYIG 541
            RA++AQ   R    Y     PY ++F+     +      F  F++ +FD ++F + Y  
Sbjct: 432 DRALRAQGYSRKDLPYSTTIAPYAAWFSGIMSFIFLLTGGFYNFIHGNFDIESFFSRYFI 491

Query: 542 IPVFVISYFGYKFVKKTKIWKPEEVDLYTFKAAIDEEEE 580
           IP+ +  +  +K  KKT+  +P EVDL +    I E  E
Sbjct: 492 IPLAIALFTFWKLFKKTRYLRPHEVDLQSIFEDIRENPE 530

>KLLA0B14685g Chr2 complement(1289025..1290740) [1716 bp, 571 aa]
           {ON} weakly similar to uniprot|P15380 Saccharomyces
           cerevisiae YOR348C PUT4 proline-specific permease (also
           capable of transporting alanine and glycine) putative
           proline-specific permease
          Length = 571

 Score =  284 bits (726), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 173/541 (31%), Positives = 281/541 (51%), Gaps = 18/541 (3%)

Query: 60  STVSSRLEDSEKQDDYMD-DGKDEHTRLRKDLKARHISMIAXXXXXXXXXXXXXXXXXYT 118
           S+V+  + DS+ Q  Y D +      ++ + LK RHI +IA                   
Sbjct: 29  SSVNDVIGDSD-QGSYSDIENFKPPQKIVRGLKTRHIQLIALGSAIGTGLFIGSGGALSV 87

Query: 119 AGPMSMFIAYAFVGVLVFFTMAALGEMASYIPLDG---FTSYASRYCDPALGFAVGYAYL 175
            GP  + IAY  +   V+  M  + EM   IPL G     S A  Y +  + F  G+   
Sbjct: 88  CGPAPLLIAYIIISFFVWSIMNQMTEMVCLIPLPGEASLYSLAKTYLNSPISFMCGWNLF 147

Query: 176 CKYLILPPNQLTAAALVIQYWLDREQVNPGVWITIFLVIIVAMNFIGVKFFGEFEFWLST 235
               ++ P ++TA AL++QYW D    N  ++I+IF+V+ + +  + VK FGE EFW+S+
Sbjct: 148 YAMAMIVPAEITACALLVQYWTD---ANSAIFISIFIVVSILLTMLPVKVFGESEFWVSS 204

Query: 236 FKVIVMIGLIILLFVIMLGGGPTHDR-LGFRFYDHPGAFKPYSKSIDGSKGKXXXXXXXX 294
            K++ ++GLII+  VI  GGGP  D  LGF ++ +PGAF P+    +G+ G+        
Sbjct: 205 IKILTIVGLIIVGIVIFFGGGPAQDHVLGFHYWKNPGAFNPHLA--EGNTGRFLAVWTAI 262

Query: 295 XXXXXXXXGI-ELTGIVAAEAANPRKSIPKAIKLTMYRIIVFYLVTIFLLGMCVAYD-DP 352
                    + E     +AE   PR+++PKA +  +YR+ +FY+V   ++G+ V ++ D 
Sbjct: 263 IKSGFSFVLVPETVTSCSAECIAPRRNMPKACQRFIYRLAIFYIVGTLVVGVIVGFNNDR 322

Query: 353 LLXXXXXXXXXXXXXPYVVAIINSGIKALPHIFNACVLMFVFSACNSDLYVASRTLYGLA 412
           L+             P+V+ I  +GIK LPHI NAC+L   +S     LY +SRTLY +A
Sbjct: 323 LINAIQSGKSDAAASPFVIGIQEAGIKILPHIINACILTSAYSCGTGLLYGSSRTLYSMA 382

Query: 413 IDNKAPKIFAVTNRWGVPYYSLLMSSCFCLLAYMSVSSGSAKIFNYFVNVVSIFGLLSWI 472
           +   APKIFA  NR+G PYYS  ++S F  LAY++ S  ++ +FN+  N+ +I G +SWI
Sbjct: 383 LRGDAPKIFAKVNRFGTPYYSTGLASLFSFLAYLNCSKSASVVFNWLSNIATISGFVSWI 442

Query: 473 SILITYLCFFRAVKAQNVDRSRFAYRAPFQPYGSYFTLAFCILIAFIKNFTVFLNHHFDY 532
            + +TY+ F + + A +++  R  +R PFQ   +Y T  F  +++    + VF+  +++ 
Sbjct: 443 FVSMTYIRFRKVINALDLN-DRVPFRRPFQVPLAYLTCGFFFILSLTNGYAVFVKGNWNV 501

Query: 533 KNFITGYIGIPVFVISYFGYKFVKKT---KIWKPEEVDLYTFKAAIDEEEEQGKIADAER 589
            +F   Y+ I   +  Y    F  K    + +K  EV++   K  I +EEE+  +    R
Sbjct: 502 SDFFASYVTIGFVIFLYLVGSFYYKQWTFRDFKEIEVEILP-KIDIADEEERNDVIPVPR 560

Query: 590 R 590
            
Sbjct: 561 N 561

>KLTH0B00154g Chr2 complement(7385..9055) [1671 bp, 556 aa] {ON}
           weakly similar to uniprot|P38090 Saccharomyces
           cerevisiae YBR132C High affinity polyamine permease,
           preferentially uses spermidine over putrescine;
           expression is down-regulated by osmotic stress; plasma
           membrane carnitine transporter, also functions as a
           low-affinity amino acid permease
          Length = 556

 Score =  283 bits (723), Expect = 4e-87,   Method: Compositional matrix adjust.
 Identities = 174/539 (32%), Positives = 272/539 (50%), Gaps = 10/539 (1%)

Query: 46  DKKDGLDINDMDNLSTVSSRLEDSEKQDDYMDDGKD---EHTRLRKDLKARHISMIAXXX 102
            KK+  ++         ++ + D   +     +G+    E    R+ L  R +SMI    
Sbjct: 2   SKKENFELAVTTLEEGETTTIHDVGAETIRSLEGQAPSLEERIARRKLFPRQVSMIGIGG 61

Query: 103 XXXXXXXXXXXXXXYTAGPMSMFIAYAFVGVLVFFTMAALGEMASYIPLDG-FTSYASRY 161
                            GP S+ IA+    V+       +  M +Y+P+ G F  +  R+
Sbjct: 62  AIGTALFVSIGTQIIHGGPGSLLIAFCLWSVVFIGLSQCMCVMVTYLPVTGSFVHFTERF 121

Query: 162 CDPALGFAVGYAYLCKYLILPPNQLTAAALVIQYWLDREQVNPGVWITIFLVIIVAMNFI 221
            D + GF+VG+ Y          ++TA  LV+++W D+  +     I+I + +  ++N  
Sbjct: 122 VDSSCGFSVGWTYFVCQAANVCFEITAVCLVVEFWTDK--IPKAALISILIALFGSLNLF 179

Query: 222 GVKFFGEFEFWLSTFKVIVMIGLIILLFVIMLGGGPTHDRLGFRFYDHPGAFKPYSKSID 281
            V  FGE EF+LS  KVI+ IGLI    V+M GG P H  LGF+ + +PGAF  Y     
Sbjct: 180 SVFIFGEGEFYLSIGKVILAIGLIFFTIVVMAGGNPQHKVLGFKNWSNPGAFAEYIS--K 237

Query: 282 GSKGKXXXXXXXXXXXXXXXXGIELTGIVAAEAANPRKSIPKAIKLTMYRIIVFYLVTIF 341
           GS GK                G++  G  A+EA NPRK IP + +    R+I+FY+    
Sbjct: 238 GSAGKFHGFMSCLIFALYVFWGVDYLGNAASEAMNPRKVIPSSFRKVFGRLIIFYIGGAI 297

Query: 342 LLGMCVAYDDP-LLXXXXXXXXXXXXXPYVVAIINSGIKALPHIFNACVLMFVFSACNSD 400
            +G+ V ++D  ++             PYV A+   GI  LPHI N  +L  + SA NS 
Sbjct: 298 CVGILVPFNDHNMIKAISEGAVGAGASPYVSAMKTLGIGVLPHIVNVLILTSIISAGNSS 357

Query: 401 LYVASRTLYGLAIDNKAPKIFAVTNRWGVPYYSLLMSSCFCLLAYMSVSSGSAKIFNYFV 460
           LY ASR L+ LA++ +APK+F +T R GVP Y  +     C LAY+SVS+ +  +  +F+
Sbjct: 358 LYSASRVLHRLALEGQAPKLFKITKR-GVPIYCCVAVLLVCGLAYLSVSNSTNNVLTWFL 416

Query: 461 NVVSIFGLLSWISILITYLCFFRAVKAQNVDRSRFAYRAPFQPYGSYFTLAFCILIAFIK 520
           NV +    + +I I I+YL F +  KAQN+D     Y + F PY  + +L + +L+ F+ 
Sbjct: 417 NVETAAMAIVYIFICISYLQFAKGCKAQNIDLKTLPYSSSFLPYLGWHSLFWLVLMLFMN 476

Query: 521 NFTVFLNHHFDYKNFITGYIGIPVFVISYFGYKFVKKTKIWKPEEVDLYTFKAAIDEEE 579
            + VFL   +D ++FI  Y  IP F++ + G+K  KKT+  KP E+DL++  A + EE+
Sbjct: 477 GYAVFLKDSWDLQSFIFSYFMIPFFIVLFAGHKLYKKTRFVKPVEMDLFSGIAELAEED 535

>KLTH0F04048g Chr6 (359492..361243) [1752 bp, 583 aa] {ON} weakly
           similar to uniprot|P15380 Saccharomyces cerevisiae
           YOR348C PUT4 proline-specific permease (also capable of
           transporting alanine and glycine) putative
           proline-specific permease
          Length = 583

 Score =  281 bits (720), Expect = 3e-86,   Method: Compositional matrix adjust.
 Identities = 173/535 (32%), Positives = 273/535 (51%), Gaps = 24/535 (4%)

Query: 67  EDSEKQDDYMDDGKD---------EHTRLRKDLKARHISMIAXXXXXXXXXXXXXXXXXY 117
           E S  Q D + D +D         EH   RK LK+RHI +IA                  
Sbjct: 40  EKSAYQVDQIIDVEDASMELIEGQEHQVARK-LKSRHIQLIALGGAIGTGLFIGSGGALS 98

Query: 118 TAGPMSMFIAYAFVGVLVFFTMAALGEMASYIPLDGFTSY---ASRYCDPALGFAVGYAY 174
             GP  + I+Y  +   V+  M  L EM   +P+ G TS       Y +  L F  G   
Sbjct: 99  VCGPAPLLISYMIMSFFVWCIMNFLTEMVCMMPISGETSMFAMTGTYLNKPLSFMCGINL 158

Query: 175 LCKYLILPPNQLTAAALVIQYWLDREQVNPGVWITIFLVIIVAMNFIGVKFFGEFEFWLS 234
                ++ P+++TA A++IQYW D    N  ++I+IF+V+ V++  + V FFGE EFW+S
Sbjct: 159 FYAMSMIAPSEITATAILIQYWTD---ANSAIFISIFIVVTVSLTMLPVHFFGESEFWVS 215

Query: 235 TFKVIVMIGLIILLFVIMLGGGPTHDR-LGFRFYDHPGAFKPYSKSIDGSKGKXXXXXXX 293
             K+  + GL+IL  VI  GG P  D+ LGF ++ HPGAF P+   + G+ GK       
Sbjct: 216 IIKLFCITGLVILGIVIFFGGAPNQDKVLGFHYWKHPGAFNPHL--VPGNTGKFLACWTA 273

Query: 294 XXXXXXXXXGI-ELTGIVAAEAANPRKSIPKAIKLTMYRIIVFYLVTIFLLGMCVAYDDP 352
                     + E+    AAEA +PR+++P+  +  +YR+ +FY+     +G+ V YD+ 
Sbjct: 274 IIKSGFSYVLVPEVVVSCAAEAKDPRRNMPRVAQRFVYRLALFYVCGSLTIGIMVGYDNS 333

Query: 353 -LLXXXXXXXXXXXXXPYVVAIINSGIKALPHIFNACVLMFVFSACNSDLYVASRTLYGL 411
            LL             P+V+ I   GI+ LPHI NAC+L   +S   S LY ASR L+ +
Sbjct: 334 RLLNAIAAGESNAAASPFVIGIQEVGIRVLPHIINACILTSAYSCGTSVLYGASRVLHSM 393

Query: 412 AIDNKAPKIFAVTNRWGVPYYSLLMSSCFCLLAYMSVSSGSAKIFNYFVNVVSIFGLLSW 471
           A++   PKIFA TNR+G PYYS   +S FCLLAY++ S  S+ +F +  N+ +I G + W
Sbjct: 394 AVNGAVPKIFATTNRFGTPYYSTAAASVFCLLAYLNCSDSSSVVFTWLSNIATISGFVDW 453

Query: 472 ISILITYLCFFRAVKAQNVDRSRFAYRAPFQPYGSYFTLAFCILIAFIKNFTVFLNHHFD 531
           + + + YL F + ++  N+   +  +R  F    +Y +  F  +++    + VF+  +++
Sbjct: 454 MLVCVVYLRFRKVIEHANLT-DKMPFRKRFMKPLAYLSCGFFAILSLTNGYAVFVADNWN 512

Query: 532 YKNFITGYIGIPVFVISYFGYKFVKKT-KIWKPEEVDLYTF-KAAIDEEEEQGKI 584
             +F   Y  + +  + Y G     KT K+   +EV      K A+ +EEE+G++
Sbjct: 513 VSDFFACYTTLGLAAVLYIGAAIYYKTIKLRDLDEVAAEIIPKIAMADEEEKGEV 567

>KLTH0A00308g Chr1 (23428..25053) [1626 bp, 541 aa] {ON} weakly
           similar to uniprot|P53388 Saccharomyces cerevisiae
           YPL265W Dicarboxylic amino acid permease, mediates
           high-affinity and high-capacity transport of L-
           glutamate and L-aspartate
          Length = 541

 Score =  279 bits (713), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 180/501 (35%), Positives = 266/501 (53%), Gaps = 12/501 (2%)

Query: 81  DEHTRLRKDLKARHISMIAXXXXXXXXXXXXXXXXXYTAGPMSMFIAYAFVGVLVFFTMA 140
           ++ TRL++ LK RHI M+                    AGP  MF+AY  VG++V     
Sbjct: 45  NDRTRLKQGLKERHIKMLTLVGVFGTGLFLSSGGTLKKAGPAGMFLAYVVVGIVVGCNQI 104

Query: 141 ALGEMASYIPLDGFT-SYASRYCDPALGFAVGYAYLCKYLILPPNQLTAAALVIQYWLDR 199
           A+ E+AS++P  G T  +A ++ D ++GF  G+  +  Y  L P +L+A A+V++YW D 
Sbjct: 105 AIAEVASFMPATGATIRHAEQFIDESVGFTFGW--ISTYSSLMPGELSATAVVMRYWTD- 161

Query: 200 EQVNPGVWITIFLVIIVAMNFIGVKFFGEFEFWLSTFKVIVMIGLIILLFVIMLGGGPTH 259
             +NP VWITIF ++ V  N   ++F+GE E++    K+I++I LI+   VI LGG    
Sbjct: 162 --INPAVWITIFGILFVLTNIYTIRFYGEVEYFFGWMKIILIIILIVTGLVIDLGGA-KQ 218

Query: 260 DRLGFRFYDHPGAFKPYSKSIDGSKGKXXXXXXXXXXXXXXXXGIELTGIVAAEAANPRK 319
           +RLGF ++  PG F  Y   + G  GK                GI+   I+A E  N R 
Sbjct: 219 ERLGFHYWREPGPFAEYI--VKGEIGKFVGFWAALSSVVYSYSGIQNIAILAGETKNSRH 276

Query: 320 SIPKAIKLTMYRIIVFYLVTIFLLGMCVAYDDPLLXXXXXXXXXXXXXPYVVAIINSGIK 379
           +I    +    RIIV YL+ + +L + V Y+D L+             PYV+AI  + IK
Sbjct: 277 AIFHGARNVFLRIIVLYLIAVLVLTLIVPYNDKLIATGTGTAKSS---PYVIAIQRANIK 333

Query: 380 ALPHIFNACVLMFVFSACNSDLYVASRTLYGLAIDNKAPKIFAVTNRWGVPYYSLLMSSC 439
            LPHI NA +L   +SA N  +   SR L+ LA  N+APKIF  TN+ G+PY  +   S 
Sbjct: 334 ILPHIINAIILTSAWSAGNLAIVEGSRNLFALASKNQAPKIFLTTNKRGIPYVGIAFISA 393

Query: 440 FCLLAYMSVSSGSAKIFNYFVNVVSIFGLLSWISILITYLCFFRAVKAQNVDRSRFAYRA 499
           F  L+YMSVSS SA +F++F  +VS   LL WI I   ++   RA+KAQ   RS   +  
Sbjct: 394 FLPLSYMSVSSSSANVFSWFQELVSSNTLLRWILISANHIHMDRALKAQGYSRSDLPHST 453

Query: 500 PFQPYGSYFTLAFCILIAFIKNFTVFLNHHFDYKNFITGYIGIPVFVISYFGYKFVKKTK 559
              P+ ++F+    ++      F  F++ HFD ++F T Y  IP+ +I +  +K  KKTK
Sbjct: 454 CLGPFAAWFSGIMSLIFLLTGGFYNFIHGHFDIESFFTRYFIIPLAIILFTFWKLFKKTK 513

Query: 560 IWKPEEVDLYTFKAAIDEEEE 580
             +P EVDL +    I +  E
Sbjct: 514 YLRPAEVDLESIFEDIRQNPE 534

>KAFR0C05160 Chr3 (1025799..1027553) [1755 bp, 584 aa] {ON} Anc_7.44
           YOR348C
          Length = 584

 Score =  279 bits (713), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 173/559 (30%), Positives = 290/559 (51%), Gaps = 28/559 (5%)

Query: 52  DINDMDNLST-VSSRLEDSEKQDDYMDDGKDEHTR-LRKDLKARHISMIAXXXXXXXXXX 109
           D ND +N+   VS        + D     K+  +R L+  L++RHI +IA          
Sbjct: 20  DKNDKNNIKDGVSFEKPIIYSEVDIESGAKESSSRNLKHGLQSRHIQLIALGGTIGTGLF 79

Query: 110 XXXXXXXYTAGPMSMFIAYAFVGVLVFFTMAALGEMASYIPLD-------GFTSY-ASRY 161
                     GP ++ I+Y  +  +V+  M   GEM  Y+P +       G+ +Y  S+Y
Sbjct: 80  VGTSSTLANCGPAALVISYIVISTIVYPIMNMFGEMVCYLPGNDDDDESVGYCAYLVSKY 139

Query: 162 CDPALGFAVGYAYLCKYLILPPNQLTAAALVIQYWLDREQVNPGVWITIFLVIIVAMNFI 221
            D +LGFA  + Y   +++L   + TAA+ +++YW  +  +   V I +FL +I  +NF+
Sbjct: 140 VDESLGFATSWNYYYCFIVLVATECTAASSIVEYWTSK--IPKAVLIFLFLGVIFLLNFL 197

Query: 222 GVKFFGEFEFWLSTFKVIVMIGLIILLFVIMLGGGPTHDR---LGFRFYDHPGAFKPYSK 278
            VKF+GE EFW +  K+  + GLII+ FVI  GG P ++    +GF ++ +P +F+ Y  
Sbjct: 198 PVKFYGEAEFWFAIIKIFCITGLIIVAFVIFCGGAPNNEDNSFVGFHYWKNPSSFRDYVT 257

Query: 279 SIDGSKGKXXXXXXXXXXXXXX-XXGIELTGIVAAEAANPRKSIPKAIKLTMYRIIVFYL 337
             +GS G                  G EL  + ++E  + R++I KA +  +YR++ FY+
Sbjct: 258 --NGSLGNFLDVYNALIKGAFAFILGPELVSLTSSECVDQRRNIAKASRRFVYRLMFFYI 315

Query: 338 VTIFLLGMCVAYDDP-LLXXXXXXXXXXXXXPYVVAIINSGIKALPHIFNACVLMFVFSA 396
                + + V Y+DP LL             P+V+ I N+GI  LPHI N C+L    SA
Sbjct: 316 FGALSISVIVPYNDPTLLNALALNKPGAGSSPFVIGIQNAGITILPHIINFCILTSAMSA 375

Query: 397 CNSDLYVASRTLYGLAIDNKAPKIFAVTNRWGVPYYSLLMSSCFCLLAYMSVSSGSAKIF 456
            N+ L+ ++R L  +  +  AP+IF+  NR GVPY +L +S     LA+++ S+ SAK+F
Sbjct: 376 GNAFLFASTRALLTMGKNGSAPRIFSRINRHGVPYVALSLSIMIACLAFLNCSASSAKVF 435

Query: 457 NYFVNVVSIFGLLSWISILITYLCFFRAVKAQNVDRSRFAYRAPFQPYGSYFTLAFCILI 516
            +F N+ +I G + W +  I YL F R +    +   R  ++   Q Y ++++  F  ++
Sbjct: 436 QWFSNISTISGFIGWFTGCIAYLRFRRTIDYNGL-YDRLPFKTKGQVYLTWYSFVFVGIL 494

Query: 517 AFIKNFTVFLNHHFDYKNFITGYIGIPVFVISYFGYKFV----KKTKIWKP-EEVDLYTF 571
                +   +   ++Y++FI  YI +PVF++ YFG+       ++ K WKP +E+D+ T 
Sbjct: 495 ILTNGYMYIIPKFWNYQDFIAAYITLPVFLVLYFGHIIYSGRWRQRKWWKPVDEIDVVT- 553

Query: 572 KAAIDEEEEQGKIADAERR 590
              ++E E + KIAD ER+
Sbjct: 554 --GLEEIELKTKIADEERQ 570

>SAKL0C01232g Chr3 (110269..112110) [1842 bp, 613 aa] {ON} similar
           to uniprot|P48813 Saccharomyces cerevisiae YDR508C GNP1
           High-affinity glutamine permease also transports Leu Ser
           Thr Cys Met and Asn expression is fully dependent on
           Grr1p and modulated by the Ssy1p-Ptr3p-Ssy5p (SPS)
           sensor of extracellular amino acids
          Length = 613

 Score =  278 bits (710), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 168/542 (30%), Positives = 275/542 (50%), Gaps = 21/542 (3%)

Query: 67  EDSEKQDDYMDDGKDEHTRLRKDLKARHISMIAXXXXXXXXXXXXXXXXXYTAGPMSMFI 126
            ++  ++D  D G     +L+K +K+RH+ MI+                    GP  + I
Sbjct: 77  SNNPDKEDGSDAGDKGDNKLKKTIKSRHVVMISLGTGIGTGMLVGNGKALRNGGPAGLVI 136

Query: 127 AYAFVGVLVFFTMAALGEMA-SYIPLDG-FTSYASRYCDPALGFAVGYAYLCKYLILPPN 184
            YA +G  ++  + A GE+A  Y  L G F +Y S   DPALGF+V + Y  ++L + P 
Sbjct: 137 GYAIMGSCLYCIIQAAGELAVCYTSLSGGFNAYPSLLIDPALGFSVAWVYCLQWLCVMPL 196

Query: 185 QLTAAALVIQYWLDREQVNPGVWITIFLVIIVAMNFIGVKFFGEFEFWLSTFKVIVMIGL 244
           +L  A++ I+YW     VNP +++ IF V+I+ +N  G + + E EF+ +TFKV+++ G 
Sbjct: 197 ELVTASITIKYW--TTSVNPDIFVAIFYVVIITINVFGARGYAEAEFFFNTFKVLMISGF 254

Query: 245 IILLFVIMLGGGPTHDRLGFRFYDHPGAFKPYSKSIDGSKGKXXXXXXXXXXXXXXXXGI 304
           +IL  ++  GG      +G ++++ PG+F    K ID  KG                   
Sbjct: 255 LILGIIVNCGGAGNDGYIGGKYWNDPGSFSG-DKPIDHFKG----VVSTLVTAAFAFGAT 309

Query: 305 ELTGIVAAEAANPRKSIPKAIKLTMYRIIVFYLVTIFLLGMCVAYDDPLLXXXXXXXXXX 364
           E   + AAE ANPRKSIP A K  +YRI+V Y+ +I L+G  V ++   L          
Sbjct: 310 EFIALTAAEQANPRKSIPSAAKKILYRILVLYVGSIILIGFLVPHNSEELMGSGGSATHA 369

Query: 365 XXXPYVVAIINSGIKALPHIFNACVLMFVFSACNSDLYVASRTLYGLAIDNKAPKIFAVT 424
              PYV+AI + G+K +PH+ NA +L+ V S  NS  Y +SR L  LA    AP      
Sbjct: 370 S--PYVIAIASHGVKVVPHLINAVILLSVISMGNSAFYSSSRLLLTLAEQGYAPSFLKYV 427

Query: 425 NRWGVPYYSLLMSSCFCLLAYMSVSSGSAKIFNYFVNVVSIFGLLSWISILITYLCFFRA 484
           +R G P  ++++SS F L+++++ S     +F + + +  +  L +W +I ++++ F RA
Sbjct: 428 DREGRPTLAMVISSVFGLISFVAASPKEETVFTWLLAISGLSQLFTWSAICLSHIRFRRA 487

Query: 485 VKAQNVDRSRFAYRAPFQPYGSYFTLAFCILIAFIKNFTVFL---NHHFDYKNFITGYIG 541
           +K Q        +++    +GSY+     +LI   + +T          D + F   Y+ 
Sbjct: 488 MKVQGRSLGELGFKSQVGVWGSYYATGMMLLILIGQFWTAIAPIGEGKLDAEAFFENYLA 547

Query: 542 IPVFVISYFGYKFVKK--TKIWKPEEVDLYTFKAAIDEEEEQGKIADAERRERLKNSKTK 599
           +P+ +  YFGYK  K+  T      ++DL + +   DE+    K  DAE RE+L+NS   
Sbjct: 548 MPILIALYFGYKVWKRDWTLYIPASKIDLISNRRIFDEDVL--KQEDAEYREKLRNS--- 602

Query: 600 GW 601
           GW
Sbjct: 603 GW 604

>Ecym_6021 Chr6 (37898..39700) [1803 bp, 600 aa] {ON} similar to
           Ashbya gossypii AFR230C
          Length = 600

 Score =  275 bits (702), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 166/524 (31%), Positives = 272/524 (51%), Gaps = 24/524 (4%)

Query: 68  DSEKQDDYMDDGKD-----EHTRLRKDLKARHISMIAXXXXXXXXXXXXXXXXXYTAGPM 122
           DS   D  + D +        + L++ LK RH+ MIA                  TAGP 
Sbjct: 61  DSVDLDPNLTDAQKIAILTSQSPLQRKLKNRHLQMIAIGGAIGTGLFIGSSKALRTAGPA 120

Query: 123 SMFIAYAFVGVLVFFTMAALGEMASYIPLDG-FTSYASRYCDPALGFAVGYAYLCKYLIL 181
            + I +  +  ++     +LGEMA   P+ G +T+YA+R+ D + GFA    Y+ + L++
Sbjct: 121 GILIGWGLMATMILCMCLSLGEMAVTFPVSGGYTTYATRFIDESYGFANNINYMMQALVV 180

Query: 182 PPNQLTAAALVIQYWLDREQVNPGVWITIFLVIIVAMNFIGVKFFGEFEFWLSTFKVIVM 241
            P ++ AA++ + YW  + Q     ++ +F + IV++N  GVK +GE EF  S  KV+ +
Sbjct: 181 LPLEIVAASITVDYWGPKSQYR-AAFVALFWLCIVSINMFGVKGYGEAEFVFSLIKVVTV 239

Query: 242 IGLIILLFVIMLGGGPTHDRLGFRFYDHPGAFKPYSKSIDGSKGKXXXXXXXXXXXXXXX 301
           IG IIL  +++ GGGPTH+ +G +F+ +PGAF       D +  K               
Sbjct: 240 IGFIILGVILVCGGGPTHEYIGSKFWSNPGAFVG-----DTAGQKFKGICSVFVTAAFSF 294

Query: 302 XGIELTGIVAAEAANPRKSIPKAIKLTMYRIIVFYLVTIFLLGMCVAYDDPLLXXXXXXX 361
              EL G+ AAE  +PRKS+PKA K   +RI +FY++++ ++G+ V Y DP L       
Sbjct: 295 ANTELVGLAAAETEDPRKSVPKAAKQVFWRITLFYILSLLMVGLLVPYTDPRLLGSSIVD 354

Query: 362 XXXXXXPYVVAIINSGIKALPHIFNACVLMFVFSACNSDLYVASRTLYGLAIDNKAPKIF 421
                 P+V+A+ N GIK LP + N  +L  V S  NS ++  SR L  L+     P +F
Sbjct: 355 AAAS--PFVLALKNHGIKGLPSVINVVILTAVLSVGNSSVFSCSRCLTALSEQGFLPNVF 412

Query: 422 AVTNRWGVPYYSLLMSSCFCLLAYMSVSSGSAKIFNYFVNVVSIFGLLSWISILITYLCF 481
              +R G P  S++ SS F LL +++VS    +IF++ +++  +  L  W++I + ++ F
Sbjct: 413 GYIDRKGRPLVSIIFSSAFGLLCFLAVSHQVQEIFDWMLSLSGLSSLFIWLTISLCHIRF 472

Query: 482 FRAVKAQNVDRSRFAYRAPFQPYGSYFTLAFCILIAFIKNFTVFL---NHHFDYKNFITG 538
            +A+ AQN      A+ +P   +GSY+++ F I++  I  F + L   +      NF   
Sbjct: 473 RKALSAQNRSIDELAFASPIGIWGSYYSV-FLIIVVLILQFWIALFPGHQKPSASNFFKA 531

Query: 539 YIGIPVFVISYFGYKFVKKTKIWK----PEEVDLYTFKAAIDEE 578
           Y+ +P+ V  Y G+K    TK WK    P+ +D+ T +  +D E
Sbjct: 532 YLSMPIAVAMYLGHKIY--TKNWKLLIDPKYMDIDTGRRELDIE 573

>KNAG0C02140 Chr3 complement(416347..418143) [1797 bp, 598 aa] {ON} 
          Length = 598

 Score =  273 bits (697), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 175/532 (32%), Positives = 277/532 (52%), Gaps = 22/532 (4%)

Query: 80  KDEHTRLRKDLKARHISMIAXXXXXXXXXXXXXXXXXYTAGPMSMFIAYAFVGVLVFFTM 139
           +  ++ L+  LK RH+ MIA                  TAGP  + I +   G +++  +
Sbjct: 75  RTANSPLQHHLKNRHLQMIAIGGAIGTGLFVGSGTALRTAGPAGILIGWGLTGTMIYSMV 134

Query: 140 AALGEMASYIPLDG-FTSYASRYCDPALGFAVGYAYLCKYLILPPNQLTAAALVIQYWLD 198
            ALGE+A   P+ G FT+YA+R+ D + GFA    Y+ ++L++ P ++ AA++ + YW  
Sbjct: 135 MALGELAVLFPVSGGFTTYATRFIDESYGFANNINYMLQWLVVLPLEIVAASITVNYWGT 194

Query: 199 REQVNPGVWITIFLVIIVAMNFIGVKFFGEFEFWLSTFKVIVMIGLIILLFVIMLGGGPT 258
             +   G ++ +F + I  +N  GVK +GE EF  S  KVI ++G IIL  ++  GGGP 
Sbjct: 195 NPRYRDG-FVALFWLAIFIINLFGVKGYGEAEFIFSIIKVITVVGFIILGIILNCGGGPV 253

Query: 259 HDRLGFRFYDHP-GAFKPYSKSIDGSKGKXXXXXXXXXXXXXXXXGIELTGIVAAEAANP 317
              +G R++ HP GAF       D +  +                G EL G+ +AE ANP
Sbjct: 254 KGYIGGRYWHHPYGAFVG-----DSAGARFKGVCSVFVTAAFSFAGSELVGLASAETANP 308

Query: 318 RKSIPKAIKLTMYRIIVFYLVTIFLLGMCVAYDDPLLXXXXXXXXXXXXXPYVVAIINSG 377
           RKS+PKA K   +RI +FYL+ + ++G+ V Y +  L             P+V+AI   G
Sbjct: 309 RKSVPKAAKQVFWRITLFYLLALGMVGLLVPYTEKRLIGASSVDAAAS--PFVIAITTHG 366

Query: 378 IKALPHIFNACVLMFVFSACNSDLYVASRTLYGLAIDNKAPKIFAVTNRWGVPYYSLLMS 437
           I+ LP + N  +L+ V S  NS +Y  SRTL  LA  N  PK F   +R G P YS+L++
Sbjct: 367 IRGLPSVVNVVILIAVLSVGNSAIYACSRTLCALAEQNFLPKFFGYIDRSGRPLYSILVT 426

Query: 438 SCFCLLAYMSVSSGSAKIFNYFVNVVSIFGLLSWISILITYLCFFRAVKAQNVDRSRFAY 497
           S F L+A+++ S    ++FN+ + +  +  L +W  I + ++ F +A+ AQ       ++
Sbjct: 427 SGFGLVAFVAQSKKEGEVFNWLLALSGLSSLFTWGGICLCHIRFRKALSAQGRGTDELSF 486

Query: 498 RAPFQPYGSYFTLAFCILIAFIKNFTVFL---NHHFDYKNFITGYIGIPVFVISYFGYKF 554
            +P   YGSY+ L F I++ FI  F V L       + K F   Y+  P+ +  Y G+K 
Sbjct: 487 VSPAGVYGSYWGL-FMIILMFIAQFYVALFPPGAKPNAKAFFEAYLSFPIVIACYLGHKI 545

Query: 555 VKKT-KIW-KPEEVDLYTFKAAIDEEEEQGKIADAERRERLKNSKTKGWDWF 604
            KK  KI+ K E++D+ T +   D++ +  +   AE R  L    TK W W+
Sbjct: 546 YKKNWKIFIKAEDMDIDTGRK--DDDLDLLRQEVAEERAVL---ATKPW-WY 591

>KNAG0F00270 Chr6 complement(27784..29688) [1905 bp, 634 aa] {ON}
           Anc_1.50 YDR508C
          Length = 634

 Score =  273 bits (698), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 165/553 (29%), Positives = 285/553 (51%), Gaps = 23/553 (4%)

Query: 65  RLEDSEKQDDY---MDDGKDEHTRLRKDLKARHISMIAXXXXXXXXXXXXXXXXXYTAGP 121
           R+++ +   D    + +   E++ L++ +K RH+ +I+                   AGP
Sbjct: 93  RVDEKQTTSDLESGLGEVPGENSDLKQTIKKRHVLLISLGTGIGTGLLVGNAKVLRDAGP 152

Query: 122 MSMFIAYAFVGVLVFFTMAALGEMA---SYIPLDGFTSYASRYCDPALGFAVGYAYLCKY 178
             + I Y+ +G  ++  + A GE+A   S +P   F  Y +   D A GFAV + Y  ++
Sbjct: 153 GGLVIGYSIMGSCLYCIIQACGELAVCYSSLP-SNFNIYPTFLVDKAFGFAVAWVYCLQW 211

Query: 179 LILPPNQLTAAALVIQYWLDREQVNPGVWITIFLVIIVAMNFIGVKFFGEFEFWLSTFKV 238
           L + P +L  A++ I+YW     VNP ++++IF V+I+ +N  G + + E EF+ ++ KV
Sbjct: 212 LCVCPLELVTASMTIKYWTT--SVNPDIFVSIFFVLIIVINTFGARGYAEAEFFFNSCKV 269

Query: 239 IVMIGLIILLFVIMLGGGPTHDRLGFRFYDHPGAFKPYSKSIDGSKGKXXXXXXXXXXXX 298
           ++M G  IL  +I  GG  T   +G +++  PGAF   ++ ID  KG             
Sbjct: 270 LMMAGFFILGIIITCGGAGTSGYIGAKYWHSPGAFNG-NRPIDHFKG----VMATFTTAA 324

Query: 299 XXXXGIELTGIVAAEAANPRKSIPKAIKLTMYRIIVFYLVTIFLLGMCVAYDDPLLXXXX 358
                 E   + AAE +NPRK+IPKA K+ +YRI+  +L +I L+G  V Y+ P L    
Sbjct: 325 FAFGASEFISLTAAEQSNPRKAIPKAAKMMIYRILFVFLSSITLIGFLVPYNSPYLLGSG 384

Query: 359 XXXXXXXXXPYVVAIINSGIKALPHIFNACVLMFVFSACNSDLYVASRTLYGLAIDNKAP 418
                    PYVVA+ + G++ +PH  NA +L+ V S  NS  Y +SR L  LA    AP
Sbjct: 385 SDATKAS--PYVVAVASHGVRVVPHFINAVILLSVLSVGNSAFYSSSRLLNSLAQQGYAP 442

Query: 419 KIFAVTNRWGVPYYSLLMSSCFCLLAYMSVSSGSAKIFNYFVNVVSIFGLLSWISILITY 478
           K+F   ++ G P  +++ S+ F  +A+ + S    ++F + + +  +  L +W++I I++
Sbjct: 443 KMFTYIDKRGRPLVAMVCSTLFMTIAFCAASPKEEQVFTWLLAISGLSQLFTWVAICISH 502

Query: 479 LCFFRAVKAQNVDRSRFAYRAPFQPYGSYFTLAFCILIAFIKNFTVFL----NHHFDYKN 534
           L F RA+K Q        +++    YGS +     IL A I  F V L     +  D +N
Sbjct: 503 LRFRRALKVQGHSLGEIGFKSQVGIYGSLYAATMLIL-ALIAQFWVALAPIGGNGLDARN 561

Query: 535 FITGYIGIPVFVISYFGYKFVKKT-KIWKP-EEVDLYTFKAAIDEEEEQGKIADAERRER 592
           F   Y+ +P+ ++ YFGYK  K+  K W P   +DL + +   DE+  + ++A+ E+ ++
Sbjct: 562 FFQNYLAMPILLVLYFGYKIRKRDWKFWIPAHRIDLVSHRKVFDEDILKQEVAEIEQEKK 621

Query: 593 LKNSKTKGWDWFY 605
             ++  K  ++F+
Sbjct: 622 NLSTGRKIQEFFF 634

>CAGL0K05753g Chr11 (565111..567093) [1983 bp, 660 aa] {ON} highly
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508c GNP1
          Length = 660

 Score =  273 bits (699), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 172/556 (30%), Positives = 275/556 (49%), Gaps = 30/556 (5%)

Query: 54  NDMDNLSTVSS--RLEDSEKQDDYMDDGKDEHTRLRKDLKARHISMIAXXXXXXXXXXXX 111
           ND+    +++S  R+++    +  M   K E   L+K +K RH+ MI+            
Sbjct: 111 NDLTTAISMNSLDRVQNKPTGNGQM---KFEEEALKKSIKPRHVVMISLGTGIGTGLLVG 167

Query: 112 XXXXXYTAGPMSMFIAYAFVGVLVFFTMAALGEMASYIP--LDGFTSYASRYCDPALGFA 169
                + AGP  + I YA +G  ++  + A GEMA      L GF +Y S   DP  GFA
Sbjct: 168 NAKALHNAGPAGLVIGYAIMGSCIYCIIQAAGEMAVVYSNLLGGFNTYPSMLVDPGFGFA 227

Query: 170 VGYAYLCKYLILPPNQLTAAALVIQYWLDREQVNPGVWITIFLVIIVAMNFIGVKFFGEF 229
           V + Y  ++L + P +L   +L I+YW     VNP  ++ IF V+I+ +   G + + E 
Sbjct: 228 VAWVYCLQWLCVCPLELVTTSLTIKYWT--TTVNPDAFVVIFYVVIIFIQIFGARGYAEA 285

Query: 230 EFWLSTFKVIVMIGLIILLFVIMLGGGPTHDRLGFRFYDHPGAFKPYSKSIDGSKGKXXX 289
           EF+ +  K++++IG  IL  +I  GG      LG +++  PGAF+  +  I   KG    
Sbjct: 286 EFFFNCCKILMIIGFYILGIIINAGGAGNDGYLGAKYWHDPGAFRG-TNGIQRFKG---- 340

Query: 290 XXXXXXXXXXXXXGIELTGIVAAEAANPRKSIPKAIKLTMYRIIVFYLVTIFLLGMCVAY 349
                          E   + AAE +NPRK+IP A K  +YR+I  ++ TI LLG  V +
Sbjct: 341 IMATFVSAAFAFGATEFIALTAAEQSNPRKAIPSAAKKVLYRVICIFVGTIALLGFLVPW 400

Query: 350 DDPLLXXXXXXXXXXXXXPYVVAIINSGIKALPHIFNACVLMFVFSACNSDLYVASRTLY 409
           D   L             PYV+AI   G++ +PH  NA +L+ VFS  NS  Y +SR L 
Sbjct: 401 DSDQLMGAGGSATKAS--PYVLAISIHGVRVVPHFINAVILISVFSVANSAFYSSSRLLL 458

Query: 410 GLAIDNKAPKIFAVTNRWGVPYYSLLMSSCFCLLAYMSVSSGSAKIFNYFVNVVSIFGLL 469
           GLA    APK F   +R G P+ ++  ++ F ++A+ + S    ++F + + +  +  L 
Sbjct: 459 GLAQQGYAPKFFDYVDRQGRPFRAMCCAALFGVIAFCAASPKEDQVFTWLLAISGLSQLF 518

Query: 470 SWISILITYLCFFRAVKAQNVDRSRFAYRAPFQPYGSYFTLAFCILIAFIKNFTVFL--- 526
           +WI+I ++++ F RA+  Q        ++A    YGSY+     +L A I  F V +   
Sbjct: 519 TWIAICVSHIRFRRAMTVQGRSLGEIGFKAQLGVYGSYYATIMMVL-ALIAQFWVAIAPI 577

Query: 527 --NHHFDYKNFITGYIGIPVFVISYFGYKFVKKTKIW----KPEEVDLYTFKAAIDEEEE 580
             N   D + F   Y+ +P+ +  YFGYK  K+   W    + +++DL +++   DEE  
Sbjct: 578 GNNGDLDAEGFFENYLAMPILIAFYFGYKLWKRD--WRLFIRAKDIDLDSYRQVFDEELL 635

Query: 581 QGKIADAERRERLKNS 596
             K  D E +E+LKN 
Sbjct: 636 --KQEDEEYKEKLKNG 649

>Skud_16.2 Chr16 complement(1584..3074) [1491 bp, 496 aa] {ON}
           YPL265W (REAL)
          Length = 496

 Score =  267 bits (683), Expect = 8e-82,   Method: Compositional matrix adjust.
 Identities = 164/485 (33%), Positives = 253/485 (52%), Gaps = 20/485 (4%)

Query: 62  VSSRLEDSEKQDDYMDDGKD---------EHTRLRKDLKARHISMIAXXXXXXXXXXXXX 112
           V S++ ++   +  ++ G +         + TRL++ LK RHI M+              
Sbjct: 15  VKSKICETNVDEQELECGSETAKQGVLYNDRTRLKQGLKERHIKMLTLVGVFGTGLFLSS 74

Query: 113 XXXXYTAGPMSMFIAYAFVGVLVFFTMAALGEMASYIPLDGFT-SYASRYCDPALGFAVG 171
                  GP+ + IAY FVG++V     A+ E+AS++P  G T  +A ++ D ++GF  G
Sbjct: 75  GGTLKKIGPVGLLIAYLFVGIVVGCNQIAIAEVASFMPATGATIRHAEQFIDESVGFTFG 134

Query: 172 YAYLCKYLILPPNQLTAAALVIQYWLDREQVNPGVWITIFLVIIVAMNFIGVKFFGEFEF 231
           +  +  Y  L P +L+A A++++YW D   V+P V+IT+F V+ VA N   ++F+GE E+
Sbjct: 135 W--ISTYSSLMPGELSATAVIMKYWTD---VSPAVFITVFGVLFVATNIYTIRFYGEIEY 189

Query: 232 WLSTFKVIVMIGLIILLFVIMLGGGPTHDRLGFRFYDHPGAFKPYSKSIDGSKGKXXXXX 291
                K++++  LII   VI LGG    +RLGF ++  PG F  Y   + G  GK     
Sbjct: 190 VFGWLKLVLIFILIISGLVIDLGGVKGQERLGFHYWRDPGPFANYL--VAGHIGKFVGFW 247

Query: 292 XXXXXXXXXXXGIELTGIVAAEAANPRKSIPKAIKLTMYRIIVFYLVTIFLLGMCVAYDD 351
                      GI+   I+A E  N R +I    K    RIIV YLVT+F+L + V Y+D
Sbjct: 248 AAISSVVYSYSGIQNIAILAGETKNSRYAIFHGAKNVFLRIIVLYLVTVFVLTLIVPYND 307

Query: 352 PLLXXXXXXXXXXXXXPYVVAIINSGIKALPHIFNACVLMFVFSACNSDLYVASRTLYGL 411
            L+             P+V+A+  +GIK LPHI NA +L   +SA N  +   SR L+ L
Sbjct: 308 KLIATGTGTAKSS---PFVIAMNRAGIKVLPHIVNALILTSAWSAGNLAIIEGSRNLFCL 364

Query: 412 AIDNKAPKIFAVTNRWGVPYYSLLMSSCFCLLAYMSVSSGSAKIFNYFVNVVSIFGLLSW 471
           A  N+AP+IF  T++ G+PY  ++  S F  LAYMS S  SA +F +F  +VS   LL W
Sbjct: 365 ATKNQAPQIFLKTSKRGIPYVGVIFISSFLPLAYMSCSESSATVFGWFQELVSSNTLLRW 424

Query: 472 ISILITYLCFFRAVKAQNVDRSRFAYRAPFQPYGSYFTLAFCILIAFIKNFTVFLNHHFD 531
           I I   ++   RA+KAQ   RS         P+ ++F+    ++  F   F  F++ HFD
Sbjct: 425 ILISANHIHMDRALKAQGYSRSDLPCSTRIAPFAAWFSGIMSVIFLFTGGFYNFMHGHFD 484

Query: 532 YKNFI 536
            ++F+
Sbjct: 485 IESFL 489

>Kwal_23.2817 s23 complement(26637..28379) [1743 bp, 580 aa] {ON}
           YOR348C (PUT4) - putative proline-specific permease
           [contig 246] FULL
          Length = 580

 Score =  269 bits (687), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 166/523 (31%), Positives = 268/523 (51%), Gaps = 12/523 (2%)

Query: 67  EDSEKQDDYMDDGKDEHTRLRKDLKARHISMIAXXXXXXXXXXXXXXXXXYTAGPMSMFI 126
           +D E+      D     T + + LK+RH+  IA                  + GP  + I
Sbjct: 45  QDIERGSLSDIDTIKPSTEVSRGLKSRHVQFIALGGAIGTGLFIGSGTALSSCGPAPLLI 104

Query: 127 AYAFVGVLVFFTMAALGEMASYIPLDGFTSYAS---RYCDPALGFAVGYAYLCKYLILPP 183
           +Y+ +   V+  M  + EM   IPL G +S AS    Y +    F  G+       ++ P
Sbjct: 105 SYSVMSFFVWAIMNQMTEMVVLIPLSGESSMASLAGTYLNRPSSFMCGWNCFYAMSMVVP 164

Query: 184 NQLTAAALVIQYWLDREQVNPGVWITIFLVIIVAMNFIGVKFFGEFEFWLSTFKVIVMIG 243
            ++TA AL+I+YW D    N  +++TIF+++   ++ + VK FGE EF +S  K++ ++G
Sbjct: 165 TEITACALLIEYWTD---ANAAIFVTIFMILATLLSLLPVKIFGESEFCVSIIKILTILG 221

Query: 244 LIILLFVIMLGGGPT-HDRLGFRFYDHPGAFKPYSKSIDGSKGKXXXXXXXXXXXXXXXX 302
           LI++  VI  GGGP  H  LGF +++ PGAF  Y   + GS G                 
Sbjct: 222 LILVGVVIFFGGGPAQHKVLGFHYWNTPGAFNSYL--VKGSTGAFLAVWKAIIKSGFAFV 279

Query: 303 GI-ELTGIVAAEAANPRKSIPKAIKLTMYRIIVFYLVTIFLLGMCVAYDDPLLXXXXXX- 360
            I E+T   +AEAA PRK++P+A +  +YR+ VFY++   ++G+ V YD+  L       
Sbjct: 280 MIPEITSSCSAEAAFPRKNMPRACQRFVYRLAVFYVLGCLVIGVIVGYDNKTLNEAISSG 339

Query: 361 XXXXXXXPYVVAIINSGIKALPHIFNACVLMFVFSACNSDLYVASRTLYGLAIDNKAPKI 420
                  P+V+ I  +GI+ LPHI NAC+L   +S   S+LY ASR L+ LA+   APK 
Sbjct: 340 KANAAASPFVIGIQEAGIRILPHIINACILTSAYSCSTSELYGASRVLHSLALRGDAPKF 399

Query: 421 FAVTNRWGVPYYSLLMSSCFCLLAYMSVSSGSAKIFNYFVNVVSIFGLLSWISILITYLC 480
           F+  N++GVPYYS+  +S F +LAY++ S  S  +FN+  N+ +I G ++W+ + ITYL 
Sbjct: 400 FSKVNKYGVPYYSVAATSLFGVLAYLNCSKSSLVVFNWLSNIATISGFVNWVFVSITYLR 459

Query: 481 FFRAVKAQNVDRSRFAYRAPFQPYGSYFTLAFCILIAFIKNFTVFLNHHFDYKNFITGYI 540
           F +      ++  R  YR   Q   +Y +  F  L+A    F VF+  +++  +F T Y+
Sbjct: 460 FRKITDYLKIN-DRVPYRRRGQRALAYASAIFFALLAITNGFYVFIAGNWNVSDFFTCYV 518

Query: 541 GIPVFVISYFGYKFVKKTKIWKPEEVDLYTFKAAIDEEEEQGK 583
            I    + + G     K   ++  +V        ID+ +++ K
Sbjct: 519 TIGFVGVLFIGSSIYYKEWTFRDMDVVGREIMPKIDQADQEEK 561

>TBLA0A05180 Chr1 complement(1267962..1269992) [2031 bp, 676 aa]
           {ON} 
          Length = 676

 Score =  270 bits (689), Expect = 8e-81,   Method: Compositional matrix adjust.
 Identities = 180/566 (31%), Positives = 286/566 (50%), Gaps = 33/566 (5%)

Query: 46  DKKDGLDI--NDMDNLSTVSSRLEDSEKQDDYMDDGK---DEHTRLRKDLKARHISMIAX 100
           D+K G DI  +D++N   V   L  +  QD+ +  G+   D +  LR+ +K RH+ M++ 
Sbjct: 116 DQKVGPDIYIDDLENKQQV--ELIGTTIQDEELLPGQKKEDSNAELRQTIKPRHVIMMSL 173

Query: 101 XXXXXXXXXXXXXXXXYTAGPMSMFIAYAFVGVLVFFTMAALGEMA-SYIPLDG-FTSYA 158
                             AGP  + I Y  +G  ++  + A GEMA +Y  L G F ++ 
Sbjct: 174 GTGIGTGLLVGNAKPLAAAGPAPLVIGYGIMGTCIYCIIQACGEMAVAYGNLTGSFNTFP 233

Query: 159 SRYCDPALGFAVGYAYLCKYLILPPNQLTAAALVIQYWLDREQVNPGVWITIFLVIIVAM 218
           S   DP   FAV + Y  ++L + P +L  A++ IQYW  +  V+P V++ IF V+I+ +
Sbjct: 234 SFLVDPGFNFAVAWVYCIQWLCVCPLELVTASMTIQYWTTK--VDPDVFVVIFYVLILLI 291

Query: 219 NFIGVKFFGEFEFWLSTFKVIVMIGLIILLFVIMLGGGPTHDRLGFRFYDHPGAFKPYSK 278
           NF G K + E EF  +T KV+++ G  IL   I  G   T   +G ++++ PGAF+  +K
Sbjct: 292 NFFGAKGYAEAEFIFNTCKVLMICGFFILAICIDTGAAGTDGYIGAKYWNDPGAFRGQTK 351

Query: 279 SIDGSKGKXXXXXXXXXXXXXXXXGIELTGIVAAEAANPRKSIPKAIKLTMYRIIVFYLV 338
            I+  KG                   E   + AAE +NPRK+IP A K  +YR++V +L 
Sbjct: 352 -IERFKG----VMDTFVTAAFAFGATEFIALTAAEQSNPRKAIPSAAKKIIYRVLVIFLN 406

Query: 339 TIFLLGMCVAYD-DPLLXXXXXXXXXXXXXPYVVAIINSGIKALPHIFNACVLMFVFSAC 397
           TI L+G  V YD D LL             PYV+AI   G++   H  NA +L+ V S  
Sbjct: 407 TIILIGFLVPYDSDQLLGSGGSATKAS---PYVLAISLHGVRVAQHFVNAVILISVISVG 463

Query: 398 NSDLYVASRTLYGLAIDNKAPKIFAVTNRWGVPYYSLLMSSCFCLLAYMSVSSGSAKIFN 457
           NS  Y +SR L  LA    APKIF   +R G P  ++  S+   ++A+ + S    ++F 
Sbjct: 464 NSAFYSSSRLLMSLAQQGSAPKIFDYVDREGRPLIAMCCSAVIAVIAFCATSPKETEVFT 523

Query: 458 YFVNVVSIFGLLSWISILITYLCFFRAVKAQNVDRSRFAYRAPFQPYGSYFTLAFCILIA 517
           + + +  +  L +W +I +++L F RA+K Q        Y +     GS +  A  +++A
Sbjct: 524 WLMAIAGLSQLFTWFAICLSHLRFRRAMKVQGRSLGEMGYLSQTGILGSLYA-AIMMILA 582

Query: 518 FIKNFTVFL----NHHFDYKNFITGYIGIPVFVISYFGYKFVKKTKIW----KPEEVDLY 569
            I  F V L     H  D  +F + Y+ +P+ ++ YFGYK  K+   W    + +++DL 
Sbjct: 583 LIAQFWVALVPMGTHTPDANSFFSNYLAMPILIVFYFGYKIWKRD--WRLFIRAKDIDLI 640

Query: 570 TFKAAIDEEEEQGKIADAERRERLKN 595
           + +   DEE  + +  D E RE+L+N
Sbjct: 641 SHRTIYDEELLRQE--DEEYREKLRN 664

>YCL025C Chr3 complement(76018..77919) [1902 bp, 633 aa] {ON}
           AGP1Low-affinity amino acid permease with broad
           substrate range, involved in uptake of asparagine,
           glutamine, and other amino acids; expression is
           regulated by the SPS plasma membrane amino acid sensor
           system (Ssy1p-Ptr3p-Ssy5p)
          Length = 633

 Score =  267 bits (683), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 173/565 (30%), Positives = 280/565 (49%), Gaps = 30/565 (5%)

Query: 46  DKKDGLDINDMDNLSTVSSR----LEDSEKQDDYMDDGKDEHTRLRKDLKARHISMIAXX 101
           D+ +   +ND+ +  + SSR    LE +E  D+   +   +   L+K ++ RH+ MIA  
Sbjct: 72  DEVEATQMNDLTSAISPSSRQAQELEKNESSDNIGANTGHKSDSLKKTIQPRHVLMIALG 131

Query: 102 XXXXXXXXXXXXXXXYTAGPMSMFIAYAFVGVLVFFTMAALGEMA-SYIPL-DGFTSYAS 159
                            AGP  + I YA +G +++  + A GEMA  Y  L  G+ +Y S
Sbjct: 132 TGIGTGLLVGNGTALVHAGPAGLLIGYAIMGSILYCIIQACGEMALVYSNLTGGYNAYPS 191

Query: 160 RYCDPALGFAVGYAYLCKYLILPPNQLTAAALVIQYWLDREQVNPGVWITIFLVIIVAMN 219
              D   GFAV + Y  ++L + P +L  A++ I+YW     VNP V++ IF V+++ +N
Sbjct: 192 FLVDDGFGFAVAWVYCLQWLCVCPLELVTASMTIKYW--TTSVNPDVFVIIFYVLVITIN 249

Query: 220 FIGVKFFGEFEFWLSTFKVIVMIGLIILLFVIMLGGGPTHDRLGFRFYDHPGAFKPYSKS 279
             G + + E EF+ +  K+++M G  IL  +I +GG      +G +++  PGAF     +
Sbjct: 250 IFGARGYAEAEFFFNCCKILMMTGFFILGIIIDVGGAGNDGFIGGKYWHDPGAFNG-KHA 308

Query: 280 IDGSKGKXXXXXXXXXXXXXXXXGIELTGIVAAEAANPRKSIPKAIKLTMYRIIVFYLVT 339
           ID  KG                 G E   I  AE +NPRK+IP A K  +YRI+  +L T
Sbjct: 309 IDRFKG----VAATLVTAAFAFGGSEFIAITTAEQSNPRKAIPGAAKQMIYRILFLFLAT 364

Query: 340 IFLLGMCVAYD-DPLLXXXXXXXXXXXXXPYVVAIINSGIKALPHIFNACVLMFVFSACN 398
           I LLG  V Y+ D LL             PYV+A+ + G++ +PH  NA +L+ V S  N
Sbjct: 365 IILLGFLVPYNSDQLLGSTGGGTKAS---PYVIAVASHGVRVVPHFINAVILLSVLSMAN 421

Query: 399 SDLYVASRTLYGLAIDNKAPKIFAVTNRWGVPYYSLLMSSCFCLLAYMSVSSGSAKIFNY 458
           S  Y ++R    L+    APK+F+  +R G P  ++ +S+ F ++A+ + S    ++F +
Sbjct: 422 SSFYSSARLFLTLSEQGYAPKVFSYIDRAGRPLIAMGVSALFAVIAFCAASPKEEQVFTW 481

Query: 459 FVNVVSIFGLLSWISILITYLCFFRAVKAQNVDRSRFAYRAPFQPYGSYFTLAFCILIAF 518
            + +  +  L +W +I +++L F RA+K Q        +++    +GS +     ILI  
Sbjct: 482 LLAISGLSQLFTWTAICLSHLRFRRAMKVQGRSLGELGFKSQTGVWGSAYACIMMILI-L 540

Query: 519 IKNFTVFL----NHHFDYKNFITGYIGIPVFVISYFGYKFVKKTKIWK----PEEVDLYT 570
           I  F V +        D + F   Y+ +P+ +  Y GYK   K   WK     +++DL +
Sbjct: 541 IAQFWVAIAPIGEGKLDAQAFFENYLAMPILIALYVGYKVWHKD--WKLFIRADKIDLDS 598

Query: 571 FKAAIDEEEEQGKIADAERRERLKN 595
            +   DEE    K  D E RERL+N
Sbjct: 599 HRQIFDEELI--KQEDEEYRERLRN 621

>KAFR0D04120 Chr4 (816117..818063) [1947 bp, 648 aa] {ON} Anc_1.50
           YDR508C
          Length = 648

 Score =  268 bits (684), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 169/566 (29%), Positives = 284/566 (50%), Gaps = 30/566 (5%)

Query: 55  DMDNLSTVSSRLEDSEKQDDYMDDGKDEHTRLRKDLKARHISMIAXXXXXXXXXXXXXXX 114
           D++N  T +     + K   +    +++   L+K +K RH+ +++               
Sbjct: 100 DIENELTTTLSPLSATKDPQFAPHAEEKDDHLQKTIKPRHVLLMSLGTGIGTGLLVGNGS 159

Query: 115 XXYTAGPMSMFIAYAFVGVLVFFTMAALGEMA-SYIPLDG-FTSYASRYCDPALGFAVGY 172
             + AGP  + I YA +G  ++  + A GEMA +Y  L G F +Y S   D A GF+V +
Sbjct: 160 ALHKAGPGGLVIGYAIMGSCLYCIIQACGEMAVAYSGLPGNFNAYPSFLVDEAFGFSVAW 219

Query: 173 AYLCKYLILPPNQLTAAALVIQYWLDREQVNPGVWITIFLVIIVAMNFIGVKFFGEFEFW 232
            Y  ++L + P +L  A++ IQYW     VN  V++ IF V+I+ +N  G K + E EF+
Sbjct: 220 VYCLQWLCVMPLELVTASMTIQYWT--TTVNADVFVVIFYVLIIFINVFGAKGYAEAEFF 277

Query: 233 LSTFKVIVMIGLIILLFVIMLGGGPTHDRLGFRFYDHPGAFKPYSKSIDGSKGKXXXXXX 292
            ++ KV++M G  IL  VI  GG      +G +++ +PGAF+   KSID    +      
Sbjct: 278 FNSCKVLMMAGFFILAIVINTGGAGNDGYIGAKYWHNPGAFRG-DKSID----RFKDVMS 332

Query: 293 XXXXXXXXXXGIELTGIVAAEAANPRKSIPKAIKLTMYRIIVFYLVTIFLLGMCVAYDDP 352
                       E   I A+E +NPR++IP A K  +YRI+  +L +I L+G  V Y+  
Sbjct: 333 TFTTAAFAFGASEFIAIGASEQSNPRRAIPSAAKTMIYRILFIFLTSITLVGFLVPYNST 392

Query: 353 LLXXXXXXXXXXXXXPYVVAIINSGIKALPHIFNACVLMFVFSACNSDLYVASRTLYGLA 412
            L             PYV+A+ + G++ +PH  NA +L+ V S  NS  Y + R LY L+
Sbjct: 393 ELMGSGSAATKAS--PYVIAVASHGVRVVPHFINAVILLSVLSVANSAFYSSCRILYSLS 450

Query: 413 IDNKAPKIFAVTNRWGVPYYSLLMSSCFCLLAYMSVSSGSAKIFNYFVNVVSIFGLLSWI 472
               AP  F   +R G P  +++MS+ F ++A+ + SS    +F + + +  +  L +WI
Sbjct: 451 QQGYAPSWFNYIDREGRPARAMIMSALFSVIAFCACSSKEEDVFTWLLAISGLSQLFTWI 510

Query: 473 SILITYLCFFRAVKAQNVDRSRFAYRAPFQPYGSYFTLAFCILIAFIKNFTVFL----NH 528
           +I ++++ F RA+K Q        +++    +GS +  A  + +A I  F V +      
Sbjct: 511 AICVSHIRFRRAMKVQGRSVDEIGFKSQVGVWGSSYA-AIMMTLALIAEFWVSIAPIGED 569

Query: 529 HFDYKNFITGYIGIPVFVISYFGYKFVKKTKIWK----PEEVDLYTFKAAIDEEEEQGKI 584
           H D +NF   Y+ +P+ ++ YFGYK  K+   WK     +++DL + +   D   E  K 
Sbjct: 570 HLDAQNFFENYLAMPILIVLYFGYKICKRD--WKLFIRAKDIDLVSHRKIYD--GELIKQ 625

Query: 585 ADAERRERLKNSKTKGWDWFYEKVLG 610
            + E +ERL+N        F++KV+ 
Sbjct: 626 EEEEFKERLRNGP------FWKKVVA 645

>TDEL0D00200 Chr4 (32432..34135) [1704 bp, 567 aa] {ON} 
          Length = 567

 Score =  265 bits (677), Expect = 3e-80,   Method: Compositional matrix adjust.
 Identities = 169/540 (31%), Positives = 281/540 (52%), Gaps = 16/540 (2%)

Query: 54  NDM-DNLSTVSSRLEDSEKQDDYMDDGKDEHTRLRKDLKARHISMIAXXXXXXXXXXXXX 112
           N M +N+    + + D E+      + K ++  +R  LK+RHI +IA             
Sbjct: 19  NQMKENMKASVNEVIDEEQGSISELEVKPQNEMVR-GLKSRHIQLIALGDAIGTGLFIGS 77

Query: 113 XXXXYTAGPMSMFIAYAFVGVLVFFTMAALGEMASYIPLDG---FTSYASRYCDPALGFA 169
                T GP  + I+Y  +   V+  +  L EM + IPL G     S A  Y    L F 
Sbjct: 78  GGALSTCGPAPILISYIVMSFFVWTIVNQLTEMVALIPLPGEASMYSLARMYVGRPLAFM 137

Query: 170 VGYAYLCKYLILPPNQLTAAALVIQYWLDREQVNPGVWITIFLVIIVAMNFIGVKFFGEF 229
            G+       ++ P+++TA A++IQYW D    N  ++I+IF+V  VA+  + V+ FGE 
Sbjct: 138 CGWNLFYAMAMIAPSEITACAMLIQYWTD---ANSAIFISIFIVFSVAITMLPVRVFGES 194

Query: 230 EFWLSTFKVIVMIGLIILLFVIMLGGGPTHDR-LGFRFYDHPGAFKPYSKSIDGSKGKXX 288
           EF +S+ K++ ++GLII+  VI  GGGP+ D  LGF ++  PGAFK +   + GS GK  
Sbjct: 195 EFCVSSIKLLTIVGLIIVGIVIFFGGGPSQDHILGFHYWKKPGAFKEHL--VPGSTGKFL 252

Query: 289 XXXXXXXXXXXXXXGI-ELTGIVAAEAANPRKSIPKAIKLTMYRIIVFYLVTIFLLGMCV 347
                          + E     +AE+A+PR+++P+A +  +YR+ +FY+  + ++ + V
Sbjct: 253 AVWTAIIKSGFSFVLVPETVASCSAESASPRRNMPRACQRFVYRLALFYVAGVLVVTVVV 312

Query: 348 AYDDP-LLXXXXXXXXXXXXXPYVVAIINSGIKALPHIFNACVLMFVFSACNSDLYVASR 406
             DD  LL             PYV+ I  +GIK LPHI NAC+L   +S   ++LY  SR
Sbjct: 313 GSDDANLLNAIHSGASNAAASPYVIGIKEAGIKVLPHIINACILTSAYSCGTAELYGCSR 372

Query: 407 TLYGLAIDNKAPKIFAVTNRWGVPYYSLLMSSCFCLLAYMSVSSGSAKIFNYFVNVVSIF 466
            L+ +A+   AP+IFA  NR+GVPYYS  ++  F LLAY++ S  S+ +FN+  N+ +I 
Sbjct: 373 ILHSMAMKGDAPQIFAKVNRFGVPYYSTAVACLFTLLAYLNCSKSSSLVFNWLSNIATIS 432

Query: 467 GLLSWISILITYLCFFRAVKAQNVDRSRFAYRAPFQPYGSYFTLAFCILIAFIKNFTVFL 526
           G +SW+ + +TY  F   +   +++  R  +R  FQ   +Y  +AF +L++    + VF+
Sbjct: 433 GFISWVFVSVTYTRFRTVIDKLDLN-DRIPFRRRFQKGFAYACIAFFVLLSLTNGYAVFI 491

Query: 527 NHHFDYKNFITGYIGIPVFVISYFGYK-FVKKTKIWKPEEVDLYTF-KAAIDEEEEQGKI 584
             +++  +F   Y+ I    + + G   + K+ +     E+      K  I +E+E+  +
Sbjct: 492 KGNWNTSDFFASYVTIGFVAVLFIGSTIYYKELRFRDVSEIGREIIPKIDIADEDERNDV 551

>Smik_3.53 Chr3 complement(77146..79047) [1902 bp, 633 aa] {ON}
           YCL025C (REAL)
          Length = 633

 Score =  266 bits (681), Expect = 4e-80,   Method: Compositional matrix adjust.
 Identities = 171/564 (30%), Positives = 278/564 (49%), Gaps = 28/564 (4%)

Query: 46  DKKDGLDINDMDNLSTVSSR----LEDSEKQDDYMDDGKDEHTRLRKDLKARHISMIAXX 101
           ++ +   +ND+ +  + SSR    LE +E  D+      ++   L+K ++ RH+ MIA  
Sbjct: 72  ERVETAQMNDLASAISPSSRQRQELEKNESSDNIGARTGNKSDSLKKTIQPRHVLMIALG 131

Query: 102 XXXXXXXXXXXXXXXYTAGPMSMFIAYAFVGVLVFFTMAALGEMA-SYIPL-DGFTSYAS 159
                            AGP  + I Y  +G +++  + A GEMA  Y  L  G+ +Y S
Sbjct: 132 TGIGTGLLVGNGTALVHAGPAGLLIGYGIMGSILYCIIQACGEMALVYSNLTGGYNAYPS 191

Query: 160 RYCDPALGFAVGYAYLCKYLILPPNQLTAAALVIQYWLDREQVNPGVWITIFLVIIVAMN 219
              D   GFAV + Y  ++L + P +L  A++ I+YW     VNP V++ IF V+++ +N
Sbjct: 192 FLVDDGFGFAVAWVYCLQWLCVCPLELVTASMTIKYW--TTSVNPDVFVIIFYVLVITIN 249

Query: 220 FIGVKFFGEFEFWLSTFKVIVMIGLIILLFVIMLGGGPTHDRLGFRFYDHPGAFKPYSKS 279
             G + + E EF+ +  K+++M G  IL  +I +GG      +G +++  PGAF     S
Sbjct: 250 IFGARGYAEAEFFFNCCKILMMTGFFILGIIIDVGGAGNDGFIGGKYWHDPGAFNG-KHS 308

Query: 280 IDGSKGKXXXXXXXXXXXXXXXXGIELTGIVAAEAANPRKSIPKAIKLTMYRIIVFYLVT 339
           ID  KG                 G E   I  AE ANPRK++P A K  +YRI+  +L T
Sbjct: 309 IDRFKG----VVATLVTAAFAFGGSEFIAITTAEQANPRKAVPGAAKQMIYRILFLFLAT 364

Query: 340 IFLLGMCVAYDDPLLXXXXXXXXXXXXXPYVVAIINSGIKALPHIFNACVLMFVFSACNS 399
           I LLG  V Y+   L             PYV+A+ + G++ +PH  NA +L+ V S  NS
Sbjct: 365 IILLGFLVPYNSNQLLGSSGGGTKAS--PYVIAVASHGVRVVPHFINAVILLSVLSMANS 422

Query: 400 DLYVASRTLYGLAIDNKAPKIFAVTNRWGVPYYSLLMSSCFCLLAYMSVSSGSAKIFNYF 459
             Y ++R L  L+    AP++F   ++ G P  ++ +S+ F ++A+ + S    ++F + 
Sbjct: 423 SFYSSARILLTLSEQGYAPRVFTYIDKAGRPLIAMGVSALFGVIAFCAASPKEDQVFTWL 482

Query: 460 VNVVSIFGLLSWISILITYLCFFRAVKAQNVDRSRFAYRAPFQPYGSYFTLAFCILIAFI 519
           + +  +  L +W +I ++++ F RA+K Q        +R+    +GS +     ILI  I
Sbjct: 483 LAISGLSQLFTWTAICLSHIRFRRAMKVQGRSLGELGFRSQTGVWGSTYACIMMILI-LI 541

Query: 520 KNFTVFL----NHHFDYKNFITGYIGIPVFVISYFGYKFVKKTKIWK----PEEVDLYTF 571
             F V +        D + F   Y+ +P+ +  Y GYK  KK   WK     +++DL + 
Sbjct: 542 GQFWVAIAPIGEGKLDAQAFFENYLAMPILIALYVGYKIWKKD--WKLFIRADKIDLISH 599

Query: 572 KAAIDEEEEQGKIADAERRERLKN 595
           +   DEE    K  D E RERLKN
Sbjct: 600 RQIFDEELI--KQEDEEFRERLKN 621

>KAFR0A01120 Chr1 complement(216442..218220) [1779 bp, 592 aa] {ON}
           Anc_3.284 YDR046C
          Length = 592

 Score =  265 bits (676), Expect = 9e-80,   Method: Compositional matrix adjust.
 Identities = 172/537 (32%), Positives = 269/537 (50%), Gaps = 23/537 (4%)

Query: 71  KQDDYMDDGKDE---HTRLRKDLKARHISMIAXXXXXXXXXXXXXXXXXYTAGPMSMFIA 127
           KQD  +++  D     T+L+K +K+RH+ M++                 + AGP  + IA
Sbjct: 57  KQDSDLEEDTDTIVTDTQLKKTMKSRHVVMMSLGTGIGTGLLVANAQGLHKAGPAPLVIA 116

Query: 128 YAFVGVLVFFTMAALGEMASYIP-LDG-FTSYASRYCDPALGFAVGYAYLCKYLILPPNQ 185
           Y  V  + +F + A GEMA   P L G F +Y S +     GFA  + +  ++L + P +
Sbjct: 117 YGMVSFVTYFMIQAAGEMAVVYPTLPGNFNAYISTFISKPFGFATVWLFFIQWLTVLPLE 176

Query: 186 LTAAALVIQYWLDREQVNPGVWITIFLVIIVAMNFIGVKFFGEFEFWLSTFKVIVMIGLI 245
           L  AA+ +QYW D   +N  V++ IF V ++ ++F GVK +GE EF  +  K++ + G I
Sbjct: 177 LITAAMTVQYWND--SINADVYVVIFYVFLLFIHFFGVKAYGETEFIFNLCKILFVGGFI 234

Query: 246 ILLFVIMLGGGPTHDRLGFRFYDHPGAFKPYSKSIDGSKGKXXXXXXXXXXXXXXXXGIE 305
           I   V+ +GG      +G +++  PGAF     + D + G+                G+E
Sbjct: 235 IFSIVVNVGGAGNSGYIGAKYWHDPGAF-----TSDTNAGRFKGVCYVLVTAYFSYGGME 289

Query: 306 LTGIVAAEAANPRKSIPKAIKLTMYRIIVFYLVTIFLLGMCVAYDDPLLXXXXXXXXXXX 365
           L  +   E  NPR+S P A K ++YRI+V YL+T+ L+G  V  +   L           
Sbjct: 290 LFALSVNEQENPRRSTPTAAKQSIYRIVVIYLLTMILVGFNVPSNSNELMGSGGSVTHAS 349

Query: 366 XXPYVVAIINSGIKALPHIFNACVLMFVFSACNSDLYVASRTLYGLAIDNKAPKIFAVTN 425
             PYV+A    G+K +PHI NA +L+ + S  NS LY A R +  LA    APK     +
Sbjct: 350 --PYVLAASIHGVKVVPHIVNAVILISLISVGNSALYAAPRLMCALAQQGFAPKFMDYVD 407

Query: 426 RWGVPYYSLLMSSCFCLLAYMSVSSGSAKIFNYFVNVVSIFGLLSWISILITYLCFFRAV 485
           R G P ++L++ S F ++ +++ SS   ++FN+   +  +  L +W  I+I+++ F +A+
Sbjct: 408 REGRPLFALIVCSVFGVIGFVACSSKEEQVFNWLAAIAGLAELFTWSGIMISHIRFRQAM 467

Query: 486 KAQNVDRSRFAYRAPFQPYGSYFTLAFCILIAFIKNFTVFLN----HHFDYKNFITGYIG 541
           K QN       Y++PF  YGSYF + F +L+ F+  F V L            F   Y+ 
Sbjct: 468 KLQNKSLDEVGYKSPFGVYGSYFGVFFNLLV-FVAQFWVALAPPMYTEMSADTFFESYLA 526

Query: 542 IPVFVISYFGYKFVKK--TKIWKPEEVDLYTFKAAIDEEEEQGKIADAERRERLKNS 596
            P+F   YFGY   K+  T     E VDL   +   D E    K  D E++E LKNS
Sbjct: 527 FPIFFAFYFGYMIWKRDFTLFSDLESVDLDYHRRIYDPELV--KQEDEEKKEMLKNS 581

>NDAI0B05220 Chr2 (1278386..1280221) [1836 bp, 611 aa] {ON}
           Anc_1.244
          Length = 611

 Score =  265 bits (677), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 181/579 (31%), Positives = 294/579 (50%), Gaps = 40/579 (6%)

Query: 51  LDIND--MDNLSTVS--SRLEDSEK--QDDYMDDGKDEHTR---------LRKDLKARHI 95
           +D ND  +D+  +VS  +R++DS K  + + +D    E  R         L+  LK RH+
Sbjct: 45  IDSNDATIDHSKSVSRWTRIKDSFKRAEKEEVDPNLTEAERIAINTAKAPLKHTLKGRHM 104

Query: 96  SMIAXXXXXXXXXXXXXXXXXYTAGPMSMFIAYAFVGVLVFFTMAALGEMASYIPLDG-F 154
            M+A                  TAGP  + I +     +++  + ALGE+A   P+ G F
Sbjct: 105 QMVAIGGAIGSGLFVGSSTALRTAGPAGIVIGWGLTSTMIYCMVMALGELAVVFPVSGGF 164

Query: 155 TSYASRYCDPALGFAVGYAYLCKYLILPPNQLTAAALVIQYWLDREQVNPGVWITIFLVI 214
           T+YA+R+ D + GFA  + Y  ++L   P ++ +A++ + YW   E+   G ++ +F ++
Sbjct: 165 TTYATRFIDESFGFASNFNYALQWLATLPLEIVSASITVNYWQTPERYRDG-FVALFWLV 223

Query: 215 IVAMNFIGVKFFGEFEFWLSTFKVIVMIGLIILLFVIMLGGGPTHDRLGFRFYDHPGAFK 274
           IV +N  GV+ FGE EF  ST KV+ +IG IIL  V++ GGGP    +G R++ +PGAF 
Sbjct: 224 IVIINLFGVRGFGEAEFVFSTIKVLTVIGFIILGIVLVAGGGPEGGFVGGRYWHNPGAFV 283

Query: 275 PYSKSIDGSKGKXXXXXXXXXXXXXXXXGIELTGIVAAEAANPRKSIPKAIKLTMYRIIV 334
                 D +  +                G EL GI AAEAANPRKS+P+A K  ++RI++
Sbjct: 284 G-----DNAGTQFKGVCSVFVTAAFSFAGSELVGITAAEAANPRKSVPRAAKQVVWRIVL 338

Query: 335 FYLVTIFLLGMCVAYDDPLLXXXXXXXXXXXXXPYVVAIINSGIKALPHIFNACVLMFVF 394
           FY+ ++ ++G+ V Y DP L             P+V+AI+  GI+ LP + N  +L+ V 
Sbjct: 339 FYMGSLIMIGLLVPYTDPRLIGASSVDASAS--PFVIAIVTHGIRGLPSVINVVILIAVL 396

Query: 395 SACNSDLYVASRTLYGLAIDNKAPKIFAVTNRWGVPYYSLLMSSCFCLLAYMSVSSGSAK 454
           S  NS ++  SRT+  L+     P+IF   +R G P   +++ S F L+A+++ S    +
Sbjct: 397 SVGNSAIFAGSRTIAALSEQGFLPEIFGYIDRKGRPLVGIIVISTFGLIAFIAASKKQGE 456

Query: 455 IFNYFVNVVSIFGLLSWISILITYLCFFRAVKAQNVDRSRFAYRAPFQPYGSYFTLAFCI 514
           +F + + +  +  L +W  I + ++ F  A+KAQ    +   + +P    GS + L F +
Sbjct: 457 VFAWLMALSGLSSLFTWGGICLCHIRFRMALKAQGRSTNELPFVSPAGIIGSSWGL-FML 515

Query: 515 LIAFIKNFTVFL---NHHFDYKNFITGYIGIPVFVISYFGYKFVKKTKIW----KPEEVD 567
           L+ FI  F V L         + F   Y+  P+ +  YFG+K  KK   W    K E++D
Sbjct: 516 LLMFIAQFYVALFPPGSKPSAEVFFESYLSFPIVLAFYFGHKIYKKN--WKLFIKAEDMD 573

Query: 568 LYTFKAAIDEEEEQGKIADAERRERLKNSKTKGWDWFYE 606
           + T +   D E     +   E  E      TKGW W+ +
Sbjct: 574 IDTGRRETDLE-----LLKQEIEEEKAILATKGW-WYRQ 606

>Kpol_2000.92 s2000 (208509..210422) [1914 bp, 637 aa] {ON}
           (208509..210422) [1914 nt, 638 aa]
          Length = 637

 Score =  265 bits (676), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 180/569 (31%), Positives = 290/569 (50%), Gaps = 41/569 (7%)

Query: 53  INDMDN-LSTVSSRLE-----DSEKQDDYMDDGKDEHTR---------LRKDLKARHISM 97
           ++D+DN ++T  SR       +  K DD +     E  +         L+K +K RH+ M
Sbjct: 72  LHDLDNDITTSISRTSMDAALNKTKFDDAISSSISETNKGHQNEKSEDLKKTIKPRHVIM 131

Query: 98  IAXXXXXXXXXXXXXXXXXYTAGPMSMFIAYAFVGVLVFFTMAALGEMAS-YIPLDG-FT 155
           I+                   AGP ++ I YA +G  ++  + A GE+A  Y  L+G F 
Sbjct: 132 ISLGTGIGTGLLVGNGPVLSKAGPAALVIGYAIMGTCLYCIIQAAGELAVVYSDLNGGFN 191

Query: 156 SYASRYCDPALGFAVGYAYLCKYLILPPNQLTAAALVIQYWLDREQVNPGVWITIFLVII 215
           +Y S   DPALGF+V + Y  ++L + P +L  A++ I+YW  +  V+P V++ IF V+I
Sbjct: 192 AYPSFLVDPALGFSVAWVYCLQWLCVCPLELVTASMTIKYWTTK--VDPDVFVVIFYVLI 249

Query: 216 VAMNFIGVKFFGEFEFWLSTFKVIVMIGLIILLFVIMLGGGPTHDRLGFRFYDHPGAFKP 275
           +A+N  G + + E EF+ +  KV++M G  IL  +I  GG      LG +++  PGAF  
Sbjct: 250 IAINTFGARGYAEAEFFFNCCKVLMMTGFFILGIIITAGGAGNDGYLGAKYWHDPGAFNG 309

Query: 276 YSKSIDGSKGKXXXXXXXXXXXXXXXXGIELTGIVAAEAANPRKSIPKAIKLTMYRIIVF 335
             KSID  KG                   E   + AAE +NPRK+IP A K  +YRI+  
Sbjct: 310 -DKSIDRFKG----VMDTFVTAAFAFGATEFIALTAAEQSNPRKAIPSAAKKVLYRIVCI 364

Query: 336 YLVTIFLLGMCVAYD-DPLLXXXXXXXXXXXXXPYVVAIINSGIKALPHIFNACVLMFVF 394
           +L +I L+G  V Y+ D LL             PYV+A+ + G++ +PH  NA +L+ V 
Sbjct: 365 FLASITLIGFLVPYNSDQLLGSGGSGIKAS---PYVIAVSSHGVRVVPHFINAVILLSVL 421

Query: 395 SACNSDLYVASRTLYGLAIDNKAPKIFAVTNRWGVPYYSLLMSSCFCLLAYMSVSSGSAK 454
           S  NS  Y +SR L  LA    APK F   +R G P+ ++LMS+ F ++A+ + S    +
Sbjct: 422 SVGNSAFYSSSRLLLSLAQQGYAPKWFDYVDREGRPFRAMLMSALFGVIAFCATSPKETE 481

Query: 455 IFNYFVNVVSIFGLLSWISILITYLCFFRAVKAQNVDRSRFAYRAPFQPYGSYFTLAFCI 514
           +F++ + +  +  L +WI+I ++++ F RA++ Q        Y +    YGS +  A  +
Sbjct: 482 VFSWLLAISGLSQLFTWITICVSHIRFRRAMQVQGRSLGEVGYLSQSGVYGSAYA-AIML 540

Query: 515 LIAFIKNFTVFL----NHHFDYKNFITGYIGIPVFVISYFGYKFVKKTKIWK----PEEV 566
            +A I  F V +        D +NF   Y+ +P+ +  YFGY+  K+   WK     +++
Sbjct: 541 FLALIAQFWVAIAPIGEGKLDAENFFQNYLAMPILIAFYFGYRVWKRD--WKLFIRAKDI 598

Query: 567 DLYTFKAAIDEEEEQGKIADAERRERLKN 595
           DL T +   DE   + +  D E +E+L+N
Sbjct: 599 DLDTHRQIFDENILRQE--DEEYKEKLRN 625

>Skud_3.38 Chr3 complement(63096..64997) [1902 bp, 633 aa] {ON}
           YCL025C (REAL)
          Length = 633

 Score =  264 bits (674), Expect = 4e-79,   Method: Compositional matrix adjust.
 Identities = 171/565 (30%), Positives = 279/565 (49%), Gaps = 30/565 (5%)

Query: 46  DKKDGLDINDMDNLSTVSSR----LEDSEKQDDYMDDGKDEHTRLRKDLKARHISMIAXX 101
           D+ + + +ND+ +  + SSR    LE ++  D       ++   L+K ++ RH+ MIA  
Sbjct: 72  DESEAVQMNDLTSAISPSSRNAQGLEKNDSTDKINPPAGNKSGSLKKTIQPRHVLMIALG 131

Query: 102 XXXXXXXXXXXXXXXYTAGPMSMFIAYAFVGVLVFFTMAALGEMA-SYIPL-DGFTSYAS 159
                            AGP  + I YA +G +++  + A GE+A  Y  L  G+ +Y S
Sbjct: 132 TGIGTGLLVGNGTALVHAGPAGLLIGYAIMGSILYCIIQACGELALVYSNLTGGYNAYPS 191

Query: 160 RYCDPALGFAVGYAYLCKYLILPPNQLTAAALVIQYWLDREQVNPGVWITIFLVIIVAMN 219
              D   GFAV + Y  ++L + P +L  A++ I+YW     VNP V++ IF V+++ +N
Sbjct: 192 FLVDDGFGFAVAWVYCLQWLCVCPLELVTASMTIKYW--TTSVNPDVFVIIFYVLVITIN 249

Query: 220 FIGVKFFGEFEFWLSTFKVIVMIGLIILLFVIMLGGGPTHDRLGFRFYDHPGAFKPYSKS 279
             G + + E EF+ +  K+++M G  IL  +I +GG      +G +++  PGAF     S
Sbjct: 250 IFGARGYAEAEFFFNCCKILMMTGFFILSIIIDVGGAGNDGFIGGKYWHDPGAFNG-KHS 308

Query: 280 IDGSKGKXXXXXXXXXXXXXXXXGIELTGIVAAEAANPRKSIPKAIKLTMYRIIVFYLVT 339
           ID  KG                 G E   I  AE +NPRK+IP A K  +YRI+  +L T
Sbjct: 309 IDRFKG----VVATLVTAAFAFGGSEFIAITTAEQSNPRKAIPGAAKQMIYRILFLFLAT 364

Query: 340 IFLLGMCVAYD-DPLLXXXXXXXXXXXXXPYVVAIINSGIKALPHIFNACVLMFVFSACN 398
           I +LG  V Y+ D LL             PYV+AI + G++ +PH  NA +L+ V S  N
Sbjct: 365 IIMLGFLVPYNSDQLLGSGGGGTKAS---PYVIAIASHGVRVVPHFVNAVILLSVLSMAN 421

Query: 399 SDLYVASRTLYGLAIDNKAPKIFAVTNRWGVPYYSLLMSSCFCLLAYMSVSSGSAKIFNY 458
           S  Y ++R    L+    APK F+  +R G P  ++ +S+ F ++A+ + S    ++F +
Sbjct: 422 SSFYSSARLFLTLSEQGYAPKFFSYIDRAGRPLIAMGVSALFAVIAFCAASPKEEQVFTW 481

Query: 459 FVNVVSIFGLLSWISILITYLCFFRAVKAQNVDRSRFAYRAPFQPYGSYFTLAFCILIAF 518
            + +  +  L +W +I  +++ F RA+K Q        +++    +GS +     +LI  
Sbjct: 482 LLAISGLSQLFTWTAICFSHIRFRRAMKVQGRSLGELGFKSQTGVWGSMYACIMMLLI-L 540

Query: 519 IKNFTVFL----NHHFDYKNFITGYIGIPVFVISYFGYKFVKKTKIWK----PEEVDLYT 570
           I  F V +        D + F   Y+ +P+ +  Y GYK    TK WK     +++DL +
Sbjct: 541 IGQFWVAIAPIGEGKLDAQAFFENYLAMPILIALYVGYKIW--TKDWKLFIRADKIDLES 598

Query: 571 FKAAIDEEEEQGKIADAERRERLKN 595
            +   DEE    K  D E RERL+N
Sbjct: 599 HRQIFDEELI--KQEDEEYRERLRN 621

>SAKL0C01650g Chr3 complement(139480..141321) [1842 bp, 613 aa] {ON}
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508C GNP1 High-affinity glutamine permease also
           transports Leu Ser Thr Cys Met and Asn expression is
           fully dependent on Grr1p and modulated by the
           Ssy1p-Ptr3p-Ssy5p (SPS) sensor of extracellular amino
           acids
          Length = 613

 Score =  263 bits (671), Expect = 8e-79,   Method: Compositional matrix adjust.
 Identities = 167/542 (30%), Positives = 272/542 (50%), Gaps = 21/542 (3%)

Query: 67  EDSEKQDDYMDDGKDEHTRLRKDLKARHISMIAXXXXXXXXXXXXXXXXXYTAGPMSMFI 126
            ++  ++D  D G     +L+K +K+RH+ MI+                    GP  + I
Sbjct: 77  SNNPDKEDGSDAGDKGDNKLKKTIKSRHVVMISLGTGIGTGMLVGNGKALRNGGPAGLVI 136

Query: 127 AYAFVGVLVFFTMAALGEMA-SYIPLDG-FTSYASRYCDPALGFAVGYAYLCKYLILPPN 184
            YA +G  ++  + A GE+A  Y  L G F +Y S   DPALGF+V + Y  ++L + P 
Sbjct: 137 GYAIMGSCLYCIIQAAGELAVCYTSLSGGFNAYPSLLIDPALGFSVAWVYCLQWLCVMPL 196

Query: 185 QLTAAALVIQYWLDREQVNPGVWITIFLVIIVAMNFIGVKFFGEFEFWLSTFKVIVMIGL 244
           +L  A++ I+YW     VNP +++ IF V+ +A+N  G + + E EF+ +T KV+++ G 
Sbjct: 197 ELVTASITIKYW--TTSVNPDIFVAIFYVLTIAINVFGARGYAEAEFFFNTCKVLMITGF 254

Query: 245 IILLFVIMLGGGPTHDRLGFRFYDHPGAFKPYSKSIDGSKGKXXXXXXXXXXXXXXXXGI 304
            IL  ++  GG      +G ++++ PG+F    K ID  KG                   
Sbjct: 255 FILGIIVNCGGAGNDGYIGGKYWNDPGSFSG-DKPIDHFKG----VVSTLVTAAFAFGAT 309

Query: 305 ELTGIVAAEAANPRKSIPKAIKLTMYRIIVFYLVTIFLLGMCVAYDDPLLXXXXXXXXXX 364
           E   + AAE ANPRKSIP A K  +YRIIV +L +I L+G  V ++   L          
Sbjct: 310 EFIALTAAEQANPRKSIPSAAKKVLYRIIVIFLGSITLVGFLVPHNSEELMGSGGSATHA 369

Query: 365 XXXPYVVAIINSGIKALPHIFNACVLMFVFSACNSDLYVASRTLYGLAIDNKAPKIFAVT 424
              PYV+AI + G+K +PH  NA +L+ V S  NS  Y +SR L  LA    AP      
Sbjct: 370 S--PYVIAIASHGVKVVPHFINAVILLSVLSVGNSAFYSSSRLLLSLAEQGYAPSFLKYV 427

Query: 425 NRWGVPYYSLLMSSCFCLLAYMSVSSGSAKIFNYFVNVVSIFGLLSWISILITYLCFFRA 484
           +R G P  ++++S+ F L+++++ S     +F + + +  +  L +W +I ++++ F RA
Sbjct: 428 DREGRPTLAMIISAVFGLISFVAASPKEETVFTWLLAISGLSQLFTWSAICLSHIRFRRA 487

Query: 485 VKAQNVDRSRFAYRAPFQPYGSYFTLAFCILIAFIKNFTVFL---NHHFDYKNFITGYIG 541
           +K Q        +++    +GSY+     +LI   + +T          D + F   Y+ 
Sbjct: 488 MKVQGRSLGELGFKSQVGVWGSYYATGMMLLILIGQFWTAIAPIGEGKLDAEAFFENYLA 547

Query: 542 IPVFVISYFGYKFVKK--TKIWKPEEVDLYTFKAAIDEEEEQGKIADAERRERLKNSKTK 599
           +P+ +  YFGYK  K+  T      ++DL + +   DE+    K  DAE RE+L+NS   
Sbjct: 548 MPILIALYFGYKVWKRDWTLYIPASKIDLISNRRIFDEDVL--KQEDAEFREKLRNS--- 602

Query: 600 GW 601
           GW
Sbjct: 603 GW 604

>CAGL0B01012g Chr2 (91330..93201) [1872 bp, 623 aa] {ON} similar to
           uniprot|P25376 Saccharomyces cerevisiae YCL025c AGP1
           Asparagine/glutamine permease or uniprot|P48813
           Saccharomyces cerevisiae YDR508c GNP1
          Length = 623

 Score =  262 bits (670), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 164/551 (29%), Positives = 272/551 (49%), Gaps = 26/551 (4%)

Query: 57  DNLSTVSSRLEDSEKQDDYM--DDGKDEHTRLRKDLKARHISMIAXXXXXXXXXXXXXXX 114
           +NL      + D E Q++ +  +    ++  L++ +K RH+ +I+               
Sbjct: 75  ENLDKDGKEVADLEVQENQVLTEKSNQKNKELKQTIKPRHVILISLGTGIGTGLLVGNAK 134

Query: 115 XXYTAGPMSMFIAYAFVGVLVFFTMAALGEMA-SYIPLDG-FTSYASRYCDPALGFAVGY 172
             + AGP  + I Y+ +G  ++  + A GE+A SY  L G F  Y S   DPA GF+V +
Sbjct: 135 ALHNAGPAGLLIGYSIMGTCLYCIIQAAGELAVSYSSLSGGFNVYPSFLVDPAFGFSVAW 194

Query: 173 AYLCKYLILPPNQLTAAALVIQYWLDREQVNPGVWITIFLVIIVAMNFIGVKFFGEFEFW 232
            Y  ++L + P +L  A++ I+YW     VN  +++ IF V+I+ +N  G + + E EF+
Sbjct: 195 VYCIQWLCVCPLELVTASMTIKYW--TTTVNADIFVGIFYVLIIVINTFGARGYAEAEFF 252

Query: 233 LSTFKVIVMIGLIILLFVIMLGGGPTHDRLGFRFYDHPGAFKPYSKSIDGSKGKXXXXXX 292
            +  K+++MIG  IL  VI  GG      +G R++  PGAF    + ID  KG       
Sbjct: 253 FNCCKILMMIGFFILGIVINTGGAGNDGYIGDRYWHTPGAFAG-DRPIDHFKG----IMA 307

Query: 293 XXXXXXXXXXGIELTGIVAAEAANPRKSIPKAIKLTMYRIIVFYLVTIFLLGMCVAYDDP 352
                       E   + AAE +NPRK+IP A K  +YRI+  +L +I L+G  V YD  
Sbjct: 308 TMVTAAFAFGATEFIALTAAEQSNPRKAIPSAAKKVLYRILFIFLGSITLVGFLVPYDSD 367

Query: 353 LLXXXXXXXXXXXXXPYVVAIINSGIKALPHIFNACVLMFVFSACNSDLYVASRTLYGLA 412
            L             PYV+A+   G+K +PH  NA +L+ V S  NS  Y +SR LY LA
Sbjct: 368 QLMGSGGSATKAS--PYVLAVSTHGVKVVPHFINAVILLSVLSVGNSAFYSSSRLLYSLA 425

Query: 413 IDNKAPKIFAVTNRWGVPYYSLLMSSCFCLLAYMSVSSGSAKIFNYFVNVVSIFGLLSWI 472
               APK F   +R G P+ +++ +  F ++++ + S    ++F + + +  +  + +W 
Sbjct: 426 QQGNAPKFFDYVDREGRPFRAMVCAGVFAIISFCAASPKEEQVFTWLLAISGLSQVFTWF 485

Query: 473 SILITYLCFFRAVKAQNVDRSRFAYRAPFQPYGSYFTLAFCILIAFIKNFTVFL----NH 528
           +I ++++ F +A+  Q        ++A    +GSY+ + F +++  I  F V +      
Sbjct: 486 AICLSHIRFRKAMFVQKRSLGEIGFKAQTGVWGSYY-VCFMLVMILIAQFWVAIAPIGEG 544

Query: 529 HFDYKNFITGYIGIPVFVISYFGYKFVKKTKIW----KPEEVDLYTFKAAIDEEEEQGKI 584
             D + F   Y+ +P+ ++ Y GYK  KK   W    +   +DL   +   DEE    K 
Sbjct: 545 KLDAQGFFENYLAMPILILFYVGYKIWKKD--WSLFIRANNIDLDKHRQIFDEELL--KQ 600

Query: 585 ADAERRERLKN 595
            D E RE+LKN
Sbjct: 601 EDEEYREKLKN 611

>Ecym_2664 Chr2 complement(1280994..1282721) [1728 bp, 575 aa] {ON}
           similar to Ashbya gossypii AGR040C
          Length = 575

 Score =  260 bits (664), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 168/540 (31%), Positives = 271/540 (50%), Gaps = 31/540 (5%)

Query: 70  EKQDDYM---DDGKDEHTRLRKDLKARHISMIAXXXXXXXXXXXXXXXXXYTAGPMSMFI 126
           +KQDD +   D+     ++++K +K+RH+ MI+                   AGP  + I
Sbjct: 45  KKQDDDVVGYDEETGTSSKMKKTIKSRHLLMISLGTGIGTGLLVGNGTALAKAGPGGLII 104

Query: 127 AYAFVGVLVFFTMAALGEMA-SYIPLDG-FTSYASRYCDPALGFAVGYAYLCKYLILPPN 184
            Y     +++  + A GE+   Y  + G +T+Y+S   DPALGF+V + Y  +++ + P 
Sbjct: 105 GYGVASAMLYCIIQAAGELGICYSGMTGNYTAYSSLLVDPALGFSVSWVYCIQWMTVFPL 164

Query: 185 QLTAAALVIQYWLDREQVNPGVWITIFLVIIVAMNFIGVKFFGEFEFWLSTFKVIVMIGL 244
           QL  AA+ I+YW D    NP +++ I   +IV +N  G K + E EF  +T KV++M+G 
Sbjct: 165 QLVTAAITIKYWTD---TNPDIFVAILYFLIVFINLFGAKGYAEAEFLFNTCKVLMMVGF 221

Query: 245 IILLFVIMLGGGPTHDRLGFRFYDHPGAFKPYSKSIDGSKGKXXXXXXXXXXXXXXXXGI 304
           +IL  +I  GG      +G R++  PGAF        G KG                 GI
Sbjct: 222 VILGIIINCGGAGNDGYIGARYWHTPGAFS------TGFKG----VCYVFCYAAFAYGGI 271

Query: 305 ELTGIVAAEAANPRKSIPKAIKLTMYRIIVFYLVTIFLLGMCVAYDDPLLXXXXXXXXXX 364
           E+  + A+E  NPRKSIP A K  +YRI++ Y++T  ++   V YD P L          
Sbjct: 272 EVMVLTASEQENPRKSIPSACKKVIYRILLIYMLTTLIVCFLVPYDAPELTSTGSASRAS 331

Query: 365 XXXPYVVAIINSGIKALPHIFNACVLMFVFSACNSDLYVASRTLYGLAIDNKAPKIFAVT 424
              P+V+AI + GI  +PHI NA +L+ V S  NS LY A R L  L+    APK+F   
Sbjct: 332 ---PFVIAIASHGISVVPHIINAVILVAVVSVGNSSLYSAPRLLLSLSEQGYAPKVFNYV 388

Query: 425 NRWGVPYYSLLMSSCFCLLAYMSVSSGSAKIFNYFVNVVSIFGLLSWISILITYLCFFRA 484
           +R G P    L++    LLA+++ S     +F++ + +  +  L  WISI ++++ F  A
Sbjct: 389 DRQGRPLLCFLVAMFVGLLAFIAASDAEEDVFSWLLAISGLSQLFIWISICLSHVRFRDA 448

Query: 485 VKAQNVDRSRFAYRAPFQPYGSYFTLAFCILIAFIKNFTVFL-----NHHFDYKNFITGY 539
           +KAQ        Y++    +GS+F +   + +  +  F V +           K+F   Y
Sbjct: 449 MKAQGRSLGEVGYKSQTGYWGSWFAIIVSLFV-LVAQFWVAIAPIGNGGKLSAKDFFQSY 507

Query: 540 IGIPVFVISYFGYK-FVKKTKIWKP-EEVDLYTFKAAIDEEEEQGKIADAERRERLKNSK 597
           +  PV +  YFGYK + K  ++  P  EVDL + +   DE+E   K  D + +E+++ + 
Sbjct: 508 LAAPVLIFIYFGYKIYYKDWRLCIPATEVDLNSHRKIFDEDEL--KQEDLDWKEKMRTAS 565

>KAFR0C00400 Chr3 (83280..85028) [1749 bp, 582 aa] {ON} 
          Length = 582

 Score =  260 bits (664), Expect = 4e-78,   Method: Compositional matrix adjust.
 Identities = 174/563 (30%), Positives = 278/563 (49%), Gaps = 30/563 (5%)

Query: 51  LDINDMDNLSTVSSRLEDSEK---QDDYMD------DGKDEHTRLRKDLKARHISMIAXX 101
           +D+      S V  R  DS K   +D+  D      +  D H  L+K +K+RH+ M+   
Sbjct: 24  VDLGGEGRASGVFHRFIDSFKPPVEDEKSDLEEMSMESTDRH--LKKAMKSRHVIMMTLG 81

Query: 102 XXXXXXXXXXXXXXXYTAGPMSMFIAYAFVGVLVFFTMAALGEMA-SYIPLDG-FTSYAS 159
                             GP ++ I Y  V  + +F + A GEMA +Y  L G F +Y S
Sbjct: 82  TGVGTGLLVANAKGLSYGGPGALVIGYILVSFVTYFMIQAAGEMAVTYPTLPGSFNTYTS 141

Query: 160 RYCDPALGFAVGYAYLCKYLILPPNQLTAAALVIQYWLDREQVNPGVWITIFLVIIVAMN 219
            +    +GFA  + +L ++L + P +L    + IQYW D   +N  VWI IF V ++ ++
Sbjct: 142 TFISKPVGFATVWLFLIQWLTVLPLELITGTMTIQYWND--SINADVWIVIFYVFLLCVH 199

Query: 220 FIGVKFFGEFEFWLSTFKVIVMIGLIILLFVIMLGGGPTHDRLGFRFYDHPGAFKPYSKS 279
             GVK +GE EF  +T K++ + G II   V+  GG  T   +G +++ +PG+F   +  
Sbjct: 200 VFGVKAYGELEFIFNTCKILFIGGFIIFSIVVNAGGAGTDGYIGAKYWKNPGSFASST-- 257

Query: 280 IDGSKGKXXXXXXXXXXXXXXXXGIELTGIVAAEAANPRKSIPKAIKLTMYRIIVFYLVT 339
              S G+                G EL  +   E ANPR+S PKA K ++YRI++ YL+T
Sbjct: 258 ---SAGRFKDVCYVLVTAYFSYGGTELYVLSVNEQANPRRSTPKAAKQSIYRILIIYLLT 314

Query: 340 IFLLGMCVAYDDPLLXXXXXXXXXXXXXPYVVAIINSGIKALPHIFNACVLMFVFSACNS 399
           + L+G  V +D+  L             PYV+A    G+K +PHI NA +L+ V S  NS
Sbjct: 315 MILIGFNVPHDNDQLMGAGGSSTHAS--PYVLAASIHGVKVVPHIINAVILICVTSMGNS 372

Query: 400 DLYVASRTLYGLAIDNKAPKIFAVTNRWGVPYYSLLMSSCFCLLAYMSVSSGSAKIFNYF 459
            LY A R    LA    APK  A  +R G P  +L   +   ++A+ + SS   ++F + 
Sbjct: 373 SLYAAQRLFASLAEQGYAPKCLAYIDREGRPIIALAACAVVGVIAFAAASSQEEQVFTWL 432

Query: 460 VNVVSIFGLLSWISILITYLCFFRAVKAQNVDRSRFAYRAPFQPYGSYFTLAFCILIAFI 519
             + ++  L +W +IL++++ F  A+K Q  D +   Y+A    +GS +   FC+L+ FI
Sbjct: 433 AAIAALSELFTWSTILLSHIRFRMAMKVQGKDLNELGYKALTGVWGSMWGFGFCVLV-FI 491

Query: 520 KNFTVFLN---HHFDYKNFITGYIGIPVFVISYFGYKFVKK--TKIWKPEEVDLYTFKAA 574
             F V L+        + F   Y+  P+++  YF Y   K+  T + K E++DL   +  
Sbjct: 492 AQFWVALSPPGGTISAEGFFESYLAFPLWLFFYFAYMLWKRDFTFLTKLEDIDLDAHRRI 551

Query: 575 IDEEEEQGKIADAERRERLKNSK 597
            D E  + +  D ER+E+++NS 
Sbjct: 552 YDPEFLRQE--DEERKEKIRNSS 572

>Suva_3.189 Chr3 complement(285493..287394) [1902 bp, 633 aa] {ON}
           YCL025C (REAL)
          Length = 633

 Score =  261 bits (667), Expect = 4e-78,   Method: Compositional matrix adjust.
 Identities = 171/568 (30%), Positives = 279/568 (49%), Gaps = 33/568 (5%)

Query: 46  DKKDGLDINDMDNLSTV---SSR----LEDSEKQDDYMDDGKDEHTRLRKDLKARHISMI 98
           D++   ++  M++L++    SSR    LE  E  D        +   L+K ++ RH+ MI
Sbjct: 69  DQEQEAEVAQMNDLTSAISPSSRQAHELEKDETTDKIAPHTGHKSDSLKKTIQPRHVLMI 128

Query: 99  AXXXXXXXXXXXXXXXXXYTAGPMSMFIAYAFVGVLVFFTMAALGEMA-SYIPLDG-FTS 156
           A                   AGP  + I YA +G +++  + A GEMA  Y  L G + +
Sbjct: 129 ALGTGIGTGLLVGNGTALVHAGPAGLLIGYAIMGSILYCIIQACGEMALVYSNLTGGYNA 188

Query: 157 YASRYCDPALGFAVGYAYLCKYLILPPNQLTAAALVIQYWLDREQVNPGVWITIFLVIIV 216
           Y S   D   GFAV + Y  ++L + P +L  A++ I+YW     VNP V++ IF V+++
Sbjct: 189 YPSFLVDDGFGFAVAWVYCLQWLCVCPLELVTASMTIKYW--TTSVNPDVFVIIFYVLVI 246

Query: 217 AMNFIGVKFFGEFEFWLSTFKVIVMIGLIILLFVIMLGGGPTHDRLGFRFYDHPGAFKPY 276
            +N  G + + E EF+ +  K+++M G  IL  +I +GG      +G +++  PGAF   
Sbjct: 247 TINIFGARGYAEAEFFFNCCKILMMTGFFILGIIIDVGGAGNDGYIGGKYWHEPGAFNGV 306

Query: 277 SKSIDGSKGKXXXXXXXXXXXXXXXXGIELTGIVAAEAANPRKSIPKAIKLTMYRIIVFY 336
             +ID  KG                 G E   I  AE +NPRK+IP A K  +YRI+  +
Sbjct: 307 -HAIDRFKG----VVATLVTAAFAFGGSEFIAITTAEQSNPRKAIPGAAKQMIYRILFLF 361

Query: 337 LVTIFLLGMCVAYD-DPLLXXXXXXXXXXXXXPYVVAIINSGIKALPHIFNACVLMFVFS 395
           L TI ++G  V Y+ D LL             PYV+AI + G++  PH  NA +L+ V S
Sbjct: 362 LATIIIVGFLVPYNSDQLLGSSGGGTKAS---PYVIAIASHGVRVAPHFVNAVILLSVLS 418

Query: 396 ACNSDLYVASRTLYGLAIDNKAPKIFAVTNRWGVPYYSLLMSSCFCLLAYMSVSSGSAKI 455
             NS  Y ++R    L+    APKIF+  +R G P  ++ +S+ F ++A+ + S    ++
Sbjct: 419 MANSSFYSSARLFLTLSEQGYAPKIFSYIDRAGRPLIAMCVSALFAVIAFCAASPKEDQV 478

Query: 456 FNYFVNVVSIFGLLSWISILITYLCFFRAVKAQNVDRSRFAYRAPFQPYGSYFTLAFCIL 515
           F + + +  +  L +W +I ++++ F RA+K Q        +++    +GS ++    IL
Sbjct: 479 FTWLLAISGLSQLFTWTAICLSHIRFRRAMKVQGRSLGELGFKSQTGVWGSIYSCIMMIL 538

Query: 516 IAFIKNFTVFL----NHHFDYKNFITGYIGIPVFVISYFGYKFVKKTKIWK----PEEVD 567
           I  I  F V +        D + F   Y+ +P+ ++ Y GYK   K   WK     +++D
Sbjct: 539 I-LIGQFWVAIAPIGEGKLDAQAFFENYLAMPILIVLYVGYKMWNKD--WKLFIRADKID 595

Query: 568 LYTFKAAIDEEEEQGKIADAERRERLKN 595
           L + +   DEE    K  D E RERL+ 
Sbjct: 596 LTSHRQIFDEELI--KQEDDEYRERLRT 621

>KAFR0D04140 Chr4 (821341..823254) [1914 bp, 637 aa] {ON} 
          Length = 637

 Score =  261 bits (667), Expect = 5e-78,   Method: Compositional matrix adjust.
 Identities = 165/559 (29%), Positives = 278/559 (49%), Gaps = 25/559 (4%)

Query: 47  KKDGLDINDMDNLSTVSSRLEDSEKQDDYMDDGKDEHTRLRKDLKARHISMIAXXXXXXX 106
           + D     D++N   + S L  S+ +  +     D+   L+K ++ RH+ M++       
Sbjct: 82  EDDEETAEDLEN--ELVSTLSPSKSKQLHGQKNGDDDAHLQKSIRPRHVLMMSLGTGIGT 139

Query: 107 XXXXXXXXXXYTAGPMSMFIAYAFVGVLVFFTMAALGEMA-SYIPLDG-FTSYASRYCDP 164
                       AGP ++ I Y  +G  ++  + A GEMA  Y  L G F +Y S   D 
Sbjct: 140 GLLVGNGSALSKAGPGALVIGYGIMGSCLYCIIQACGEMAVCYSGLPGNFNAYPSFLVDE 199

Query: 165 ALGFAVGYAYLCKYLILPPNQLTAAALVIQYWLDREQVNPGVWITIFLVIIVAMNFIGVK 224
            + F V + Y  ++L + P +L  A++ I YW  +  VN  V++ IF V+I  +N  G K
Sbjct: 200 GMAFGVAWVYCLQWLCVMPLELVTASMTIDYWTTK--VNSDVFVVIFFVLITLINTFGAK 257

Query: 225 FFGEFEFWLSTFKVIVMIGLIILLFVIMLGGGPTHDRLGFRFYDHPGAFKPYSKSIDGSK 284
            + E EF+ ++ KV++M G  IL  VI  GG      +G +++ +PGAF+   KSID   
Sbjct: 258 GYAEAEFFFNSCKVLMMAGFFILAIVINTGGAGNDGYIGAKYWHNPGAFRG-DKSID--- 313

Query: 285 GKXXXXXXXXXXXXXXXXGIELTGIVAAEAANPRKSIPKAIKLTMYRIIVFYLVTIFLLG 344
            +                  E   I A+E +NPR++IP A K  +YRI+  +L +I L+G
Sbjct: 314 -RFKDVMSTFTTAAFAFGASEFIAIGASEQSNPRRAIPSAAKTMIYRILFIFLTSITLVG 372

Query: 345 MCVAYDDPLLXXXXXXXXXXXXXPYVVAIINSGIKALPHIFNACVLMFVFSACNSDLYVA 404
             V YD   L             PYV+A+ + G++ +PH  NA +L+ V S  NS  Y +
Sbjct: 373 FLVPYDSTELLGSGGSASSQAS-PYVIAVASHGVRVVPHFINAVILLSVLSVANSAYYSS 431

Query: 405 SRTLYGLAIDNKAPKIFAVTNRWGVPYYSLLMSSCFCLLAYMSVSSGSAKIFNYFVNVVS 464
            R LY LA    APK F   +R G P  ++L+++ F ++A+ S S     +F + +++  
Sbjct: 432 CRILYSLAQQGYAPKWFEYIDREGRPARAMLVTTIFGVIAFCSCSDKEEDVFAWLLSIAG 491

Query: 465 IFGLLSWISILITYLCFFRAVKAQNVDRSRFAYRAPFQPYGSYFTLAFCILIAFIKNFTV 524
           +  L +W +I ++++ F RA+K Q        +++    +GS +  A  +++A I  F V
Sbjct: 492 LSQLFTWTAICLSHIRFRRAMKVQGRSVDEIGFKSQVGVWGSGYA-AIMMILALIAEFWV 550

Query: 525 FL----NHHFDYKNFITGYIGIPVFVISYFGYKFVKKTKIWK----PEEVDLYTFKAAID 576
            +      H D +NF   Y+ +P+ ++ YFGYK  KK   WK     +++DL + +   D
Sbjct: 551 SIAPIGEDHLDAQNFFENYLAMPILIVLYFGYKIYKKD--WKLFIRAKDIDLISHRTIFD 608

Query: 577 EEEEQGKIADAERRERLKN 595
            E  + +  + E +E+L+N
Sbjct: 609 GELVRQE--EEEYKEKLRN 625

>KAFR0D04130 Chr4 (818573..820507) [1935 bp, 644 aa] {ON} 
          Length = 644

 Score =  260 bits (664), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 160/531 (30%), Positives = 267/531 (50%), Gaps = 22/531 (4%)

Query: 58  NLSTVSSRLEDSEKQDDYMDDGKDEHTRLRKDLKARHISMIAXXXXXXXXXXXXXXXXXY 117
            L+T  S L  + K+ D     K+E   LRK ++ RH+ M +                 +
Sbjct: 99  ELTTTLSPLSAAIKEHDVAITSKEEDAHLRKSIQPRHVLMSSLATGVGTGLLVGNGSALH 158

Query: 118 TAGPMSMFIAYAFVGVLVFFTMAALGEMA-SYIPLDG-FTSYASRYCDPALGFAVGYAYL 175
            AGP  + I YA +G  ++  + A GEMA SY  L G F +Y +   D   GFAV + Y 
Sbjct: 159 KAGPAGLVIGYAIMGTCLYCIIQACGEMAVSYSNLPGNFNAYPTFLVDEGFGFAVAWVYC 218

Query: 176 CKYLILPPNQLTAAALVIQYWLDREQVNPGVWITIFLVIIVAMNFIGVKFFGEFEFWLST 235
            ++L + P +L  A++ I YW  +  VN  +++ IF V+I+ +N  G K + E +F+ +T
Sbjct: 219 IQWLCVMPLELVTASMTIDYWTTK--VNNDIFVVIFYVLIILINVFGAKGYAEADFFFNT 276

Query: 236 FKVIVMIGLIILLFVIMLGGGPTHDRLGFRFYDHPGAFKPYSKSIDGSKGKXXXXXXXXX 295
            KV+++ G  IL  +I  GG  T   +G +++  PGAF+   +SID    +         
Sbjct: 277 CKVLMITGFFILAIIINAGGAGTSGYIGAKYWHDPGAFRG-DRSID----RFKDVMATFT 331

Query: 296 XXXXXXXGIELTGIVAAEAANPRKSIPKAIKLTMYRIIVFYLVTIFLLGMCVAYDDPLLX 355
                    E   I A+E +NPR++IP A K+ +YRI+  +L +I L+G  V YD   L 
Sbjct: 332 TAAFAFGASEFIAIGASEQSNPRRAIPSAAKIMIYRILFIFLSSIALVGFLVPYDSSELM 391

Query: 356 XXXXXXXXXXXXPYVVAIINSGIKALPHIFNACVLMFVFSACNSDLYVASRTLYGLAIDN 415
                       PYV+AI + G++ +PH  NA +L+ V S  NS  Y + R L+ L+   
Sbjct: 392 GSGSGGTKAS--PYVLAISSHGVRVVPHFINAVILLAVLSVSNSAFYSSCRILFSLSQQG 449

Query: 416 KAPKIFAVTNRWGVPYYSLLMSSCFCLLAYMSVSSGSAKIFNYFVNVVSIFGLLSWISIL 475
            AP+ F   +R G P  ++++S  F ++A+ + SS   ++F + + +  +  + +W++I 
Sbjct: 450 YAPQWFNYIDREGRPARAMIISILFGIIAFCACSSKEEEVFTWLLAISGLSQIFTWMAIC 509

Query: 476 ITYLCFFRAVKAQNVDRSRFAYRAPFQPYGSYFTLAFCILIAFIKNFTVFL----NHHFD 531
           ++++ F RA+  Q    S   +R+    +GS +  A  + +A I  F V +      H D
Sbjct: 510 LSHIRFRRAMHVQGRSISELGFRSQLGVWGSVYA-ATMLFLALIAEFWVSIAPIGEDHLD 568

Query: 532 YKNFITGYIGIPVFVISYFGYKFVKKTKIWK----PEEVDLYTFKAAIDEE 578
            K+F   Y+ +P+ ++ YFGYK   +   WK     + +DL T +   D E
Sbjct: 569 AKSFFENYLAMPILIVFYFGYKIYNRD--WKLFIRAKNIDLITHRNIFDAE 617

>SAKL0G14014g Chr7 (1202476..1204293) [1818 bp, 605 aa] {ON} highly
           similar to uniprot|P06775 Saccharomyces cerevisiae
           YGR191W HIP1 High-affinity histidine permease also
           involved in the transport of manganese ions
          Length = 605

 Score =  259 bits (661), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 162/530 (30%), Positives = 262/530 (49%), Gaps = 29/530 (5%)

Query: 69  SEKQDDYMDDGKDEHTRLRKDLKARHISMIAXXXXXXXXXXXXXXXXXYTAGPMSMFIAY 128
           S+ +++  D   D  ++L KDL  RH+  +A                  T GP S+ +A+
Sbjct: 73  SDFENNVYDTAND--SKLNKDLSVRHLLTLAVGGAIGTGLFVNSGASLNTGGPASLIVAW 130

Query: 129 AFVGVLVFFTMAALGEMASYIPL-DGFTSYASRYCDPALGFAVGYAYLCKYLILPPNQLT 187
             V   +F  + ALGE+A+  P+  GF  Y +R+ +P+ GFAV   YL ++ +L P +L 
Sbjct: 131 VIVSTCLFTIVNALGELAAVFPVVGGFNVYITRFVEPSFGFAVNINYLAQWAVLLPLELV 190

Query: 188 AAALVIQYWLDREQVNPGVWITIFLVIIVAMNFIGVKFFGEFEFWLSTFKVIVMIGLIIL 247
           AA++ I+YW     +N   W+ IF   I   N + VK FGE EF LS  K++ +IG  IL
Sbjct: 191 AASITIRYW--NNTINSDAWVAIFYTAIFLANMLDVKSFGETEFVLSMIKILAIIGFTIL 248

Query: 248 LFVIMLGGGPTHDRLGFRFYDHPGAFKPYSKSIDGSKGKXXXXXXXXXXXXXXXXGIELT 307
             V+  GGGP+ + +G R+++ PGAF       D    +                G EL 
Sbjct: 249 GIVLACGGGPSGEYIGGRYWNDPGAFVG-----DTPGRRFKGVCAVFVTAAFSYSGTELV 303

Query: 308 GIVAAEAANPRKSIPKAIKLTMYRIIVFYLVTIFLLGMCVAYDDPLLXXXXXXXXXXXXX 367
            + AAE+ NPR ++PKA K T + I + Y+  + ++G  V Y+D  L             
Sbjct: 304 AVSAAESHNPRVTLPKASKRTFWLITLCYITVLTIIGCLVPYNDERLLNGNSSVDAAAS- 362

Query: 368 PYVVAIINSGIKALPHIFNACVLMFVFSACNSDLYVASRTLYGLAIDNKAPKIFAVTNRW 427
           P V+AI N GIK LP + NA +L+ + S  NS +Y  SR +  +A     PK     ++ 
Sbjct: 363 PLVIAIENGGIKGLPSLMNAIILIAILSVANSAVYACSRCMVAMAEIGNLPKRLNYIDKR 422

Query: 428 GVPYYSLLMSSCFCLLAYMSVSSGSAKIFNYFVNVVSIFGLLSWISILITYLCFFRAVKA 487
           G P Y++  +  F LL++++ S    ++F +   +  +  L  W SI ++++ F +A+KA
Sbjct: 423 GRPLYAIFATLIFGLLSFIAASDKQEEVFTWLSALSGLSTLFCWFSINLSHIRFRQAMKA 482

Query: 488 QNVDRSRFAYRAPFQPYGSYF--TLAFCILIA-FIKNFTVFLNHHFDYKNFITGYIGIPV 544
           Q+   +   + +    YGS++   + F +LIA F  +     +   D ++F  GY+ +P+
Sbjct: 483 QDRSLNELPFVSITGVYGSWYGCIVIFLVLIASFWTSLFPVGSDGADAESFFEGYLSLPI 542

Query: 545 FVISYFGYKFVKKTKIWK-------------PEEVDLYTFKAAIDEEEEQ 581
           F++ Y G+K  KK   W+               E+DL   K  I  E EQ
Sbjct: 543 FIVCYLGHKVYKKD--WRLYVKTKDMDLDTGRREIDLDILKQEIRLEREQ 590

>Ecym_4789 Chr4 complement(1531864..1533630) [1767 bp, 588 aa] {ON}
           similar to Ashbya gossypii AGR319W
          Length = 588

 Score =  258 bits (660), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 156/525 (29%), Positives = 263/525 (50%), Gaps = 14/525 (2%)

Query: 58  NLSTVSSRLEDSEKQDDYMDDGKDEHTRLRKDLKARHISMIAXXXXXXXXXXXXXXXXXY 117
           ++  +  + ED +  +  + +       L +DL  RH+  +A                  
Sbjct: 43  DVQVMGKKYEDMDDVEKAIFNTTKRSLNLNRDLSIRHLLTLAVGGAIGTGLFVNSGSALN 102

Query: 118 TAGPMSMFIAYAFVGVLVFFTMAALGEMASYIPL-DGFTSYASRYCDPALGFAVGYAYLC 176
             GP S+ IA+  +   +F  + ALGE+A+  P+  GF  Y +R  DP+LGFAV   YL 
Sbjct: 103 IGGPASLVIAWTIISTCLFTIVNALGELAAVFPVVGGFNVYVTRLVDPSLGFAVNINYLA 162

Query: 177 KYLILPPNQLTAAALVIQYWLDREQVNPGVWITIFLVIIVAMNFIGVKFFGEFEFWLSTF 236
           ++ +L P +L AA++ I+YW     VN   W+ +F V I   + + VK FGE EF LS  
Sbjct: 163 QWAVLLPLELVAASITIRYW--NNSVNSDAWVAVFYVCIFLASLLDVKSFGETEFILSMV 220

Query: 237 KVIVMIGLIILLFVIMLGGGPTHDRLGFRFYDHPGAFKPYSKSIDGSKGKXXXXXXXXXX 296
           K++ + G  IL  V++ GGGP +  +G ++++ PG+F   S    GS+ K          
Sbjct: 221 KILAIGGFTILGIVLICGGGPKNGYIGAKYWNDPGSFVGASP---GSQFKGLCSVFVTAA 277

Query: 297 XXXXXXGIELTGIVAAEAANPRKSIPKAIKLTMYRIIVFYLVTIFLLGMCVAYDDPLLXX 356
                 G EL G+ AAE+ANPR ++PKA K T + I + YL+ + ++G  V +DDP L  
Sbjct: 278 FSYS--GTELVGVSAAESANPRYTLPKASKRTFWLITLSYLLVLTIIGCLVRHDDPKLLS 335

Query: 357 XXXXXXXXXXXPYVVAIINSGIKALPHIFNACVLMFVFSACNSDLYVASRTLYGLAIDNK 416
                      P V+AI N GI+ LP + NA +L+ + S  NS +Y  SR +  +A    
Sbjct: 336 ASSSVDVAAS-PLVIAIENGGIQGLPSLMNAIILIAIISVANSSVYACSRCMVSMAEIGN 394

Query: 417 APKIFAVTNRWGVPYYSLLMSSCFCLLAYMSVSSGSAKIFNYFVNVVSIFGLLSWISILI 476
            P+IF   +  G P  +++ +  F LL++++ S+   +IF +   +  +  L  W++I I
Sbjct: 395 LPRIFTYIDNRGRPIVAIIFTLVFGLLSFIAASNKQEEIFVWLSALSGLSTLFCWLAINI 454

Query: 477 TYLCFFRAVKAQNVDRSRFAYRAPFQPYGSYFTLAFCILIAFIKNFTVFL---NHHFDYK 533
           +++ F RA+  Q        Y +     GS++     IL+     +T      +   D++
Sbjct: 455 SHIRFRRALNTQGYSLDELPYLSMTGVIGSWYGCVVIILVLIASFWTSLFPAGSSGADWE 514

Query: 534 NFITGYIGIPVFVISYFGYKFVKKTKIW--KPEEVDLYTFKAAID 576
           +F  GY+ +P+F+  + G+K  K+   W  +  ++D+ T +  ID
Sbjct: 515 SFFKGYLSLPIFLFCFVGHKLYKRNWSWMIRSNKIDVNTGRRMID 559

>Skud_11.275 Chr11 (496787..498595) [1809 bp, 602 aa] {ON} YKR039W
           (REAL)
          Length = 602

 Score =  258 bits (660), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 167/534 (31%), Positives = 280/534 (52%), Gaps = 19/534 (3%)

Query: 65  RLEDSEKQDDYMDDGK----DEHTRLRKDLKARHISMIAXXXXXXXXXXXXXXXXXYTAG 120
           R+E  E   +  +  K       T L+  LK RH+ MIA                  T G
Sbjct: 61  RVEPVEVDPNLTEAEKVAFVTAQTPLKHHLKNRHLQMIAIGGAIGTGLLVGSGTALRTGG 120

Query: 121 PMSMFIAYAFVGVLVFFTMAALGEMASYIPLDG-FTSYASRYCDPALGFAVGYAYLCKYL 179
           P S+ I +   G +++  + ALGE+A   P+ G FT+YA+R+ D + G+A  + Y+ ++L
Sbjct: 121 PASLLIGWGSTGTMIYSMVMALGELAVIFPISGGFTTYATRFIDESFGYANNFNYMLQWL 180

Query: 180 ILPPNQLTAAALVIQYWLDREQVNPGVWITIFLVIIVAMNFIGVKFFGEFEFWLSTFKVI 239
           ++ P ++ +A++ + +W    +   G ++ +F ++IV +N  GVK +GE EF  S  KVI
Sbjct: 181 VVLPLEIVSASITVNFWGTDPKYRDG-FVALFWLVIVIINMFGVKGYGEAEFVFSFIKVI 239

Query: 240 VMIGLIILLFVIMLGGGPTHDRLGFRFYDHPGAFKPYSKSIDGSKGKXXXXXXXXXXXXX 299
            ++G IIL  ++  GGGP    +G +++  PGAF     + D    K             
Sbjct: 240 TVVGFIILGIILNCGGGPEGGYIGGKYWHDPGAF-----AGDTPGAKFKGLCSVFVTSAF 294

Query: 300 XXXGIELTGIVAAEAANPRKSIPKAIKLTMYRIIVFYLVTIFLLGMCVAYDDPLLXXXXX 359
              G EL G+ A+E+ +PRKS+PKA K   +RI +FY++++ ++G+ V Y+DP L     
Sbjct: 295 SFAGSELVGLAASESVDPRKSVPKAAKQVFWRITLFYILSLLMVGLLVPYNDPNLIGASS 354

Query: 360 XXXXXXXXPYVVAIINSGIKALPHIFNACVLMFVFSACNSDLYVASRTLYGLAIDNKAPK 419
                   P+V+AI   GIK LP + N  +L+ V S  NS +Y  SRT+  LA     P+
Sbjct: 355 VDAAAS--PFVIAIKTHGIKGLPTVVNVVILIAVLSVGNSAIYACSRTMVALAEQRFLPQ 412

Query: 420 IFAVTNRWGVPYYSLLMSSCFCLLAYMSVSSGSAKIFNYFVNVVSIFGLLSWISILITYL 479
           IFA  +R G P   + ++S F L+A+++ S     +FN+ + +  +  L +W  I I ++
Sbjct: 413 IFAYVDRKGRPLVGIAVTSAFGLIAFVAASKKEGDVFNWLLALSGLSSLFTWGGICICHI 472

Query: 480 CFFRAVKAQNVDRSRFAYRAPFQPYGSYFTLAFCILIAFIKNFTVFL---NHHFDYKNFI 536
            F +A+ AQ  D    ++++P   +GSY+ L F ++I FI  F V L         + F 
Sbjct: 473 RFRKALTAQGRDLDELSFKSPTGVWGSYWGL-FMVVIMFIAQFYVALFPVGASPSAEGFF 531

Query: 537 TGYIGIPVFVISYFGYKFVKKT-KIWKP-EEVDLYTFKAAIDEEEEQGKIADAE 588
             Y+  P+ V  Y G+K  K+  K++ P E++D+ T +  +D E  + +IA+ +
Sbjct: 532 EAYLSFPLVVAMYLGHKIYKRNWKLFIPAEDMDIDTGRREVDLELLKQEIAEEK 585

>TDEL0C00930 Chr3 complement(147777..149564) [1788 bp, 595 aa] {ON} 
          Length = 595

 Score =  258 bits (659), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 158/503 (31%), Positives = 258/503 (51%), Gaps = 15/503 (2%)

Query: 80  KDEHTRLRKDLKARHISMIAXXXXXXXXXXXXXXXXXYTAGPMSMFIAYAFVGVLVFFTM 139
           K   + L+  LK RH+ MIA                  TAGP  + I +   G +++  +
Sbjct: 73  KTAQSPLKHHLKNRHLQMIAIGGAIGTGLFVGSGTALRTAGPAGILIGWGLTGTMIYSMV 132

Query: 140 AALGEMASYIPL-DGFTSYASRYCDPALGFAVGYAYLCKYLILPPNQLTAAALVIQYWLD 198
            A+GE+A   P+  GFT+YA+R+ D + GFA  + Y+ ++L++ P ++ AA++ + YW  
Sbjct: 133 MAVGELAVVFPVAGGFTTYATRFVDESFGFAANFIYMLQWLVVLPLEIVAASITVNYWGT 192

Query: 199 REQVNPGVWITIFLVIIVAMNFIGVKFFGEFEFWLSTFKVIVMIGLIILLFVIMLGGGPT 258
             +   G ++ +F V+IV +N  GVK +GE EF  S  KVI +IG II+  V++ GGG  
Sbjct: 193 DPKYRDG-FVALFYVVIVIINMFGVKGYGEAEFIFSFIKVITVIGFIIMAIVLICGGGKD 251

Query: 259 HDRLGFRFYDHPGAFKPYSKSIDGSKGKXXXXXXXXXXXXXXXXGIELTGIVAAEAANPR 318
           H  +G +++ +PGAF       D +  +                G EL G+  +EA  PR
Sbjct: 252 HKYIGAQYWYNPGAFVG-----DTAGQQFQGFCTVFVTAAFSFAGSELVGLAGSEAEEPR 306

Query: 319 KSIPKAIKLTMYRIIVFYLVTIFLLGMCVAYDDPLLXXXXXXXXXXXXXPYVVAIINSGI 378
           KS+P A K   +RI +FY++ + L+GM V  D P L             P+V+AI+N GI
Sbjct: 307 KSVPGAAKQVFWRITLFYILCLLLIGMLVPSDSPRLIGASSVDAAAS--PFVIAIVNHGI 364

Query: 379 KALPHIFNACVLMFVFSACNSDLYVASRTLYGLAIDNKAPKIFAVTNRWGVPYYSLLMSS 438
           K LP + N  +L+ V S  NS +Y  SRTL  LA     P I    +R G P   + +S+
Sbjct: 365 KGLPSVVNVVILIAVLSVGNSAIYSCSRTLAALADQGFLPSICGYIDRGGRPLVGIAISA 424

Query: 439 CFCLLAYMSVSSGSAKIFNYFVNVVSIFGLLSWISILITYLCFFRAVKAQNVDRSRFAYR 498
            F L+A+++ S     +FN+ + +  +  L +W  I + ++ +  A+ AQ        ++
Sbjct: 425 FFGLIAFVAQSKKEGDVFNWLMALSGLSSLFTWAGICLCHIRYRGALAAQGRSTDELPFQ 484

Query: 499 APFQPYGSYFTLAFCILIAFIKNFTVFL---NHHFDYKNFITGYIGIPVFVISYFGYKFV 555
           AP   +GSY+    CIL+ FI  F V L       +  +F   Y+   +F+  Y  +K  
Sbjct: 485 APAGVWGSYWGFFMCILM-FIAQFYVGLFPPGTKPNAYDFFLAYLSFCIFIALYAFHKIW 543

Query: 556 KKT-KIWKP-EEVDLYTFKAAID 576
           K+  K++ P +++D+ T +  +D
Sbjct: 544 KRNWKLFIPLKDLDIDTGRREVD 566

>KLLA0C01606g Chr3 complement(123485..125347) [1863 bp, 620 aa] {ON}
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508C GNP1 High-affinity glutamine permease also
           transports Leu Ser Thr Cys Met and Asn expression is
           fully dependent on Grr1p and modulated by the
           Ssy1p-Ptr3p-Ssy5p (SPS) sensor of extracellular amino
           acids
          Length = 620

 Score =  258 bits (660), Expect = 4e-77,   Method: Compositional matrix adjust.
 Identities = 167/563 (29%), Positives = 277/563 (49%), Gaps = 37/563 (6%)

Query: 60  STVSSRLEDSEKQDDYMDDG----------------KDEHTRLRKDLKARHISMIAXXXX 103
           S+V  R +DS K+ D+++                   ++   L++D+K RH+ M++    
Sbjct: 60  SSVWHRFKDSFKRADHINTNIHGNAELELNPSQSLLPEKGASLKRDIKPRHVVMMSLATG 119

Query: 104 XXXXXXXXXXXXXYTAGPMSMFIAYAFVGVLVFFTMAALGEMA-SYIPLDG-FTSYASRY 161
                         T GP  + I YA +G  ++  + A GE+A +Y  L G F +Y S  
Sbjct: 120 IGTGLLVGNGKALATGGPAGLTIGYAIMGSCLYSIIQAAGELAVAYPTLTGNFNNYPSFL 179

Query: 162 CDPALGFAVGYAYLCKYLILPPNQLTAAALVIQYWLDREQVNPGVWITIFLVIIVAMNFI 221
            DPA+ FA    Y  ++L + P ++ +AA+ I+YW     +NP VW  IF V+I+ +N  
Sbjct: 180 VDPAMCFATAALYCIQWLCVFPLEVISAAITIKYW--NTSINPNVWCVIFYVMIIGINMC 237

Query: 222 GVKFFGEFEFWLSTFKVIVMIGLIILLFVIMLGGGPTHDRLGFRFYDHPGAFKPYSKSID 281
           G   + E +F+ +T K+++  G  IL  +I  GG      +G ++++ PGAF       D
Sbjct: 238 GSAGYAEADFFFNTCKILMFAGFFILGIIINCGGAGDSVYIGGKYWNDPGAFNG-----D 292

Query: 282 GSKGKXXXXXXXXXXXXXXXXGIELTGIVAAEAANPRKSIPKAIKLTMYRIIVFYLVTIF 341
               +                  E   + A+E ANPRK+IP A K  +YRII  YL +I 
Sbjct: 293 TGISRFKAIVSTLVTAAFAFGASEAVALTASEQANPRKAIPSAAKQVLYRIIAIYLASII 352

Query: 342 LLGMCVAYDDPLLXXXXXXXXXXXXXPYVVAIINSGIKALPHIFNACVLMFVFSACNSDL 401
           L+G  V Y+ P L             PYV+A+ + G+K +P   NA +L+ V S  N   
Sbjct: 353 LVGFLVPYNSPELMGSGSSSVHSS--PYVIAVASHGVKVVPSFINAVILISVLSVGNFSF 410

Query: 402 YVASRTLYGLAIDNKAPKIFAVTNRWGVPYYSLLMSSCFCLLAYMSVSSGSAKIFNYFVN 461
           Y +SR L  L+    APK F   +R G P Y++++ +    + ++S SS    +F + + 
Sbjct: 411 YSSSRILLCLSEIGYAPKFFQYVDRQGRPLYAMIVGALVGCICFVSASSAEESVFTWLMA 470

Query: 462 VVSIFGLLSWISILITYLCFFRAVKAQNVDRSRFAYRAPFQPYGSYFTLAFCILIAFIKN 521
           V  +  L +W +I I+++ F +A++ QN       +R+    +GSY+ + F +++ FI  
Sbjct: 471 VSGLSQLFTWTNICISHVRFRKAMQVQNRSIGELGFRSQVGVWGSYYGI-FMMILVFIGQ 529

Query: 522 FTVFL-----NHHFDYKNFITGYIGIPVFVISYFGYKFVKKT-KIWKP-EEVDLYTFKAA 574
           F V L         D +NF   Y+ +PVF+  YFG+K  KK  +++ P  E+DL + +  
Sbjct: 530 FWVALFPVGGTDGADAENFFANYLAMPVFLALYFGFKIWKKDWRLYIPASEIDLISHRKI 589

Query: 575 IDEEEEQGKIADAERRERLKNSK 597
            DEE    K  D E + ++K++ 
Sbjct: 590 FDEEIL--KQEDEEYKIKMKHAS 610

>YBR068C Chr2 complement(373861..375690) [1830 bp, 609 aa] {ON}
           BAP2High-affinity leucine permease, functions as a
           branched-chain amino acid permease involved in the
           uptake of leucine, isoleucine and valine; contains 12
           predicted transmembrane domains
          Length = 609

 Score =  257 bits (656), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 165/545 (30%), Positives = 274/545 (50%), Gaps = 24/545 (4%)

Query: 63  SSRLEDSEKQDDYMDDGKDEHT---RLRKDLKARHISMIAXXXXXXXXXXXXXXXXXYTA 119
           ++R +   +    ++DG +  T   +L+K +K+RH+ M++                 +  
Sbjct: 65  TTRTKQINENTSDLEDGVESITSDSKLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLHYG 124

Query: 120 GPMSMFIAYAFVGVLVFFTMAALGEMASYIPL--DGFTSYASRYCDPALGFAVGYAYLCK 177
           GP ++ I Y  V  + +F + A GEMA   P     F +Y+S +   + GFA  + Y  +
Sbjct: 125 GPAALIIGYILVSFVTYFMIQAAGEMAVTYPTLPANFNAYSSIFISKSFGFATVWLYCFQ 184

Query: 178 YLILPPNQLTAAALVIQYWLDREQVNPGVWITIFLVIIVAMNFIGVKFFGEFEFWLSTFK 237
           +L + P +L  A++ IQ+W D+  +NP ++I IF V +V ++F GVK +GE EF  +  K
Sbjct: 185 WLTVLPLELITASMTIQFWNDK--INPDIYILIFYVFLVFIHFFGVKAYGETEFIFNCCK 242

Query: 238 VIVMIGLIILLFVIMLGGGPTHDRLGFRFYDHPGAFKPYSKSIDGSKGKXXXXXXXXXXX 297
           ++++ G IIL  VI  GG      +G  ++ +PGAF       D S G+           
Sbjct: 243 ILMIAGFIILSIVINCGGAGNDGYIGATYWHNPGAFAG-----DTSIGRFKNVCYILVTA 297

Query: 298 XXXXXGIELTGIVAAEAANPRKSIPKAIKLTMYRIIVFYLVTIFLLGMCVAYDDPLLXXX 357
                G+EL  +   E +NPRKS P A K ++YRI+V YL+T+ L+G  V Y+D  L   
Sbjct: 298 YFSFGGMELFALSVQEQSNPRKSTPVAAKRSIYRIVVIYLLTMILIGFNVPYNDDQLMGA 357

Query: 358 XXXXXXXXXXPYVVAIINSGIKALPHIFNACVLMFVFSACNSDLYVASRTLYGLAIDNKA 417
                     PYV+A    G+K +PHI NA +L+ V S  NS LY   R +  LA    A
Sbjct: 358 GGSATHAS--PYVLAASIHGVKIVPHIINAVILISVVSVANSSLYAGPRLICSLAQQGYA 415

Query: 418 PKIFAVTNRWGVPYYSLLMSSCFCLLAYMSVSSGSAKIFNYFVNVVSIFGLLSWISILIT 477
           PK     +R G P  +L++   F ++A+++ SS    +F +   +  +  L +W SI+++
Sbjct: 416 PKFLDYVDREGRPLRALIVCCVFGVIAFVAASSKEEIVFTWLAAIAGLSELFTWTSIMLS 475

Query: 478 YLCFFRAVKAQNVDRSRFAYRAPFQPYGSYFTLAFCILIAFIKNFTVFL-----NHHFDY 532
           +L F +A+K Q        Y+A    +GS + + F IL+ F+  F V L         D 
Sbjct: 476 HLRFRQAMKVQGRSLDELGYKATTGIWGSIYGVFFNILV-FVAQFWVALAPLGNGGKCDA 534

Query: 533 KNFITGYIGIPVFVISYFGYKFVKK--TKIWKPEEVDLYTFKAAIDEEEEQGKIADAERR 590
           ++F   Y+  P+++  YFGY    +  T +   +++DL   +   D E  + +  D E +
Sbjct: 535 ESFFQNYLAFPIWLAFYFGYMVYNRDFTLLNPLDKIDLDFHRRIYDPELMRQE--DEENK 592

Query: 591 ERLKN 595
           E+L+N
Sbjct: 593 EKLRN 597

>Suva_11.273 Chr11 (498611..500416) [1806 bp, 601 aa] {ON} YKR039W
           (REAL)
          Length = 601

 Score =  256 bits (655), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 167/536 (31%), Positives = 271/536 (50%), Gaps = 32/536 (5%)

Query: 65  RLEDSEKQDDYMDDGK----DEHTRLRKDLKARHISMIAXXXXXXXXXXXXXXXXXYTAG 120
           R+E  E   +  +  K       T L+  LK RH+ MIA                  T G
Sbjct: 60  RVEPVEVDPNLTEAEKVAFITAQTPLKHQLKNRHLQMIAIGGAIGTGLLVGSGKALRTGG 119

Query: 121 PMSMFIAYAFVGVLVFFTMAALGEMASYIPLDG-FTSYASRYCDPALGFAVGYAYLCKYL 179
           P S+ I +  +G +++  + ALGE+A   P+ G FT+YA+R+ D + GFA  + Y+ ++L
Sbjct: 120 PASLLIGWGSMGTMIYAMVMALGELAVVFPISGGFTTYATRFIDESFGFAANFNYMLQWL 179

Query: 180 ILPPNQLTAAALVIQYWLDREQVNPGVWITIFLVIIVAMNFIGVKFFGEFEFWLSTFKVI 239
           +  P ++ +A++ + YW    +   G ++ +F ++IV +N  GVK +GE EF  S  KVI
Sbjct: 180 VTLPLEIVSASITVNYWGTDPKYRDG-FVALFWLVIVCINMFGVKGYGEAEFVFSIIKVI 238

Query: 240 VMIGLIILLFVIMLGGGPTHDRLGFRFYDHPGAFKPYSKSIDGSKGKXXXXXXXXXXXXX 299
            +IG IIL  ++  GGGP    +G +++  PGAF     + D    K             
Sbjct: 239 TIIGFIILGIILNCGGGPEKGYIGGKYFHDPGAF-----AGDTPGAKFKGVCSVFVTAAF 293

Query: 300 XXXGIELTGIVAAEAANPRKSIPKAIKLTMYRIIVFYLVTIFLLGMCVAYDDPLLXXXXX 359
              G EL G+ A+E+ +PRKS+PKA K   +RI +FY++++ ++G+ V Y+D  L     
Sbjct: 294 SFAGSELVGLAASESVDPRKSVPKAAKQVFWRITLFYILSLLMIGLLVPYNDSRLIGASS 353

Query: 360 XXXXXXXXPYVVAIINSGIKALPHIFNACVLMFVFSACNSDLYVASRTLYGLAIDNKAPK 419
                   P+V+AI+  GIK LP + N  +L+ V S  NS ++  SRT   LA     P+
Sbjct: 354 VDAAAS--PFVIAIVTHGIKGLPSVVNVVILIAVLSVGNSAIFACSRTFVALAEQGFLPQ 411

Query: 420 IFAVTNRWGVPYYSLLMSSCFCLLAYMSVSSGSAKIFNYFVNVVSIFGLLSWISILITYL 479
           IFA  +R G P   ++++S   L+A+++ S+    +FN+ + +  +  L +W  I I ++
Sbjct: 412 IFAYVDRKGRPLVGIIITSAVGLIAFVAASNKEEDVFNWLLALSGLSSLFTWGGICICHI 471

Query: 480 CFFRAVKAQNVDRSRFAYRAPFQPYGSYFTLAFCILIAFIKNFTVFL---NHHFDYKNFI 536
            F +A+ +Q       ++++P   +GSY+ L F I+I FI  F V L   N     + F 
Sbjct: 472 RFRKALTSQGRSVDELSFKSPTGVWGSYWGL-FMIVIMFIAQFYVALFPVNGSPSAEGFF 530

Query: 537 TGYIGIPVFVISYFGYKFVKKTKIWK-------------PEEVDLYTFKAAIDEEE 579
             Y+  P+ +  Y G+K  K+   WK               EVDL   K  I EE+
Sbjct: 531 EAYLSFPLVLAMYIGHKIYKRN--WKLLIPAGEMDIDSGRREVDLELLKQEIAEEK 584

>Suva_2.688 Chr2 complement(1219181..1221166) [1986 bp, 661 aa] {ON}
           YDR508C (REAL)
          Length = 661

 Score =  257 bits (656), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 166/554 (29%), Positives = 277/554 (50%), Gaps = 30/554 (5%)

Query: 52  DINDMDNLSTVSSRLEDSEKQDDYMDDGKDEHTRLRKDLKARHISMIAXXXXXXXXXXXX 111
           ++N   +  T S   + S++QD   ++       L+K +K RHI M++            
Sbjct: 116 ELNPKGSFVTESGIKQPSQEQDQNQEN-------LKKTIKPRHIVMMSLGTGIGTGLLVG 168

Query: 112 XXXXXYTAGPMSMFIAYAFVGVLVFFTMAALGEMASYIP--LDGFTSYASRYCDPALGFA 169
                  AGP  + I YA +G  ++  + A GE+A      + GF +Y S   DPALGF+
Sbjct: 169 NSKVLNNAGPAGLVIGYAIMGSCIYCIIQACGELAVIYSDLIGGFNTYPSFLVDPALGFS 228

Query: 170 VGYAYLCKYLILPPNQLTAAALVIQYWLDREQVNPGVWITIFLVIIVAMNFIGVKFFGEF 229
           V + Y  ++L + P +L  A++ I+YW  +  V+P V++ IF V+I+ +N  G K + E 
Sbjct: 229 VAWVYCLQWLCVCPLELVTASMTIKYWTVK--VDPDVFVVIFYVLIIVINVFGAKGYAEA 286

Query: 230 EFWLSTFKVIVMIGLIILLFVIMLGGGPTHDRLGFRFYDHPGAFKPYSKSIDGSKGKXXX 289
           +F+ +  K++++IG  IL  +I  GG  T   +G R++ +PGAF+  +  I   KG    
Sbjct: 287 DFFFNCCKILMIIGFFILAIIIDCGGAGTDGYIGSRYWHNPGAFRG-NTGIQRFKGVVAT 345

Query: 290 XXXXXXXXXXXXXGIELTGIVAAEAANPRKSIPKAIKLTMYRIIVFYLVTIFLLGMCVAY 349
                          E   + A+E +NPRK+IP A K  +YRI+  +L ++ L+G  V Y
Sbjct: 346 FVTAAFAFGMS----EQLAMTASEQSNPRKAIPSAAKKMIYRILFVFLGSLVLVGFLVPY 401

Query: 350 -DDPLLXXXXXXXXXXXXXPYVVAIINSGIKALPHIFNACVLMFVFSACNSDLYVASRTL 408
             D LL             PYV+A+ + G++ +PH  NA +L+ V S  N   Y +SR L
Sbjct: 402 TSDQLLGASGSATKAS---PYVIAVASHGVRVVPHFINAVILLSVLSVANGAFYSSSRIL 458

Query: 409 YGLAIDNKAPKIFAVTNRWGVPYYSLLMSSCFCLLAYMSVSSGSAKIFNYFVNVVSIFGL 468
             LA    APK F   +R G P  ++L+SS F ++A+ + S     +F + + +  +  L
Sbjct: 459 MSLAKQGNAPKCFDYIDREGRPAVAMLVSSIFGIIAFCASSPKEEDVFTWLLAISGLSQL 518

Query: 469 LSWISILITYLCFFRAVKAQNVDRSRFAYRAPFQPYGSYFTLAFCILIAFIKNFTVFLN- 527
            +WI+I ++++ F RA+K Q        Y++    +GS + +   +L A I  F V ++ 
Sbjct: 519 FTWITICLSHIRFRRAMKVQGRSLGEVGYKSQVGIWGSMYAIVMMVL-ALIAQFWVAISP 577

Query: 528 ----HHFDYKNFITGYIGIPVFVISYFGYKFVKK--TKIWKPEEVDLYTFKAAIDEEEEQ 581
                    ++F   Y+ +P+ +  Y  YK  KK  T     +++DL T +   DEE   
Sbjct: 578 IGGGGKLSAQSFFENYLAMPILIALYVFYKVWKKDWTLFIPADKIDLVTDRQIFDEELL- 636

Query: 582 GKIADAERRERLKN 595
            K  D E +E+L+N
Sbjct: 637 -KQEDEEYQEKLRN 649

>Skud_2.260 Chr2 complement(467322..469118) [1797 bp, 598 aa] {ON}
           YBR132C (REAL)
          Length = 598

 Score =  255 bits (652), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 156/546 (28%), Positives = 264/546 (48%), Gaps = 19/546 (3%)

Query: 50  GLDINDMDNLSTVSS----RLEDSEKQDDYMDDGKDEH----TRLRKDLKARHISMIAXX 101
           G   + + ++ST+       + + E  + ++D+    H    T  R+ L+ RH+ +IA  
Sbjct: 42  GPSESSLAHISTIPEGGDVHVHEHEDGESFIDEDSRTHLLFSTETRRKLENRHVQLIAIS 101

Query: 102 XXXXXXXXXXXXXXXYTAGPMSMFIAYAFVGVLVFFTMAALGEMASYIPLDG-FTSYASR 160
                          Y  GP S+ +A+A   V +     +  EM  + P+   F   A++
Sbjct: 102 GVIGTALFVAIGKALYRGGPASLLLAFALWCVPILCITVSTAEMVCFFPVSSPFLRLATK 161

Query: 161 YCDPALGFAVGYAYLCKYLILPPNQLTAAALVIQYWLDREQVNPGVWITIFLVIIVAMNF 220
             D +      + +     +  P ++ +   +I YW  R+  + G+ + + +V+ + ++ 
Sbjct: 162 CVDDSFAVMASWNFWFLECVQIPFEIVSVNTIIHYW--RDDYSAGIPLAVQVVLYLLISI 219

Query: 221 IGVKFFGEFEFWLSTFKVIVMIGLIILLFVIMLGGGPTHDRLGFRFYDHPGAFKPY---S 277
             VK++GE EFWL++FK+I+ +GL I  F+ MLGG P HDR GFR Y     FK Y    
Sbjct: 220 CAVKYYGEMEFWLASFKIILALGLFIFTFITMLGGNPKHDRYGFRNYGE-SPFKKYFPDG 278

Query: 278 KSIDGSKGKXXXXXXXXXXXXXXXXGIELTGIVAAEAANPRKSIPKAIKLTMYRIIVFYL 337
           K +  S G                 G E   ++A E   PRK +PKA K    R+   +L
Sbjct: 279 KDVGKSSGYFQGFLACLIQASFTIAGGEYISMLAGEVKRPRKVLPKAFKQVFVRLTFLFL 338

Query: 338 VTIFLLGMCVAYDDP-LLXXXXXXXXXXXXXPYVVAIINSGIKALPHIFNACVLMFVFSA 396
            +   +G+  + +DP L              PYV+A+ N  I+ LP I N  ++   FSA
Sbjct: 339 GSCLCVGIVCSPNDPDLTAAINEARPGAGSSPYVIAMNNLKIRILPDIVNIALITAAFSA 398

Query: 397 CNSDLYVASRTLYGLAIDNKAPKIFAVTNRWGVPYYSLLMSSCFCLLAYMSVSSGSAKIF 456
            N+  Y +SRT YG+A+D  APK+F   NR GVP YS+ +S  + L++ + ++S SA + 
Sbjct: 399 GNAYTYCSSRTFYGMALDGYAPKLFTRCNRHGVPIYSVAISLVWALVSLLQLNSNSAVVL 458

Query: 457 NYFVNVVSIFGLLSWISILITYLCFFRAVKAQNVDRSRFAYRAPFQPYGSYFTLAFCILI 516
           N+ +N+++   L++++ + ITYL F RA   Q     +  +R+  QPY +   L  C  +
Sbjct: 459 NWLINLITASQLINFVVLCITYLFFRRAYHVQQDSLPKLPFRSWGQPYTAIIGLVSCSAM 518

Query: 517 AFIKNFTVFLNHHFDYKNFITGYIGIPVFVISYFGYKFV---KKTKIWKPEEVDLYTFKA 573
             I+ +TVF    +  ++F+  Y+ + + +  Y GYKF+    K K   P E+D      
Sbjct: 519 ILIQGYTVFFPKLWSTQDFLFSYLMVFINIGIYVGYKFIWKRGKDKFKNPHEIDFSKELV 578

Query: 574 AIDEEE 579
            I+  E
Sbjct: 579 EIENHE 584

>NCAS0B07900 Chr2 (1500061..1501920) [1860 bp, 619 aa] {ON}
           Anc_1.244
          Length = 619

 Score =  256 bits (653), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 174/546 (31%), Positives = 282/546 (51%), Gaps = 26/546 (4%)

Query: 60  STVSSRLEDSEK--QDDYMDDGKDEHTR---------LRKDLKARHISMIAXXXXXXXXX 108
           +T   + +DS K  +D  +D    E  R         L+  LK R  +MIA         
Sbjct: 66  TTRWQKFKDSFKKAEDVELDPNLTEAERIAQATAKAPLQHTLKGRQQTMIAIGGAIGSGL 125

Query: 109 XXXXXXXXYTAGPMSMFIAYAFVGVLVFFTMAALGEMASYIPL-DGFTSYASRYCDPALG 167
                    T GP  + I +     +++  + ALGE+A   P+  GFT+YA+R+ D + G
Sbjct: 126 FVGSSTALRTGGPAGLIIGWGLTSTMIYSMVMALGELAVVFPVAGGFTTYATRFVDESFG 185

Query: 168 FAVGYAYLCKYLILPPNQLTAAALVIQYWLDREQVNPGVWITIFLVIIVAMNFIGVKFFG 227
           +A  + Y  ++L++ P ++ +A++ + YW    +   G ++ +F ++IV +N  GVK FG
Sbjct: 186 YANNFNYALQWLVVLPLEIVSASITVNYWGTPTRYRDG-FVALFWLVIVIINMFGVKGFG 244

Query: 228 EFEFWLSTFKVIVMIGLIILLFVIMLGGGPTHDRLGFRFYDHPGAFKPYSKSIDGSKGKX 287
           E EF  S  KV  +IG IIL  V++ GGGP    +G +++  PGAF  +     GS  + 
Sbjct: 245 EAEFVFSIIKVTTVIGFIILGIVLVCGGGPKGGFVGAKYWHDPGAFVGH-----GSGAQF 299

Query: 288 XXXXXXXXXXXXXXXGIELTGIVAAEAANPRKSIPKAIKLTMYRIIVFYLVTIFLLGMCV 347
                          G EL GI AAEAANPRKSIP A K  ++RI++FY+ T+ ++G+ V
Sbjct: 300 KGVCSVFVTAAFSFAGSELIGITAAEAANPRKSIPGAAKQVVWRIVLFYMGTLTMIGLLV 359

Query: 348 AYDDPLLXXXXXXXXXXXXXPYVVAIINSGIKALPHIFNACVLMFVFSACNSDLYVASRT 407
            Y+D  L             P+V+AI+  GIK LP + N  +L+ V S  NS ++  SRT
Sbjct: 360 PYNDKRLIGASSVDAAAS--PFVIAIVTHGIKGLPSVINVVILIAVLSVGNSAIFACSRT 417

Query: 408 LYGLAIDNKAPKIFAVTNRWGVPYYSLLMSSCFCLLAYMSVSSGSAKIFNYFVNVVSIFG 467
           +  L+     PK+F   +R G P   + ++S F LLA+++ S    ++FN+ + +  +  
Sbjct: 418 IAALSDQGFLPKVFGYIDRSGRPLVGIAITSTFGLLAFVAASKKEGEVFNWLLALSGLSS 477

Query: 468 LLSWISILITYLCFFRAVKAQNVDRSRFAYRAPFQPYGSYFTLAFCILIAFIKNFTVFL- 526
           L +W  I + ++ F  A+KAQ  D +   + +P    GSY+ L F I++ FI  F V L 
Sbjct: 478 LFTWGGICLCHIRFRMALKAQGRDTNELTFVSPAGVAGSYWGL-FMIVLMFIAQFYVALF 536

Query: 527 --NHHFDYKNFITGYIGIPVFVISYFGYKFVKKT-KIWKP-EEVDLYTFKAAIDEEEEQG 582
                 D + F   Y+  P+ V +YFG+K  K+  K++ P E++D+ T +   D E  + 
Sbjct: 537 PPGGKPDAEVFFQSYLSFPIVVATYFGHKIYKRNWKLFIPLEDMDIDTGRRETDMELLKQ 596

Query: 583 KIADAE 588
           +I + +
Sbjct: 597 EIMEEK 602

>KLLA0A06886g Chr1 complement(621646..623409) [1764 bp, 587 aa] {ON}
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039W GAP1 General amino acid permease localization to
           the plasma membrane is regulated by nitrogen source
          Length = 587

 Score =  254 bits (650), Expect = 5e-76,   Method: Compositional matrix adjust.
 Identities = 168/539 (31%), Positives = 279/539 (51%), Gaps = 29/539 (5%)

Query: 63  SSRLEDSEKQDDYMDDGKD-----EHTRLRKDLKARHISMIAXXXXXXXXXXXXXXXXXY 117
           S +  D++  D  + D +       +  L++ LK+RH+ MIA                  
Sbjct: 48  SFKRADTQDLDPNLTDAEKMAILTANAPLKRTLKSRHLQMIAIGGAIGTGLFVGSGKALA 107

Query: 118 TAGPMSMFIAYAFVGVLVFFTMAALGEMASYIPL-DGFTSYASRYCDPALGFAVGYAYLC 176
           TAGP  + I +A  G +++  + A+GE+A   P+  GFT+YASR+ D + GFA    Y+ 
Sbjct: 108 TAGPAGILIGWALTGTMIYCMVMAMGELAVTFPIAGGFTTYASRFVDESFGFAFNTIYML 167

Query: 177 KYLILPPNQLTAAALVIQYWLDREQVNPGVWITIFLVIIVAMNFIGVKFFGEFEFWLSTF 236
           ++L++ P ++ AA++ + YW   ++   G ++ +F V+IVA+NF GVK +GE EF  S  
Sbjct: 168 QWLVVLPLEIVAASITVNYWGTPDKYRDG-FVALFYVVIVAINFFGVKGYGEAEFIFSFI 226

Query: 237 KVIVMIGLIILLFVIMLGGGPTHDRLGFRFYDHPGAFKPYSKSIDGSKGKXXXXXXXXXX 296
           KVI +IG IIL  +++ GGGP    +G R + +PGAF       +G KG           
Sbjct: 227 KVITVIGYIILGVILVCGGGPQGGYIGGRLWHNPGAFA------NGFKG----VCSVFVT 276

Query: 297 XXXXXXGIELTGIVAAEAANPRKSIPKAIKLTMYRIIVFYLVTIFLLGMCVAYDDPLLXX 356
                 G EL G+ AAE ANPRKS+P A K   +RI +FY++ + ++G+ V Y    L  
Sbjct: 277 AAFSFAGSELVGLAAAETANPRKSLPSAAKQVFWRITLFYILALLMVGLLVPYTSDRLIG 336

Query: 357 XXXXXXXXXXXPYVVAIINSGIKALPHIFNACVLMFVFSACNSDLYVASRTLYGLAIDNK 416
                      P+V++I N+GIK LP + N  +L+ V S  NS ++  SR++  LA    
Sbjct: 337 QSSVDAAAS--PFVISIQNAGIKGLPSVINVVILIAVLSVGNSAVFACSRSMAALANQGS 394

Query: 417 APKIFAVTNRWGVPYYSLLMSSCFCLLAYMSVSSGSAKIFNYFVNVVSIFGLLSWISILI 476
            PKIF   +R G P   ++++  F LL++++ S    ++F++ + +  +  L +W  I++
Sbjct: 395 LPKIFGYIDRTGRPLVGIIVTCVFGLLSFIAASPKEGEVFDWLLALSGLSSLFTWGGIML 454

Query: 477 TYLCFFRAVKAQNVDRSRFAYRAPFQPYGSYFTLAFCILIAFIKNFTVFLNHHFDYKN-- 534
            ++   RA+ AQN   +  ++ AP   +GS +     ILI  +  F + L    D  +  
Sbjct: 455 CHIRVRRALAAQNRTTAELSFTAPTGVWGSVYGFVLIILI-LMAQFWIALFPIGDKPSAS 513

Query: 535 -FITGYIGIPVFVISYFGYKFVKKTKIWK----PEEVDLYTFKAAIDEEEEQGKIADAE 588
            F   Y+  P+ +  Y G+K  KK   WK     + +D+ T +   D E  + +IA+ +
Sbjct: 514 AFFEAYLSFPILIAFYIGHKIWKKN--WKLFIRAKNIDIDTGRRETDIEALKQEIAEEK 570

>TPHA0E03660 Chr5 (775232..777175) [1944 bp, 647 aa] {ON} Anc_1.50
           YDR508C
          Length = 647

 Score =  256 bits (653), Expect = 7e-76,   Method: Compositional matrix adjust.
 Identities = 163/524 (31%), Positives = 262/524 (50%), Gaps = 22/524 (4%)

Query: 81  DEHTRLRKDLKARHISMIAXXXXXXXXXXXXXXXXXYTAGPMSMFIAYAFVGVLVFFTMA 140
           +++  L++ ++ RH+ MI+                   AGP  + I Y+ +G +++  + 
Sbjct: 125 NDNKALKQTIRPRHVVMISLGTGIGTGLLVGNGTALKNAGPAGLVIGYSIMGSIIYCIIQ 184

Query: 141 ALGEMA---SYIPLDGFTSYASRYCDPALGFAVGYAYLCKYLILPPNQLTAAALVIQYWL 197
           A GEMA   S +P  G+  Y S   +   GFA+ + Y  ++L + P +L  A+L I+YW 
Sbjct: 185 ATGEMAIAYSNLP-GGYNVYPSFLVEKGFGFAIAWVYCIQWLTVCPLELVTASLTIKYW- 242

Query: 198 DREQVNPGVWITIFLVIIVAMNFIGVKFFGEFEFWLSTFKVIVMIGLIILLFVIMLGGGP 257
               VN  +++ IF  +I+ +N  G K + E EF+ +  KV++MIG  IL   I  GG  
Sbjct: 243 -TTSVNSDIFVAIFYALIIIINVFGAKGYAEAEFFCNCCKVLMMIGFFILSITITAGGAG 301

Query: 258 THDRLGFRFYDHPGAFKPYSKSIDGSKGKXXXXXXXXXXXXXXXXGIELTGIVAAEAANP 317
               LG  ++  PGAF+  S SID  KG                 G E   + AAE +NP
Sbjct: 302 NDGYLGGLYWHTPGAFRGDS-SIDHFKG----ICGTLVTAAFAYGGTEFLALTAAEQSNP 356

Query: 318 RKSIPKAIKLTMYRIIVFYLVTIFLLGMCVAYDDPLLXXXXXXXXXXXXXPYVVAIINSG 377
           R +IP A K  +YRII  YL++I ++G  V +D   L             PYV+A    G
Sbjct: 357 RAAIPSAAKKVLYRIICVYLISILMIGFLVPFDSTRLLGSDGSATSAS--PYVLAASLHG 414

Query: 378 IKALPHIFNACVLMFVFSACNSDLYVASRTLYGLAIDNKAPKIFAVTNRWGVPYYSLLMS 437
           ++ +PH  NA +L+ V S  NS  Y +SR L  LA    APK F   +R G P  ++LMS
Sbjct: 415 VRVVPHFINAVILISVLSVGNSAFYSSSRLLMSLARQGYAPKWFDYIDREGRPARAMLMS 474

Query: 438 SCFCLLAYMSVSSGSAKIFNYFVNVVSIFGLLSWISILITYLCFFRAVKAQNVDRSRFAY 497
           + F ++A+ + S    ++F + + +  +  L +W +I ++++ F  A+K Q        Y
Sbjct: 475 ALFGVIAFCAASPKETEVFTWLLAISGLSQLFTWCAICLSHIRFRTAMKVQGRSLGEVGY 534

Query: 498 RAPFQPYGSYFTLAFCILIAFIKNFTVFL----NHHFDYKNFITGYIGIPVFVISYFGYK 553
            A    +GS++ L F + + +I  F V +    +     +NF   Y+ +P+ ++ Y GYK
Sbjct: 535 LAQTGVWGSWYAL-FMMFLIYIAQFWVAIAPIGSGELSAQNFFENYLAMPILIVLYLGYK 593

Query: 554 FVKK--TKIWKPEEVDLYTFKAAIDEEEEQGKIADAERRERLKN 595
              K  T + K E++DL + +   DE+    K  D E R+RLKN
Sbjct: 594 IYYKDWTLLIKAEDIDLQSHRQIFDEDLL--KEEDFEYRQRLKN 635

>AGR040C Chr7 complement(782283..784004) [1722 bp, 573 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR069C
           (TAT1)
          Length = 573

 Score =  254 bits (648), Expect = 8e-76,   Method: Compositional matrix adjust.
 Identities = 170/527 (32%), Positives = 268/527 (50%), Gaps = 28/527 (5%)

Query: 78  DGKDEHT-RLRKDLKARHISMIAXXXXXXXXXXXXXXXXXYTAGPMSMFIAYAFVGVLVF 136
           D +D  T +++K +K RH+ MI                    AGP  + + Y     +++
Sbjct: 56  DAEDGTTAKMKKTIKTRHLLMITLGTGIGTGLLVGNGSALAKAGPAGLILGYVVSSAMLY 115

Query: 137 FTMAALGEMA-SYIPLDG-FTSYASRYCDPALGFAVGYAYLCKYLILPPNQLTAAALVIQ 194
             + A GE+   Y  + G +T+Y+S   DPA+GF+V + Y  +++ + P QL  AA++IQ
Sbjct: 116 LIVEAAGELGICYSGMTGNYTAYSSLLVDPAMGFSVSWVYCIQWMTVFPLQLVTAAMIIQ 175

Query: 195 YWLDREQVNPGVWITIFLVIIVAMNFIGVKFFGEFEFWLSTFKVIVMIGLIILLFVIMLG 254
           YW D   +NP +++ I   +IV +N  G K + E EF+ +  KV+++IG +IL  VI  G
Sbjct: 176 YWTD---INPDIFVAIIYAVIVFINLFGAKGYAEAEFFFNLCKVLMIIGFVILGVVINCG 232

Query: 255 GGPTHDRLGFRFYDHPGAFKPYSKSIDGSKGKXXXXXXXXXXXXXXXXGIELTGIVAAEA 314
           G  T   +G +++  P  F      ++G KG                 GIE+  + A+E 
Sbjct: 233 GAGTSGYIGDKYWHEPRPF------MNGFKG----LCFVFCYAAFAYGGIEVMVLSASEQ 282

Query: 315 ANPRKSIPKAIKLTMYRIIVFYLVTIFLLGMCVAYDDPLLXXXXXXXXXXXXXPYVVAII 374
            NPRKSI  A K  +YRI++ YL+T  ++   V  D P L             P V+A+ 
Sbjct: 283 ENPRKSISSACKKVIYRIVLIYLLTTVIVCFLVPADHPSLASEGSRAS-----PLVIAVS 337

Query: 375 NSGIKALPHIFNACVLMFVFSACNSDLYVASRTLYGLAIDNKAPKIFAVTNRWGVPYYSL 434
             G+K +PHI NA +L+ V S  NS LY A R L  LA    APKIF   +R G P  + 
Sbjct: 338 FHGVKIVPHIINAVILIAVVSVGNSSLYSAPRLLLSLAEQGYAPKIFTYIDRQGRPLPAF 397

Query: 435 LMSSCFCLLAYMSVSSGSAKIFNYFVNVVSIFGLLSWISILITYLCFFRAVKAQNVDRSR 494
            ++  F LLA+++ S     +F + + +  +  +  W+SI I+++ F  A+KAQ      
Sbjct: 398 FVAMVFGLLAFLAASPAQDDVFGWLLAISGLSQMFIWMSICISHIRFRDAMKAQGRSMGE 457

Query: 495 FAYRAPFQPYGSYFTL--AFCILIA-FIKNFTVFLNHHFDYKNFITGYIGIPVFVISYFG 551
             Y+A    +GS+  +  AF ILIA F    +       D ++F   Y+  P+ +++YFG
Sbjct: 458 VGYKARTGYWGSWIAVVTAFLILIAQFWVAISPVETKGVDARSFFQSYLAFPILLLAYFG 517

Query: 552 YK-FVKKTKIWKP-EEVDLYTFKAAIDEEEEQGKIADAERRERLKNS 596
           YK + K  +I  P  EVDL + +   DE+E   K  D E + +LK+S
Sbjct: 518 YKIYHKDWRICIPASEVDLISHRQVFDEDEL--KQEDLEWKLKLKSS 562

>Kpol_526.10 s526 complement(18362..20104) [1743 bp, 580 aa] {ON}
           complement(18362..20104) [1743 nt, 581 aa]
          Length = 580

 Score =  252 bits (644), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 163/543 (30%), Positives = 276/543 (50%), Gaps = 20/543 (3%)

Query: 48  KDGLDINDMDNLSTVSSRLEDSEKQDDYMDDGKD--EHTRLRKDLKARHISMIAXXXXXX 105
           +D LD +D  +L++ ++++E+ E     +D   +    T+  + L  RH+ +IA      
Sbjct: 33  EDWLDRSD-SSLTSNTTQIEEEE-----VDSTTNLIYSTKTHRKLLNRHVQLIAISGVIG 86

Query: 106 XXXXXXXXXXXYTAGPMSMFIAYAFVGVLVFFTMAALGEMASYIPLDG-FTSYASRYCDP 164
                      Y  GP  + IA+A   + +     +  EM S++P+   F   AS+  D 
Sbjct: 87  TALFVAIGKALYHGGPAFLLIAFALWCIPILCITVSTAEMVSFLPVASPFLRLASKCADE 146

Query: 165 ALGFAVGYAYLCKYLILPPNQLTAAALVIQYWLDREQVNPGVWITIFLVIIVAMNFIGVK 224
           +L     + +     +  P ++ +   +I YW  R+  N  + + + +V+ + ++   VK
Sbjct: 147 SLAVTASWNFWFLECVQIPFEIVSVNTIIHYW--RDDYNAAIPLVVQVVLYLFISIATVK 204

Query: 225 FFGEFEFWLSTFKVIVMIGLIILLFVIMLGGGPTHDRLGFRFYDHPGAFKPY--SKSIDG 282
           ++GE EFWL++FK+I+ IGL     V MLGG P HDR GFR++     FK Y    + +G
Sbjct: 205 YYGEMEFWLASFKIILAIGLFFFTLVTMLGGNPKHDRYGFRYWGEE-PFKKYYPDNNTNG 263

Query: 283 --SKGKXXXXXXXXXXXXXXXXGIELTGIVAAEAANPRKSIPKAIKLTMYRIIVFYLVTI 340
             S G                 G E   ++A E   PRK +PKA K   +R+ + +L T 
Sbjct: 264 TDSLGYFQGFLTCLIQAAFTIAGGEYISMLAGEIKLPRKVLPKAFKQVFWRLTIIFLGTC 323

Query: 341 FLLGMCVAYDDP-LLXXXXXXXXXXXXXPYVVAIINSGIKALPHIFNACVLMFVFSACNS 399
             LG+  + +DP L              P+V+A+ N  I+ LP I NA ++   FSA N+
Sbjct: 324 LCLGIVCSPNDPSLTAAINEARPGAGSSPFVIAMNNLRIRVLPDIVNAALITSAFSAGNA 383

Query: 400 DLYVASRTLYGLAIDNKAPKIFAVTNRWGVPYYSLLMSSCFCLLAYMSVSSGSAKIFNYF 459
             Y +SRTLYG+A+D  APKIF   N++GVP Y++ +S  + L++ + ++S SA + N+ 
Sbjct: 384 YTYCSSRTLYGMALDGYAPKIFTRCNKYGVPIYAVGVSLLWALISLLQLNSNSAIVLNWL 443

Query: 460 VNVVSIFGLLSWISILITYLCFFRAVKAQNVDRSRFAYRAPFQPYGSYFTLAFCILIAFI 519
           VN+++   L++++ + + YL F RA  AQ        +R+  QPY + F L     + FI
Sbjct: 444 VNLITASQLINFVFLCVIYLFFRRAYNAQKDKLPPLPFRSWGQPYTAIFGLVCAFSMIFI 503

Query: 520 KNFTVFLNHHFDYKNFITGYIGIPVFVISYFGYKFV---KKTKIWKPEEVDLYTFKAAID 576
           + +TVF++  ++ ++F+  Y+ + + V  Y GYKF+    K K   P +VD  T    I+
Sbjct: 504 QGYTVFIHSLWNTRDFLFCYLMVFINVAIYLGYKFIWKRGKDKFIDPHKVDFITDLKEIE 563

Query: 577 EEE 579
             E
Sbjct: 564 AHE 566

>Smik_2.272 Chr2 complement(484274..486067) [1794 bp, 597 aa] {ON}
           YBR132C (REAL)
          Length = 597

 Score =  252 bits (644), Expect = 5e-75,   Method: Compositional matrix adjust.
 Identities = 154/549 (28%), Positives = 264/549 (48%), Gaps = 19/549 (3%)

Query: 54  NDMDNLSTVSS----RLEDSEKQDDYMDDGKDEH----TRLRKDLKARHISMIAXXXXXX 105
           + + ++ST+       + + E +   +D+    H    T  R+ L+ RH+ +IA      
Sbjct: 45  DSLTHISTIPEGGDVHVHEHEDRGSSIDEDSRTHLLFSTETRRKLENRHVQLIAISGVIG 104

Query: 106 XXXXXXXXXXXYTAGPMSMFIAYAFVGVLVFFTMAALGEMASYIPLDG-FTSYASRYCDP 164
                      Y  GP S+ +A+A   V +     +  EM  + P+   F   A++  D 
Sbjct: 105 TALFVAIGKALYRGGPASLLLAFALWCVPILCITVSTAEMVCFFPVSSPFLRLATKCVDD 164

Query: 165 ALGFAVGYAYLCKYLILPPNQLTAAALVIQYWLDREQVNPGVWITIFLVIIVAMNFIGVK 224
           +L     + +     +  P ++ +   +I YW  R+  + G+ + + +V+ + ++   VK
Sbjct: 165 SLAVMASWNFWFLECVQIPFEIVSVNTIIHYW--RDDYSAGIPLAVQVVLYLLISICAVK 222

Query: 225 FFGEFEFWLSTFKVIVMIGLIILLFVIMLGGGPTHDRLGFRFYDHPGAFKPY---SKSID 281
           ++GE EFWL++FK+I+ +GL I  F+ MLGG P HDR GFR Y     FK Y      + 
Sbjct: 223 YYGEMEFWLASFKIILALGLFIFTFITMLGGNPRHDRYGFRNYGE-SPFKKYFPDGNDVG 281

Query: 282 GSKGKXXXXXXXXXXXXXXXXGIELTGIVAAEAANPRKSIPKAIKLTMYRIIVFYLVTIF 341
            S G                 G E   ++A E   PRK +PKA K    R+   +L +  
Sbjct: 282 KSSGYFQGFLACLIQASFTIAGGEYISMLAGEVKRPRKVLPKAFKQVFVRLTFLFLGSCL 341

Query: 342 LLGMCVAYDDP-LLXXXXXXXXXXXXXPYVVAIINSGIKALPHIFNACVLMFVFSACNSD 400
            +G+  + +DP L              PYV+A+ N  I+ LP I N  ++   FSA N+ 
Sbjct: 342 CVGIVCSPNDPDLTAAINEARPGAGSSPYVIAMNNLKIRILPDIVNIALITAAFSAGNAY 401

Query: 401 LYVASRTLYGLAIDNKAPKIFAVTNRWGVPYYSLLMSSCFCLLAYMSVSSGSAKIFNYFV 460
            Y +SRT YG+A+D  APK+F   NR GVP YS+ +S  + L++ + ++S SA + N+ +
Sbjct: 402 TYCSSRTFYGMALDGYAPKLFTRCNRHGVPIYSVGISLIWALVSLLQLNSNSAVVLNWLI 461

Query: 461 NVVSIFGLLSWISILITYLCFFRAVKAQNVDRSRFAYRAPFQPYGSYFTLAFCILIAFIK 520
           N+++   L++++ + I YL F RA + Q     R  +R+  QPY +   L  C  +  I+
Sbjct: 462 NLITASQLINFVVLCIIYLFFRRAYRVQQDSLPRLPFRSWGQPYTAIIGLVSCSAMILIQ 521

Query: 521 NFTVFLNHHFDYKNFITGYIGIPVFVISYFGYKFV---KKTKIWKPEEVDLYTFKAAIDE 577
            +TVF    +  ++F+  Y+ + + +  Y GYKF+    K  +  P ++D       I+ 
Sbjct: 522 GYTVFFPKLWSTQDFLFSYLMVFINIGIYVGYKFIWKRGKDSLKNPHDIDFSKELTEIEN 581

Query: 578 EEEQGKIAD 586
            E +    D
Sbjct: 582 HEIECSFGD 590

>KLTH0B02046g Chr2 complement(163199..164968) [1770 bp, 589 aa] {ON}
           similar to uniprot|P06775 Saccharomyces cerevisiae
           YGR191W HIP1 High-affinity histidine permease also
           involved in the transport of manganese ions
          Length = 589

 Score =  252 bits (643), Expect = 5e-75,   Method: Compositional matrix adjust.
 Identities = 169/556 (30%), Positives = 276/556 (49%), Gaps = 26/556 (4%)

Query: 49  DGLDINDMDNLSTVSSRLEDSEKQDDYMDDGKDEHTRLRKDLKARHISMIAXXXXXXXXX 108
           D  D    D +S   S  +  E  D    + +D+  R  KDL  RH+  +A         
Sbjct: 37  DRADSKQKDLMS--GSETKALENLDSTSQEVEDQDARYNKDLSVRHLLTLAVGGAIGTGL 94

Query: 109 XXXXXXXXYTAGPMSMFIAYAFVGVLVFFTMAALGEMASYIPL-DGFTSYASRYCDPALG 167
                    T GP S+ I +  +   +F  + ALGE++S  P+  GF  Y SR+ +P+ G
Sbjct: 95  FVNSGAALTTGGPGSLVIDWVIISTCLFTIVNALGELSSTFPVVGGFNVYISRFVEPSFG 154

Query: 168 FAVGYAYLCKYLILPPNQLTAAALVIQYWLDREQVNPGVWITIFLVIIVAMNFIGVKFFG 227
           FAV   YL ++ +L P +L AA+L I+YW     +N   W+ IF  II+  N + VK FG
Sbjct: 155 FAVNLNYLAQWAVLLPLELVAASLTIRYW--NHTINSDAWVAIFYTIILLANLLDVKSFG 212

Query: 228 EFEFWLSTFKVIVMIGLIILLFVIMLGGGPTHDRLGFRFYDHPGAFKPYSKSIDGSKGKX 287
           E EF LS  K++ +IG  IL  V+  GGGP    +G +++ +PGAF  ++     +  + 
Sbjct: 213 ETEFVLSMVKILAIIGFTILGIVLTCGGGPKGGYIGGKYWSNPGAFVGHT-----AGDRF 267

Query: 288 XXXXXXXXXXXXXXXGIELTGIVAAEAANPRKSIPKAIKLTMYRIIVFYLVTIFLLGMCV 347
                          G EL  + AAE+ NPR ++PKA K T + I V Y+V + L+G  V
Sbjct: 268 HGLCSVFVTAAFSYSGTELIAVSAAESVNPRITLPKACKRTFWLITVCYIVVLTLVGCLV 327

Query: 348 AYDDPLLXXXXXXXXXXXXXPYVVAIINSGIKALPHIFNACVLMFVFSACNSDLYVASRT 407
           + DDP L             P V+AI N GIK LP + NA +L+ V S  NS +Y  SR 
Sbjct: 328 SSDDPRLLNGSSSVDVAAS-PLVIAIENGGIKGLPSLMNAIILIAVLSVANSAVYACSRC 386

Query: 408 LYGLAIDNKAPKIFAVTNRWGVPYYSLLMSSCFCLLAYMSVSSGSAKIFNYFVNVVSIFG 467
           +  +A     PK+F   +R G P Y+++ +  F LL++++ S    ++F +   +  +  
Sbjct: 387 MASMAQIGNLPKVFTYVDRKGRPLYAIVATLIFGLLSFIAASDKQEEVFTWLSALSGLST 446

Query: 468 LLSWISILITYLCFFRAVKAQNVDRSRFAYRAPFQPYGSYFTLAFCILIAFIKNFTVFLN 527
           L  W +I ++++ F R +K +        + +    +GSY+    CI+I FI     F  
Sbjct: 447 LFCWFAINVSHIRFRRTMKERGRTLDELPFVSMTGVWGSYYG---CIVI-FIVLVVCFWT 502

Query: 528 HHF-------DYKNFITGYIGIPVFVISYFGYK-FVKKTKIWKP-EEVDLYTFKAAIDEE 578
             F       + ++F   Y+  P+ +  YFG+K + +  ++  P +E+DL + + A+D E
Sbjct: 503 SLFPGGGEGANAESFFETYLSFPILLACYFGHKLYTRSWRLLTPTKEIDLDSGRRAVDLE 562

Query: 579 --EEQGKIADAERRER 592
             +++ +I +   R++
Sbjct: 563 LMKDEKRIEEQAMRQK 578

>ZYRO0D03762g Chr4 complement(304207..306009) [1803 bp, 600 aa] {ON}
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039W GAP1 General amino acid permease localization to
           the plasma membrane is regulated by nitrogen source
          Length = 600

 Score =  252 bits (644), Expect = 5e-75,   Method: Compositional matrix adjust.
 Identities = 158/517 (30%), Positives = 268/517 (51%), Gaps = 24/517 (4%)

Query: 83  HTRLRKDLKARHISMIAXXXXXXXXXXXXXXXXXYTAGPMSMFIAYAFVGVLVFFTMAAL 142
            + L+  LK RH+ MI+                  TAGP  + I +   G +++  + ++
Sbjct: 81  RSPLQHQLKNRHLQMISIGGAIGTGLFVGSGTALRTAGPAGILIGWIIAGSMIYCMVMSV 140

Query: 143 GEMASYIPL-DGFTSYASRYCDPALGFAVGYAYLCKYLILPPNQLTAAALVIQYWLDREQ 201
            E+A   P+  GFT+YA+R+ D + GFA  + Y+ ++++  P ++ AA++ + YW   ++
Sbjct: 141 AELAIAFPVAGGFTTYATRFIDESYGFANNFNYMLQWIVTLPLEIVAASITVNYWHTDKK 200

Query: 202 VNPGVWITIFLVIIVAMNFIGVKFFGEFEFWLSTFKVIVMIGLIILLFVIMLGGGPTHDR 261
              G ++ +F V+IV +N  GV+ +GE EF  S  K+++++G IIL  +++ GGGP    
Sbjct: 201 YRDG-FVALFWVVIVIINMFGVRGYGEAEFIFSICKILMIVGFIILAIILICGGGPGTGY 259

Query: 262 LGFRFYDHPGAFKPYSKSIDGSKGKXXXXXXXXXXXXXXXXGIELTGIVAAEAANPRKSI 321
           +G R++ HPGAF       D S  K                G EL G+ AAEA+NPRK +
Sbjct: 260 IGARYWYHPGAFAG-----DTSGRKFKGFCSVFVTAAFSFAGSELVGLAAAEASNPRKDV 314

Query: 322 PKAIKLTMYRIIVFYLVTIFLLGMCVAYDDPLLXXXXXXXXXXXXXPYVVAIINSGIKAL 381
           P A K   +RI +FY++ + L+GM V Y DP L             P+V+AI N GI  L
Sbjct: 315 PGAAKQVFWRITMFYVLCLLLIGMLVPYTDPRLIGGSSVDAAAS--PFVIAIKNQGISGL 372

Query: 382 PHIFNACVLMFVFSACNSDLYVASRTLYGLAIDNKAPKIFAVTNRWGVPYYSLLMSSCFC 441
           P + N  +L+ V S  NS +Y  SRTL  LA     PK F+  +R G P   + ++S F 
Sbjct: 373 PTLVNVVILIAVLSVGNSAVYACSRTLSALADQGFLPKCFSYIDRMGRPMVGIAVTSAFG 432

Query: 442 LLAYMSVSSGSAKIFNYFVNVVSIFGLLSWISILITYLCFFRAVKAQNVDRSRFAYRAPF 501
           L+A+++ S    ++F++ + +  +  L +W +I + ++ F RA+ AQ    +  A+ +P 
Sbjct: 433 LIAFVAQSDKEGEVFDWLMALSGLSSLFTWATICLCHIRFRRALAAQGRSTNELAFASPA 492

Query: 502 QPYGSYFTLAFCILIAFIKNFTVF--LNHHFDYKNFITGYIGIPVFVISYFGYKFVKKTK 559
             +G+ + L  CI++   + +     L       +F  GY+ +P+ +  + G+K  KK  
Sbjct: 493 GVWGAAWGLFLCIIMLAAQFYVALFPLGAPPSANDFFQGYLSLPIVLAMWLGHKIWKKN- 551

Query: 560 IW----KPEEVDLYTFKAAID-------EEEEQGKIA 585
            W    K E++D+ T +  +D        EEE+  +A
Sbjct: 552 -WKLFIKAEDMDIDTGRRELDLDLLRQQVEEERAALA 587

>KAFR0E01850 Chr5 (381160..382842) [1683 bp, 560 aa] {ON} Anc_5.158
           YGR191W
          Length = 560

 Score =  251 bits (641), Expect = 5e-75,   Method: Compositional matrix adjust.
 Identities = 162/524 (30%), Positives = 270/524 (51%), Gaps = 20/524 (3%)

Query: 82  EHTRLRKDLKARHISMIAXXXXXXXXXXXXXXXXXYTAGPMSMFIAYAFVGVLVFFTMAA 141
            +T L K+L  RH+  +A                    GP S+ + +  +   +F  + +
Sbjct: 39  NNTNLSKNLSVRHLVTLAVGGSIGTGLFVNSGTALSDGGPASLVVGWVIISTCLFTVINS 98

Query: 142 LGEMASYIPL-DGFTSYASRYCDPALGFAVGYAYLCKYLILPPNQLTAAALVIQYWLDRE 200
           LGE+A+  P+  GF  Y +R+ DP++GFAV   YL ++L+L P +L AA+L I+YW D+ 
Sbjct: 99  LGELAAAFPIVGGFNVYITRFVDPSVGFAVNLNYLAQWLVLLPLELVAASLTIKYWNDK- 157

Query: 201 QVNPGVWITIFLVIIVAMNFIGVKFFGEFEFWLSTFKVIVMIGLIILLFVIMLGGGPTHD 260
            +N   W+ IF V IV  N + VK FGE EF LS  K++ +IG  IL  V+  GGGP+  
Sbjct: 158 -INSDAWVAIFYVTIVLANMLEVKSFGETEFVLSMVKILAIIGFTILGIVLASGGGPSGG 216

Query: 261 RLGFRFYDHPGAFKPYSKSIDGSKG-KXXXXXXXXXXXXXXXXGIELTGIVAAEAANPRK 319
            LGF+++++PGAF      + G+   K                GIE+  + AAE+ NPRK
Sbjct: 217 YLGFKYWNNPGAF------VGGTNASKFKGLCSVFVTAAFSFSGIEMIAVSAAESKNPRK 270

Query: 320 SIPKAIKLTMYRIIVFYLVTIFLLGMCVAYDDPLLXXXXXXXXXXXXXPYVVAIINSGIK 379
            IPKA K T + +   Y+V + L+G  V Y+D  L             P V+AI N GIK
Sbjct: 271 VIPKAAKRTFWLVTSSYVVILTLVGCLVPYNDSRLLNAATSVDAAAS-PLVIAIENGGIK 329

Query: 380 ALPHIFNACVLMFVFSACNSDLYVASRTLYGLAIDNKAPKIFAVTNRWGVPYYSLLMSSC 439
            LP + NA +L+ + S  NS +Y  SR +  +A     PK+ +  ++ G P  +L+++  
Sbjct: 330 GLPSLMNAIILIAIVSVANSAVYACSRCMVSMAHIGNLPKVLSKVDKKGRPMNALIVTLI 389

Query: 440 FCLLAYMSVSSGSAKIFNYFVNVVSIFGLLSWISILITYLCFFRAVKAQNVDRSRFAYRA 499
           F LL++++ S    ++F +   +  +  +  W++I  + + F RA++ QN       Y +
Sbjct: 390 FGLLSFIAASDKQNEVFTWLSALSGLSTIFCWMAINYSLIRFRRAMQVQNRSLDELPYLS 449

Query: 500 PFQPYGSYF---TLAFCILIAFIKNFTVFLNHHFDYKNFITGYIGIPVFVISYFGYK--F 554
               +G+++    L   I+ +F  +     + H D ++F   ++ +P+ ++ YFG+K  F
Sbjct: 450 QTGIWGAWYGVLVLFLVIVASFWTSMFPLGSAHADAESFFESFLSLPILLVCYFGHKLYF 509

Query: 555 VKKTKIW-KPEEVDLYTFKAAIDEEEEQGKIADAERRERLKNSK 597
            +  ++    EE+D+ + +  IDEE   G   + E  E+  NS 
Sbjct: 510 ARNWRLQIGAEEMDIDSGRKIIDEE---GLKQEREEEEKAMNSS 550

>KAFR0D00510 Chr4 complement(80174..82027) [1854 bp, 617 aa] {ON} 
          Length = 617

 Score =  252 bits (644), Expect = 7e-75,   Method: Compositional matrix adjust.
 Identities = 158/554 (28%), Positives = 279/554 (50%), Gaps = 29/554 (5%)

Query: 54  NDMDNLSTVSSRLEDSEKQDDYMDDGKDEHTRLRKDLKARHISMIAXXXXXXXXXXXXXX 113
            DM+ + +  S  +D++ +   +DD  +E  +L+K ++ RH+ M++              
Sbjct: 69  TDMNPILSHQSVFDDAKVEISQVDDELNE--KLKKTIQPRHVVMMSLGTGIGTGLLVGNG 126

Query: 114 XXXYTAGPMSMFIAYAFVGVLVFFTMAALGEMA-SYIPL-DGFTSYASRYCDPALGFAVG 171
                AGP  + I YA +   ++  + A+GEMA +Y+ L  GF +Y     DPAL F++ 
Sbjct: 127 TTLAHAGPAGLVIGYAIMASCIYCIIQAVGEMAVNYLTLVGGFNAYPGFLVDPALNFSIA 186

Query: 172 YAYLCKYLILPPNQLTAAALVIQYWLDREQVNPGVWITIFLVIIVAMN-FIGVKFFGEFE 230
           + Y  ++  + P +L  A++ IQYW  +  VN  +++ IF ++++A+N F G + + E E
Sbjct: 187 WIYCIQWFCVCPLELVTASMTIQYWTTK--VNADIFVLIFYILVLAINIFGGARGYAETE 244

Query: 231 FWLSTFKVIVMIGLIILLFVIMLGGGPTHDRLGFRFYDHPGAFKPYSKSIDGSKG--KXX 288
           F  ++ K+++MIG  IL  VI+ GG      +G +++  PGAF+       GS G  +  
Sbjct: 245 FICNSCKILMMIGFFILGIVIICGGAGNDGFIGGKYWRDPGAFR-------GSDGPNRFK 297

Query: 289 XXXXXXXXXXXXXXGIELTGIVAAEAANPRKSIPKAIKLTMYRIIVFYLVTIFLLGMCVA 348
                           E   I A+E +NPRK+IP A K  +YR ++ YL +I ++G+ V 
Sbjct: 298 GVVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRALLIYLASIIIVGLLVP 357

Query: 349 YDDPLLXXXXXXXXXXXXXPYVVAIINSGIKALPHIFNACVLMFVFSACNSDLYVASRTL 408
           YD   L             PYV+A+   G++ +PH  NA +L+ VFS  +S  Y +SR L
Sbjct: 358 YDSSELLGSSSAATKAS--PYVLAVSTHGVRVVPHFINAVILISVFSVADSAFYSSSRML 415

Query: 409 YGLAIDNKAPKIFAVTNRWGVPYYSLLMSSCFCLLAYMSVSSGSAKIFNYFVNVVSIFGL 468
             LA    APK+F   +R G P    L+ +   ++A+ + SS   ++FN+ + +  +  +
Sbjct: 416 LTLARQGYAPKVFTFVDRTGRPSLGFLVGAVIAVMAFCACSSKETEVFNWLLAISGLSQV 475

Query: 469 LSWISILITYLCFFRAVKAQNVDRSRFAYRAPFQPYGSYFTLAFCILIAFIKNFTVFL-- 526
            +W  I ++++ F RA+K Q        Y++    +GS +     ILI   + +   +  
Sbjct: 476 FTWALICLSHIRFRRAMKVQGRSIDEIGYKSQVGVWGSAYAFVMMILIMIGQCWVGIVPV 535

Query: 527 -NHHFDYKNFITGYIGIPVFVISYFGYKFVKKTKIW----KPEEVDLYTFKAAIDEEEEQ 581
                D + F   Y+ +PVF++ Y GYK  K+   W    + +++DL + +   D E  +
Sbjct: 536 GEGSADVQAFFQDYLAMPVFIVLYLGYKIWKRD--WRLFIRAKDIDLISHRHIHDPEILR 593

Query: 582 GKIADAERRERLKN 595
            +    E +E+L+N
Sbjct: 594 QE--REEYQEKLRN 605

>Suva_4.381 Chr4 complement(668597..670369) [1773 bp, 590 aa] {ON}
           YBR132C (REAL)
          Length = 590

 Score =  251 bits (642), Expect = 8e-75,   Method: Compositional matrix adjust.
 Identities = 153/542 (28%), Positives = 263/542 (48%), Gaps = 17/542 (3%)

Query: 54  NDMDNLSTVSSRLEDSEKQDDYMDDGKDEHTRL------RKDLKARHISMIAXXXXXXXX 107
             ++++ST+         +D      +D  T L      R+ L+ RH+ +IA        
Sbjct: 40  ESLNHVSTIHEEGNMHVHEDGETSTDEDSRTNLLFSTETRRKLENRHVQLIAISGVIGTA 99

Query: 108 XXXXXXXXXYTAGPMSMFIAYAFVGVLVFFTMAALGEMASYIPLDG-FTSYASRYCDPAL 166
                    Y  GP S+ +A+A   V +     +  EM  + P+   F   A++  D +L
Sbjct: 100 LFVAIGKALYRGGPASLLLAFALWCVPILCITVSTAEMVCFFPVSSPFLRLATKCVDESL 159

Query: 167 GFAVGYAYLCKYLILPPNQLTAAALVIQYWLDREQVNPGVWITIFLVIIVAMNFIGVKFF 226
                + +     +  P ++ +   +I YW  R+  + G+ + + +V+ + ++   VK++
Sbjct: 160 AVMASWNFWFLECVQIPFEIVSVNTIIHYW--RDDYSAGIPLAVQVVLYLLISICAVKYY 217

Query: 227 GEFEFWLSTFKVIVMIGLIILLFVIMLGGGPTHDRLGFRFYDHPGAFKPY---SKSIDGS 283
           GE EFWL++FK+I+ +GL I  FV MLGG P HDR GFR+Y     FK Y    K +  S
Sbjct: 218 GEMEFWLASFKIILALGLFIFTFVTMLGGNPKHDRYGFRYYGE-SPFKQYFPDGKDVGKS 276

Query: 284 KGKXXXXXXXXXXXXXXXXGIELTGIVAAEAANPRKSIPKAIKLTMYRIIVFYLVTIFLL 343
            G                 G E   ++A E   PRK +PKA K    R+   +L +   +
Sbjct: 277 SGYFQGFLACLIQASFTIAGGEYISMLAGEVKRPRKVLPKAFKQVFVRLTFLFLGSCLCV 336

Query: 344 GMCVAYDDP-LLXXXXXXXXXXXXXPYVVAIINSGIKALPHIFNACVLMFVFSACNSDLY 402
           G+  + +DP L              PYV+A+ N  I+ LP + N  ++   FSA N+  Y
Sbjct: 337 GIVCSPNDPDLTAAINEARPGAGSSPYVIAMNNMKIRILPDVVNIALITAAFSAGNAYTY 396

Query: 403 VASRTLYGLAIDNKAPKIFAVTNRWGVPYYSLLMSSCFCLLAYMSVSSGSAKIFNYFVNV 462
            +SRT YG+A+D  APKIF   N+ GVP Y++ +S  + L++ + ++S SA + N+ +N+
Sbjct: 397 CSSRTFYGMALDGYAPKIFTKCNKHGVPIYAVGISLIWALVSLLQLNSNSAVVLNWLINL 456

Query: 463 VSIFGLLSWISILITYLCFFRAVKAQNVDRSRFAYRAPFQPYGSYFTLAFCILIAFIKNF 522
           ++   L++++ + I YL F R    Q     +  +R+  QPY +   L  C+ +  I+ +
Sbjct: 457 ITASQLINFVVLCIIYLFFRRTYSIQQDSLPKLPFRSWGQPYTAIIGLVSCLAMIMIQGY 516

Query: 523 TVFLNHHFDYKNFITGYIGIPVFVISYFGYKFV---KKTKIWKPEEVDLYTFKAAIDEEE 579
           TVF    ++ ++F+  Y+ + + +  Y GYKF+    K K+  P ++D       I+  E
Sbjct: 517 TVFFPKLWNSQDFLFSYLMVFIDIGIYVGYKFIWKRGKDKVKDPYKIDFSKELIEIENHE 576

Query: 580 EQ 581
            Q
Sbjct: 577 IQ 578

>KLTH0F01584g Chr6 complement(120227..122017) [1791 bp, 596 aa] {ON}
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508C GNP1 High-affinity glutamine permease also
           transports Leu Ser Thr Cys Met and Asn expression is
           fully dependent on Grr1p and modulated by the
           Ssy1p-Ptr3p- Ssy5p (SPS) sensor of extracellular amino
           acids
          Length = 596

 Score =  251 bits (642), Expect = 8e-75,   Method: Compositional matrix adjust.
 Identities = 170/563 (30%), Positives = 273/563 (48%), Gaps = 24/563 (4%)

Query: 49  DGLDINDMDNLSTVSSRLEDSEKQDDYMDDGKD---EHTRLRKDLKARHISMIAXXXXXX 105
           DG  ++    L+    R  +  +  D   +G+      T+L++ + +RH+ MI+      
Sbjct: 39  DGQVLSRFQRLTNSFKRAGEHGRGGDVDAEGQPVAPRETKLKQTISSRHLFMISLGTGIG 98

Query: 106 XXXXXXXXXXXYTAGPMSMFIAYAFVGVLVFFTMAALGEMA-SYIPLDG-FTSYASRYCD 163
                      +  GP  + I YA +G  ++  + A GEMA SY  L G F +Y S   D
Sbjct: 99  TGMLVGNGKALHNGGPAGLAIGYAIMGSCIYCIIQAAGEMAVSYSSLSGNFNAYPSMLID 158

Query: 164 PALGFAVGYAYLCKYLILPPNQLTAAALVIQYWLDREQVNPGVWITIFLVIIVAMNFIGV 223
           PALGF+V + Y  ++L + P +L  A + I+YW     VNP V++ IF V+ V +N  G 
Sbjct: 159 PALGFSVAWVYCLQWLCVLPLELVTATITIKYW--TTAVNPDVFVVIFYVLTVLVNLFGA 216

Query: 224 KFFGEFEFWLSTFKVIVMIGLIILLFVIMLGGGPTHDRLGFRFYDHPGAFKPYSKSIDGS 283
           + + E EF+ +T KV+++ G  IL  ++  GG      LG +++  PGA    +K I   
Sbjct: 217 RGYAEAEFFFNTCKVLMITGFFILGIIVNCGGAGNDGYLGGKYWHDPGALYG-TKPIHHF 275

Query: 284 KGKXXXXXXXXXXXXXXXXGIELTGIVAAEAANPRKSIPKAIKLTMYRIIVFYLVTIFLL 343
           KG                   E   + AAE ANPR++IP A K  +YR+++ +L  I LL
Sbjct: 276 KG----IIATMVTAAFAFGATEFIALTAAEQANPRRAIPSAAKKIVYRVLLIFLAPIILL 331

Query: 344 GMCVAYDDPLLXXXXXXXXXXXXXPYVVAIINSGIKALPHIFNACVLMFVFSACNSDLYV 403
           G  V Y+   L             PYV+AI + G+K +PH  NA +L+ V S  NS  Y 
Sbjct: 332 GFLVPYNSDELMGSGGSATHAS--PYVIAIASHGVKVVPHFINAVILLSVLSVGNSAFYS 389

Query: 404 ASRTLYGLAIDNKAPKIFAVTNRWGVPYYSLLMSSCFCLLAYMSVSSGSAKIFNYFVNVV 463
           +SR L  L+  + AP      +R G P  ++L+S  F L+A+++ S     +F + + + 
Sbjct: 390 SSRLLLSLSEQHYAPSWLNYIDREGRPIRAMLVSCIFGLIAFVAASPKEETVFTWLLAIS 449

Query: 464 SIFGLLSWISILITYLCFFRAVKAQNVDRSRFAYRAPFQPYGSYFTLAF--CILIA-FIK 520
            +  L +WI I ++++ F +A+  Q        Y++     GSY+      C+L   F  
Sbjct: 450 GLSQLFTWICICVSHIRFRKALVVQGKSLGELGYKSQTGVVGSYYATVIMACVLTGQFWV 509

Query: 521 NFTVFLNHHFDYKNFITGYIGIPVFVISYFGYKFVKKT-KIWKP-EEVDLYTFKAAIDEE 578
                     D  NF   Y+ +P+ +  YFGY+  K+  K++ P E++DL + +   DE+
Sbjct: 510 AIAPVGTDKLDANNFFENYLAMPILIALYFGYRVWKRDWKLYIPLEQIDLVSHRKVFDED 569

Query: 579 EEQGKIADAERRERLKNSKTKGW 601
               K  DAE  E ++NS   GW
Sbjct: 570 LL--KQEDAEYEESIRNS---GW 587

>Kwal_27.12681 s27 (1332647..1334428) [1782 bp, 593 aa] {ON} YKR039W
           (GAP1) - 1:1 [contig 260] FULL
          Length = 593

 Score =  251 bits (642), Expect = 9e-75,   Method: Compositional matrix adjust.
 Identities = 164/551 (29%), Positives = 285/551 (51%), Gaps = 27/551 (4%)

Query: 46  DKKDGLDINDMDNLSTVSSRLEDSEKQDDYMDDGKDEHTRLRKDLKARHISMIAXXXXXX 105
           D KDG    +++ L      L ++EK            + L++ LK RH+ MIA      
Sbjct: 45  DFKDGFKRVELEELD---PNLTEAEKIAII-----TAQSPLQRHLKNRHLQMIAIGGAIG 96

Query: 106 XXXXXXXXXXXYTAGPMSMFIAYAFVGVLVFFTMAALGEMASYIPLDG-FTSYASRYCDP 164
                       T GP  + I +  +G++++  + ++GE+A   P+ G FT+YA+R+ D 
Sbjct: 97  TGLFVGSGKALRTGGPAGVLIGWGLIGLMIYCVVMSMGELAVTFPVSGGFTTYATRFVDE 156

Query: 165 ALGFAVGYAYLCKYLILPPNQLTAAALVIQYWLDREQVNPGVWITIFLVIIVAMNFIGVK 224
           + GFA+ Y Y+ ++L++ P ++ AA++ + +W    +   G ++ +F ++IV +NF GV+
Sbjct: 157 SFGFAINYNYMLQWLVVLPLEIVAASITVNFWGTPPKYRDG-FVALFYIVIVIINFFGVR 215

Query: 225 FFGEFEFWLSTFKVIVMIGLIILLFVIMLGGGPTHDRLGFRFYDHPGAFKPYSKSIDGSK 284
            +GE EF  S  KVI +IG IIL  V++ GGGP    +G +++ +PGAF     S D + 
Sbjct: 216 GYGEAEFVFSFIKVITVIGFIILGIVLVCGGGPVGGYIGGKYWHNPGAF-----SGDDAG 270

Query: 285 GKXXXXXXXXXXXXXXXXGIELTGIVAAEAANPRKSIPKAIKLTMYRIIVFYLVTIFLLG 344
            +                G EL G+ +AE ANPRK++P+A K   +RI++FY++++ L+G
Sbjct: 271 SRFKGVCSVFVTAAFSFAGTELVGLASAETANPRKALPRAAKQVFWRILLFYIISLCLIG 330

Query: 345 MCVAYDDPLLXXXXXXXXXXXXXPYVVAIINSGIKALPHIFNACVLMFVFSACNSDLYVA 404
           + V +    L             P+V+AI   GIK LP + N  +L+ V S  NS +Y  
Sbjct: 331 LLVPHTSERLIGTSSVDAAAS--PFVLAIQTHGIKGLPSVINVVILISVLSVGNSAVYAC 388

Query: 405 SRTLYGLAIDNKAPKIFAVTNRWGVPYYSLLMSSCFCLLAYMSVSSGSAKIFNYFVNVVS 464
           SR++  LA     P IFA  +R G P  +++ +  F LL++++ S     +FN+ + +  
Sbjct: 389 SRSMVALAEQGSLPHIFAYIDRKGRPLVAIITTCVFGLLSFIAQSEKEGDVFNWLLALSG 448

Query: 465 IFGLLSWISILITYLCFFRAVKAQNVDRSRFAYRAPFQPYGSYFTLAFCILIAFIKNFTV 524
           +  L SW +I I ++ F RA+ AQ       A+ +     GSYF +   +L+  I  F V
Sbjct: 449 LSTLFSWGAICICHIRFRRALSAQGRSTDELAFVSYAGIAGSYFGV-ILVLLVLIAQFWV 507

Query: 525 F---LNHHFDYKNFITGYIGIPVFVISYFGYKFVKKTKIWK----PEEVDLYTFKAAIDE 577
               +    + ++F + Y+  PV +  Y  +K  K+   WK     +++D+ T +  +D 
Sbjct: 508 AVWPIGGSPNAEDFFSAYLSFPVLLAFYIFHKIWKRN--WKLFTRAKDIDIDTGRREMDT 565

Query: 578 EEEQGKIADAE 588
           E  + +IA+ +
Sbjct: 566 EALRQEIAEEK 576

>NDAI0A07490 Chr1 complement(1713048..1714838) [1791 bp, 596 aa]
           {ON} 
          Length = 596

 Score =  251 bits (641), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 169/551 (30%), Positives = 268/551 (48%), Gaps = 31/551 (5%)

Query: 65  RLEDSEKQDDYMDDGK-----DEHTRLRKDLKARHISMIAXXXXXXXXXXXXXXXXXYTA 119
           R ED     D  D  K     D+H  ++K +K+RH+ M+                    A
Sbjct: 54  RAEDKHADSDLEDGSKSITSDDDH--MKKAMKSRHVIMMTLGTGIGTGLLVANGKGLALA 111

Query: 120 GPMSMFIAYAFVGVLVFFTMAALGEMASYIPL--DGFTSYASRYCDPALGFAVGYAYLCK 177
           GP  + + Y  V  + +F + A GEMA   P     F +YAS +     GFA  + +  +
Sbjct: 112 GPAPLVLGYGLVSFVTYFMIQAAGEMAVTYPTMPASFNTYASIFVSKPFGFATVWLFCIQ 171

Query: 178 YLILPPNQLTAAALVIQYWLDREQVNPGVWITIFLVIIVAMNFIGVKFFGEFEFWLSTFK 237
           +L + P +L  A++ I+YW D   +NP V+I IF V ++ ++F GVK +GE EF  ++ K
Sbjct: 172 WLTVLPLELITASMTIKYWND--TINPDVFIVIFYVFLLFIHFFGVKAYGETEFIFNSCK 229

Query: 238 VIVMIGLIILLFVIMLGGGPTHDRLGFRFYDHPGAFKPYSKSIDGSKGKXXXXXXXXXXX 297
           ++++ G IIL  VI  GG      +G +++ +PGAF   S +      +           
Sbjct: 230 ILMIAGFIILSIVINCGGAGRDGYIGNKYWINPGAFASESPA-----ARFKGVAYILVTG 284

Query: 298 XXXXXGIELTGIVAAEAANPRKSIPKAIKLTMYRIIVFYLVTIFLLGMCVAYDDPLLXXX 357
                G EL  +   E  NPRKS P A K ++YRI++ YL+T+ L+G  V +D   L   
Sbjct: 285 YFSYGGTELFSLSVNEQKNPRKSTPAAAKQSIYRILIIYLLTMILIGFNVPHDSDQLMGA 344

Query: 358 XXXXXXXXXXPYVVAIINSGIKALPHIFNACVLMFVFSACNSDLYVASRTLYGLAIDNKA 417
                     PYV+A    G+K +PH  NA +L+ V S  NS LY + R +  LA    A
Sbjct: 345 GGSATHAS--PYVLAASLHGVKVVPHFINAVILISVVSVANSALYASPRLMRSLAEQGYA 402

Query: 418 PKIFAVTNRWGVPYYSLLMSSCFCLLAYMSVSSGSAKIFNYFVNVVSIFGLLSWISILIT 477
           PK F   +R G P  +L +   F ++ +++ S    + F +   +  +  L +W SI I+
Sbjct: 403 PKWFNYVDREGRPLRALCICGLFGVIGFVACSPQEEQAFTWLAAIAGLSELFTWSSIFIS 462

Query: 478 YLCFFRAVKAQNVDRSRFAYRAPFQPYGSYFTLAFCILIAFIKNFTVFL-----NHHFDY 532
           ++ F  A+K Q        YRA    +GS +++ F +L+ FI  F V L     N  +D 
Sbjct: 463 HIRFRMAMKVQGKSLEELGYRATTGIWGSVYSVFFNMLV-FIAQFWVALSPPKSNGKYDA 521

Query: 533 KNFITGYIGIPVFVISYFGYKFVKK--TKIWKPEEVDLYTFKAAIDEEEEQGKIADAERR 590
           + F   Y+  P++++ YFGY    +  T +   +++DL   +   D E  + +  DAE +
Sbjct: 522 EGFFESYLAAPLWLVFYFGYMIYSRDFTFLTPLDKIDLDFHRRIYDPELLRQE--DAETK 579

Query: 591 ERLKNSKTKGW 601
           ERL+NS   GW
Sbjct: 580 ERLRNS---GW 587

>NDAI0A05620 Chr1 (1268907..1270622) [1716 bp, 571 aa] {ON} 
          Length = 571

 Score =  250 bits (638), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 170/546 (31%), Positives = 270/546 (49%), Gaps = 26/546 (4%)

Query: 65  RLEDSEKQDDYMDDGKDE---HTRLRKDLKARHISMIAXXXXXXXXXXXXXXXXXYTAGP 121
           R E  E +++ ++DG       T L+K +K+RH+ M++                 Y +GP
Sbjct: 29  RAESPELEENDLEDGTRSIVTKTHLKKAMKSRHVVMMSIGTGIGTGLLVANAKGLYFSGP 88

Query: 122 MSMFIAYAFVGVLVFFTMAALGEMA-SYIPLDG-FTSYASRYCDPALGFAVGYAYLCKYL 179
            S+ I Y  V  + +F + A GEMA +Y  L G F SY S +     GFA  + +  ++L
Sbjct: 89  ASLIIGYVLVSFVTYFMIQAAGEMAVAYPTLPGSFNSYTSTFISKPFGFATVWLFFIQWL 148

Query: 180 ILPPNQLTAAALVIQYWLDREQVNPGVWITIFLVIIVAMNFIGVKFFGEFEFWLSTFKVI 239
            + P +L  A+L ++YW D+  +N  V+I IF   ++ ++F GVK +GE EF  ++ KV+
Sbjct: 149 TVFPLELITASLTVKYWNDK--INADVFIIIFYAFLLFIHFFGVKAYGETEFIFNSCKVL 206

Query: 240 VMIGLIILLFVIMLGGGPTHDRLGFRFYDHPGAFKPYSKSIDGSK-GKXXXXXXXXXXXX 298
           ++ G IIL  VI  GG  T   +G +++  PG+F       DG    +            
Sbjct: 207 MVAGFIILSIVINCGGAGTDGYIGAKYWHDPGSFA------DGPPITRFKGVCFILVSAY 260

Query: 299 XXXXGIELTGIVAAEAANPRKSIPKAIKLTMYRIIVFYLVTIFLLGMCVAYDDPLLXXXX 358
               G EL  +   E  NPRKS P A K ++YRI++ YL T+ L+G  V ++   L    
Sbjct: 261 FSYGGAELFSLSVNEQENPRKSTPAAAKQSIYRILIIYLATMILIGFNVPHNSDELMGAG 320

Query: 359 XXXXXXXXXPYVVAIINSGIKALPHIFNACVLMFVFSACNSDLYVASRTLYGLAIDNKAP 418
                    PYV+A     +K +PH  NA +L+ V S  NS LY A R +  LA    AP
Sbjct: 321 SAATHAS--PYVLAASLHSVKVVPHFINAVILISVISVANSALYAAPRLMCSLAEQGYAP 378

Query: 419 KIFAVTNRWGVPYYSLLMSSCFCLLAYMSVSSGSAKIFNYFVNVVSIFGLLSWISILITY 478
           K     +R G P   L++ + F ++ ++S SS   ++F +   +  +  L +W  I++++
Sbjct: 379 KFLNYVDREGRPLRGLILCALFGVIGFVSASSKEEEVFTWLAAIAGLSELFTWSGIMLSH 438

Query: 479 LCFFRAVKAQNVDRSRFAYRAPFQPYGSYFTLAFCILIAFIKNFTVFLN-----HHFDYK 533
           + F +A+K          ++A    +GSY+  AF IL+ FI  F V L+        D +
Sbjct: 439 IRFRQAMKFNGKSTDEIGFKAVTGIWGSYYGCAFNILV-FIAQFWVALSPPGSGGKCDAE 497

Query: 534 NFITGYIGIPVFVISYFGYKFVKKT-KIWKP-EEVDLYTFKAAIDEEEEQGKIADAERRE 591
            F   Y+  P++++ YFGY   K+   I  P E++DL   +   D +    K  D E +E
Sbjct: 498 AFFQSYLAAPIWLVFYFGYMIYKRDFTILNPLEKIDLDFHRRIYDPDFI--KQEDEENKE 555

Query: 592 RLKNSK 597
           RLKNS 
Sbjct: 556 RLKNSS 561

>TBLA0A05190 Chr1 complement(1271605..1273608) [2004 bp, 667 aa]
           {ON} Anc_1.50 YDR508C
          Length = 667

 Score =  252 bits (644), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 162/559 (28%), Positives = 278/559 (49%), Gaps = 29/559 (5%)

Query: 46  DKKDGLDINDMD-NLSTVSSRLEDSEKQDDYMDDGKDEHTRLRKDLKARHISMIAXXXXX 104
           +KK  L I D + + +TV+   +  E+QD        E+ +L++ +K RH+ M++     
Sbjct: 117 NKKSNLHIRDDELDYATVNVDSQPVEQQD--------ENAQLKQTIKPRHVIMMSLGTGI 168

Query: 105 XXXXXXXXXXXXYTAGPMSMFIAYAFVGVLVFFTMAALGEMA-SYIPLDG-FTSYASRYC 162
                         AGP  + I Y  +G  ++  + A GE+A +Y  ++G F ++ S   
Sbjct: 169 GTGLLVGNGTPLAQAGPAPLVIGYGIMGTCLYCIIQACGELAVAYSKVNGSFNTFPSFLV 228

Query: 163 DPALGFAVGYAYLCKYLILPPNQLTAAALVIQYWLDREQVNPGVWITIFLVIIVAMNFIG 222
           DP   FAV + Y  ++L + P +L  +++ I+YW  +  V+P V++ IF V+I+ +NF G
Sbjct: 229 DPGFNFAVAWVYCIQWLCVCPLELVTSSMTIKYWTTK--VDPDVFVVIFYVLILLINFFG 286

Query: 223 VKFFGEFEFWLSTFKVIVMIGLIILLFVIMLGGGPTHDRLGFRFYDHPGAFKPYSKSIDG 282
            K + E EF+ +  KV++MIG  I+   I  G   T   +G ++++ PGAF+  +K I+ 
Sbjct: 287 AKGYAEAEFFFNCCKVMMMIGFFIMAICINTGAAGTDGYIGAKYWNDPGAFRGQTK-IER 345

Query: 283 SKGKXXXXXXXXXXXXXXXXGIELTGIVAAEAANPRKSIPKAIKLTMYRIIVFYLVTIFL 342
            KG                   E   + AAE +NPRK+IP A K   YRI++ +L +I L
Sbjct: 346 FKG----VMDTFVTAAFAFGATEFIALTAAEQSNPRKAIPSAAKKVAYRILLIFLTSIIL 401

Query: 343 LGMCVAYDDPLLXXXXXXXXXXXXXPYVVAIINSGIKALPHIFNACVLMFVFSACNSDLY 402
           +G  V Y+   L             PYV+A    G+  + H  NA +L+ V S  NS  Y
Sbjct: 402 IGFLVPYNSDQLMGSSSGGNSAS--PYVLAASLHGVHVVQHFINAVILLSVLSVANSAFY 459

Query: 403 VASRTLYGLAIDNKAPKIFAVTNRWGVPYYSLLMSSCFCLLAYMSVSSGSAKIFNYFVNV 462
            +SR L GLA    APK F   +R G P  S+L ++   ++A+ + S     +F + + +
Sbjct: 460 SSSRLLLGLAQVGYAPKWFDYVDRNGRPLRSMLCAAIIAVIAFCATSPKETDVFTWLLAI 519

Query: 463 VSIFGLLSWISILITYLCFFRAVKAQNVDRSRFAYRAPFQPYGSYFTLAFCILIAFIKNF 522
             +  + +W +I ++++ F R ++ Q        +RA     GSY+  A  + +A +  F
Sbjct: 520 SGLSQIFTWFAICVSHIRFRRGMQVQGRSLGELGFRAQTGVLGSYYA-AIMLFLALVAQF 578

Query: 523 TVFL----NHHFDYKNFITGYIGIPVFVISYFGYKFVKK--TKIWKPEEVDLYTFKAAID 576
            V L     H  D +NF   Y+ +P+ +  Y G+K  ++      + + +DL + +   D
Sbjct: 579 WVALVPMNTHTLDAENFFQNYLAMPILLALYVGFKLWRRDFRLFIRAKNIDLISHRIIFD 638

Query: 577 EEEEQGKIADAERRERLKN 595
           EE  + +  D E +E+L+N
Sbjct: 639 EELLRQE--DEEYKEKLRN 655

>KLLA0A11770g Chr1 (1014918..1016663) [1746 bp, 581 aa] {ON} similar
           to uniprot|P06775 Saccharomyces cerevisiae YGR191W HIP1
           High-affinity histidine permease also involved in the
           transport of manganese ions
          Length = 581

 Score =  250 bits (638), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 169/545 (31%), Positives = 277/545 (50%), Gaps = 28/545 (5%)

Query: 61  TVSSRLEDSEKQDDYMDDGKDEH-------TRLRKDLKARHISMIAXXXXXXXXXXXXXX 113
           +V  +L+   ++ DY D    E        ++L KDL  RH+  +A              
Sbjct: 32  SVEKQLKPLAEEKDYADMNDVEKAIYNTKDSKLNKDLSIRHLLTLAVGGAIGTGLFVNSG 91

Query: 114 XXXYTAGPMSMFIAYAFVGVLVFFTMAALGEMASYIPL-DGFTSYASRYCDPALGFAVGY 172
               T GP S+ IA+  +   +F  + +LGE+++  P+  GF  Y +R+ +P+ GFAV +
Sbjct: 92  DSLSTGGPASLVIAWTIISTCLFTIVNSLGELSATFPVVGGFNVYVTRFVEPSFGFAVNF 151

Query: 173 AYLCKYLILPPNQLTAAALVIQYWLDREQVNPGVWITIFLVIIVAMNFIGVKFFGEFEFW 232
            YL ++ IL P +L AA++ I+YW   + +NP  W++IF V I   N + VK FGE EF 
Sbjct: 152 NYLAQWAILLPLELCAASITIRYW--NKSINPDAWVSIFYVAIAFANMLDVKSFGETEFV 209

Query: 233 LSTFKVIVMIGLIILLFVIMLGGGPTHDRLGFRFYDHPGAFKPYSKSIDGSKGKXXXXXX 292
           LS  K++ +IG  IL  V++ GGGP+   +G ++++ PGAF       D    +      
Sbjct: 210 LSMVKILAIIGFTILGIVLICGGGPSGGFIGGKYWNDPGAFVG-----DTPAQRFKGLSA 264

Query: 293 XXXXXXXXXXGIELTGIVAAEAANPRKSIPKAIKLTMYRIIVFYLVTIFLLGMCVAYDDP 352
                     G+EL G+ AAE+ NPR ++PKA K T + I + YLV + L+G  V  +DP
Sbjct: 265 VFITAAFSYSGLELVGVSAAESRNPRVTLPKAAKRTFWLITMSYLVILTLIGCLVPSNDP 324

Query: 353 LLXXXXXXXXXXXXXPYVVAIINSGIKALPHIFNACVLMFVFSACNSDLYVASRTLYGLA 412
           LL             P V+AI N GIK LP + NA +L+ + S  NS +Y  SR +  +A
Sbjct: 325 LLLNGTSSVDAAAS-PLVIAIQNGGIKGLPSLMNAIILIALLSVANSAVYACSRCIISMA 383

Query: 413 IDNKAPKIFAVTNRWGVPYYSLLMSSCFCLLAYMSVSSGSAKIFNYFVNVVSIFGLLSWI 472
                P+  A  ++ G P Y++ ++    LL++++ S+   ++F +   +  +  L  W 
Sbjct: 384 EIGNLPRSLAHVDKKGRPLYAIAITLLVGLLSFIAASNKRDEVFTWLSALSGLSTLFCWF 443

Query: 473 SILITYLCFFRAVKAQNVDRSRFAYRAPFQPYGSYFTLAFCILIA--FIKNFTVFL---- 526
           +I + +L F  A+K QN       Y +    +GS++    CI+I    I +F   L    
Sbjct: 444 AINLAHLRFRHAMKHQNRSLEELPYVSMTGEWGSWYG---CIVIGLVLIASFWTSLFPAG 500

Query: 527 NHHFDYKNFITGYIGIPVFVISYFGYKFVKKT-KIW-KPEEVDLYTFKAAIDEEE-EQGK 583
            +  D  +F   Y+ +P+F+  Y G+K  K+  +++ K  EVD+ + +   D    +Q K
Sbjct: 501 GNGADATSFFESYLSLPIFIACYLGHKIWKRNLRLYIKLSEVDVDSGRTDTDAATLKQEK 560

Query: 584 IADAE 588
            A+AE
Sbjct: 561 EAEAE 565

>TPHA0A04700 Chr1 (1064463..1066172) [1710 bp, 569 aa] {ON}
           Anc_5.158 YGR191W
          Length = 569

 Score =  249 bits (636), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 157/491 (31%), Positives = 252/491 (51%), Gaps = 16/491 (3%)

Query: 85  RLRKDLKARHISMIAXXXXXXXXXXXXXXXXXYTAGPMSMFIAYAFVGVLVFFTMAALGE 144
            L KDL  RH+  +A                  T GP S+ I +  +   +F  + ALGE
Sbjct: 77  NLNKDLDIRHLLTLAIGGSIGTGLFVNSGTSLNTGGPASLIIGWVIISSALFTVINALGE 136

Query: 145 MASYIPL-DGFTSYASRYCDPALGFAVGYAYLCKYLILPPNQLTAAALVIQYWLDREQVN 203
           +A+  P+  GF  Y +R+ DP+  FAV   YL  +++  P +L AA++ I+YW    ++N
Sbjct: 137 LAATFPIVGGFNVYMTRFVDPSFAFAVNLNYLILWIVSLPLELVAASITIRYW--NREIN 194

Query: 204 PGVWITIFLVIIVAMNFIGVKFFGEFEFWLSTFKVIVMIGLIILLFVIMLGGGPTHDRLG 263
              W+TIF V I  +N + VKFF E EF +S  K++ ++G  IL  V+ +GGGPT   +G
Sbjct: 195 SDAWVTIFFVFIALLNMMDVKFFSEAEFVMSIIKILAIVGFFILGIVLAVGGGPTGGYIG 254

Query: 264 FRFYDHPGAFKPYSKSIDGSKGKXXXXXXXXXXXXXXXXGIELTGIVAAEAANPRKSIPK 323
            ++++ PGAF       D +  +                G+E+T + AAE+ NPRK+IPK
Sbjct: 255 GKYWNDPGAFHG-----DSAGSRFKGLCSVFVIAAFSYSGVEMTAVSAAESKNPRKTIPK 309

Query: 324 AIKLTMYRIIVFYLVTIFLLGMCVAYDDPLLXXXXXXXXXXXXXPYVVAIINSGIKALPH 383
           A K T + I   Y+  + L+G+ V Y+D  L             P V+AI N+GIK LP 
Sbjct: 310 ATKRTFWVITFSYISILTLIGILVPYNDKRLLSGSSSVDASAS-PLVIAIENAGIKGLPS 368

Query: 384 IFNACVLMFVFSACNSDLYVASRTLYGLAIDNKAPKIFAVTNRWGVPYYSLLMSSCFCLL 443
           + NA +L+ + S  NS +YV SR +  +A+ N  PK+F+  ++ G P YS+  +    LL
Sbjct: 369 LMNAIILIALLSVANSCVYVCSRVMVSMALTNTLPKVFSKVDKRGRPLYSIFATLFVGLL 428

Query: 444 AYMSVSSGSAKIFNYFVNVVSIFGLLSWISILITYLCFFRAVKAQNVDRSRFAYRAPFQP 503
           ++++ S    ++F +   +  +  +  WI I + ++ F  A+K QN      AY +    
Sbjct: 429 SFIAASDKQEEVFTWLSAICGLSTIFCWIGINLAHIRFRAALKFQNRSLDELAYISQSGI 488

Query: 504 YGSYFTLAFCILIAFIKNFTVFL----NHHFDYKNFITGYIGIPVFVISYFGYKFVKKTK 559
           +GS++ +   +L+  I +F V L        D + F  GY+  P+ + SY G+K   K  
Sbjct: 489 WGSWYGVIILVLV-LIASFWVSLFPVGESSADAEAFFEGYLSFPILIASYIGHKVYIKNW 547

Query: 560 IW--KPEEVDL 568
            W    EE+D+
Sbjct: 548 KWVIPLEEIDI 558

>KAFR0D00520 Chr4 complement(82977..84773) [1797 bp, 598 aa] {ON}
           Anc_1.50 YDR508C
          Length = 598

 Score =  250 bits (638), Expect = 4e-74,   Method: Compositional matrix adjust.
 Identities = 163/556 (29%), Positives = 285/556 (51%), Gaps = 32/556 (5%)

Query: 53  INDMDNLSTVSSRLEDSEKQDDYMDDGKDEHTRLRKDLKARHISMIAXXXXXXXXXXXXX 112
           I+D +N   +     ++ K D + D   ++   L+K ++ RH+ MI+             
Sbjct: 50  IDDNNNQYEIEKNEINNIKSDQFNDKLNNQ---LQKTIQPRHVIMISLGTGIGTGLLVGN 106

Query: 113 XXXXYTAGPMSMFIAYAFVGVLVFFTMAALGEMA-SYIPL-DGFTSYASRYCDPALGFAV 170
               + AGP  + I Y  +   ++  + A GEMA +Y+ L  GF +Y S   D A  FAV
Sbjct: 107 GATLHNAGPAGLLIGYIIMASCIYCIIQACGEMAVNYLTLIGGFNNYPSFLVDTAWNFAV 166

Query: 171 GYAYLCKYLILPPNQLTAAALVIQYWLDREQVNPGVWITIFLVIIVAMN-FIGVKFFGEF 229
            + Y  ++L + P +L  A++ I+YW   E+V+P V++TIF ++I+A+N F G + + E 
Sbjct: 167 AWVYCIQWLCVCPLELVTASMTIKYW--NEKVDPDVFVTIFYLLIIAINLFGGARGYAEA 224

Query: 230 EFWLSTFKVIVMIGLIILLFVIMLGGGPTHDRLGFRFYDHPGAFKPYSKSIDGSKGKXXX 289
           EF+ +  K++++ G  IL  +++ GG  T   +G  ++++PGAF+ ++    G++ K   
Sbjct: 225 EFFFNLCKILMIAGFFILGIILICGGAGTSGYIGVSYWNNPGAFRGHTP---GTRFKGIV 281

Query: 290 XXXXXXXXXXXXXGIELTGIVAAEAANPRKSIPKAIKLTMYRIIVFYLVTIFLLGMCVAY 349
                          E   I A+E +NPRK+IP A K  +YR +  Y+ +I ++G  V Y
Sbjct: 282 STLVTAAFSFGQT--EFLAITASEQSNPRKAIPSAAKKVIYRALFIYVGSIIIVGFLVPY 339

Query: 350 DDPLLXXXXXXXXXXXXXPYVVAIINSGIKALPHIFNACVLMFVFSACNSDLYVASRTLY 409
           + P L             PYV+A+ + GI+  PH  NA +L+ V S  NS  Y +SR L 
Sbjct: 340 NSPELLGSKSSQTKAS--PYVIAVASHGIRIAPHFINAVILISVLSVANSSFYSSSRMLL 397

Query: 410 GLAIDNKAPKIFAVTNRWGVPYYSLLMSSCFCLLAYMSVSSGSAKIFNYFVNVVSIFGLL 469
            LA    APKIF   +R G P + ++ +S    +A+ + S    ++F++ + +  +  + 
Sbjct: 398 TLAKQGYAPKIFTYLDRKGRPLFGIIAASLLATIAFCASSPKETEVFSWLLAISGLSQVF 457

Query: 470 SWISILITYLCFFRAVKAQNVDRSRFAYRAPFQPYGSYF--TLAFCILIAFIKNFTVFL- 526
           +W +I ++++ F RA+K Q    +   Y++    +GS +  T+ F ILI     F V L 
Sbjct: 458 TWGTICLSHIRFRRAMKIQGRSLNELGYKSQVGVWGSIYAATVMFLILIG---QFWVALW 514

Query: 527 ---NHHFDYKNFITGYIGIPVFVISYFGYKFVKKTKIW----KPEEVDLYTFKAAIDEEE 579
              ++  +  NF   Y+ +P+ ++ YFGYK  KK   W    + +++DL + +   DE+ 
Sbjct: 515 PLNSNGANITNFFKEYLAMPILLLFYFGYKTWKKD--WNLFIRAKDIDLISHRHIYDEDV 572

Query: 580 EQGKIADAERRERLKN 595
              K    + +E LKN
Sbjct: 573 L--KQEKNQYKENLKN 586

>TPHA0B01090 Chr2 complement(246708..248528) [1821 bp, 606 aa] {ON}
           Anc_1.244 YKR039W
          Length = 606

 Score =  250 bits (638), Expect = 4e-74,   Method: Compositional matrix adjust.
 Identities = 163/514 (31%), Positives = 274/514 (53%), Gaps = 18/514 (3%)

Query: 83  HTRLRKDLKARHISMIAXXXXXXXXXXXXXXXXXYTAGPMSMFIAYAFVGVLVFFTMAAL 142
           HT L+  LK+RH+ MIA                  TAGP S+ I ++  G +++  + A+
Sbjct: 86  HTPLKHHLKSRHLQMIAIGGAIGTGLFVGSGTALRTAGPASLIIGWSITGSMIYSMVMAV 145

Query: 143 GEMASYIPLDG-FTSYASRYCDPALGFAVGYAYLCKYLILPPNQLTAAALVIQYWLDREQ 201
            EMA   P+ G FT+YA+R+ D + GFA  + Y+ ++L++ P ++ +A++ + YW    +
Sbjct: 146 AEMAVLYPISGGFTTYATRFIDESFGFANNFNYMLQWLVVLPLEIVSASITVNYWGTPTK 205

Query: 202 VNPGVWITIFLVIIVAMNFIGVKFFGEFEFWLSTFKVIVMIGLIILLFVIMLGGGPTHDR 261
              G ++ +F ++IV +N  GVK +GE EF  ST KVI ++G IIL  V++ GGGPT   
Sbjct: 206 YRDG-FVALFWLVIVIINLFGVKGYGEAEFIFSTIKVITVVGFIILGLVLVCGGGPTGGY 264

Query: 262 LGFRFYDHPGAFKPYSKSIDGSKG-KXXXXXXXXXXXXXXXXGIELTGIVAAEAANPRKS 320
           +G +++  PGAF      +  + G +                G EL GI  +EA NPRK+
Sbjct: 265 VGAKYWHDPGAF------VGATAGAQFQGFCSVFVTAAFSFSGSELIGIAGSEAENPRKA 318

Query: 321 IPKAIKLTMYRIIVFYLVTIFLLGMCVAYDDPLLXXXXXXXXXXXXXPYVVAIINSGIKA 380
           +P A K   +RI++FY++++  +G+ V  +D  L             P+V+AI   GI+ 
Sbjct: 319 VPPAAKQVFWRILLFYILSLLFIGLLVPSNDSRLIGSSNVDAAAS--PFVIAITVHGIRG 376

Query: 381 LPHIFNACVLMFVFSACNSDLYVASRTLYGLAIDNKAPKIFAVTNRWGVPYYSLLMSSCF 440
           LP + N  +L+ V S  NS +Y  SRTL  LA     PK+ +  +R G P   + +SS F
Sbjct: 377 LPSVINVVILIAVLSVGNSAIYTCSRTLVALAEQGFLPKVVSYIDRSGRPLVGIAISSFF 436

Query: 441 CLLAYMSVSSGSAKIFNYFVNVVSIFGLLSWISILITYLCFFRAVKAQNVDRSRFAYRAP 500
            L+A+++ S     +FN+ + +  +    +W +I + ++ F  A+KAQN       + +P
Sbjct: 437 GLVAFVAQSDKEGDVFNWLLAISGLSSFFTWGAICLCHIRFRAALKAQNRSTDELPFVSP 496

Query: 501 FQPYGSYFTLAFCILIAFIKNFTVFLNHHFDY---KNFITGYIGIPVFVISYFGYK-FVK 556
              +GSY+ L F I++     F V +    D     NF + Y+ +PV ++ Y  +K + K
Sbjct: 497 LGVFGSYWGL-FLIVLMLAAQFYVAIFPVGDTPSATNFFSAYLSLPVVLVMYIAHKLWTK 555

Query: 557 KTKIWKP-EEVDLYTFKAAIDEEEEQGKIADAER 589
             KI+ P  ++DL T +  +D +  + ++A+ ER
Sbjct: 556 NWKIFIPLGQLDLDTGRKQLDLDLLRQEVAE-ER 588

>SAKL0D02948g Chr4 (243064..244848) [1785 bp, 594 aa] {ON} similar
           to uniprot|P38084 Saccharomyces cerevisiae YBR068C BAP2
           High-affinity leucine permease functions as a
           branched-chain amino acid permease involved in the
           uptake of leucine isoleucine and valine contains 12
           predicted transmembrane domains
          Length = 594

 Score =  249 bits (637), Expect = 4e-74,   Method: Compositional matrix adjust.
 Identities = 162/529 (30%), Positives = 265/529 (50%), Gaps = 21/529 (3%)

Query: 77  DDGKDEHTRLRKDLKARHISMIAXXXXXXXXXXXXXXXXXYTAGPMSMFIAYAFVGVLVF 136
           +D      ++++ +K+RHI+MI+                 +  GP  + I Y     +++
Sbjct: 67  NDYNATQKKMKQTMKSRHITMISLGTGIGTGLLVANGKALHFGGPGGLVIGYVTTSTMLY 126

Query: 137 FTMAALGEMA-SYIPLDG-FTSYASRYCDPALGFAVGYAYLCKYLILPPNQLTAAALVIQ 194
             + A  E+  SY  L G + SY S   D    FAV + Y  ++ I+ P +L  +++ I+
Sbjct: 127 CVIQACCELGVSYATLPGNYNSYPSFLVDSGFNFAVAWVYGLQWAIVLPLELVTSSMTIK 186

Query: 195 YWLDREQVNPGVWITIFLVIIVAMNFIGVKFFGEFEFWLSTFKVIVMIGLIILLFVIMLG 254
           YW D   +NP V++ IF   IV ++F G + + E EF  ++ KV++M+G II+   +  G
Sbjct: 187 YWND--SINPDVFVAIFYCFIVFIHFFGSQGYAESEFIFNSCKVLMMVGFIIMGISVNCG 244

Query: 255 GGPTHDRLGFRFYDHPGAFKPYSKSIDGSKGKXXXXXXXXXXXXXXXXGIELTGIVAAEA 314
              +   +G +++  PGAF    K+ID  KG                 G E   + AAE 
Sbjct: 245 ASKS-GYIGGKYWHTPGAFVG-EKAIDHFKG----ICSVWVQSAFAYGGSEFIALTAAEQ 298

Query: 315 ANPRKSIPKAIKLTMYRIIVFYLVTIFLLGMCVAYDDPLLXXXXXXXXXXXXXPYVVAII 374
            NPRKS+PKA K  +YR+++ +L  I L+G  V YD PLL             P+V+A  
Sbjct: 299 TNPRKSVPKATKRWLYRVLIVFLTPIILVGFLVPYDSPLLLGSPGQAASHAS-PFVIAAA 357

Query: 375 NSGIKALPHIFNACVLMFVFSACNSDLYVASRTLYGLAIDNKAPKIFAVTNRWGVPYYSL 434
           + G+K +PHI NA +L+ V S  NS  Y A R L  LA     PK+F   +R G P  ++
Sbjct: 358 SHGVKVVPHIINAVILISVISVGNSAFYSAPRILLSLAEQGMGPKVFTYVDRKGRPLVTM 417

Query: 435 LMSSCFCLLAYMSVSSGSAKIFNYFVNVVSIFGLLSWISILITYLCFFRAVKAQNVDRSR 494
           L  + F L+++++ S     +F +   +VS+  L +W +I ++++ F  A+K Q      
Sbjct: 418 LFVAIFGLISFVAASDNEETVFTWLSAIVSLSQLFTWSAISLSHIRFRDAMKTQGRSLGE 477

Query: 495 FAYRAPFQPYGSYFTLAFCILIAFIKNFTVFL-----NHHFDYKNFITGYIGIPVFVISY 549
             Y+A    +GS++ +AF I++     F V +         D  NF   Y+  PV V  Y
Sbjct: 478 LGYKANTGYWGSWYAIAFNIIV-LAAQFWVAIAPIGNGGKLDVNNFFQNYLAFPVLVFFY 536

Query: 550 FGYK-FVKKTKIWKP-EEVDLYTFKAAIDEEEEQGKIADAERRERLKNS 596
           FGYK + +  K++ P ++VDL + +   D +    K  D E +ER++NS
Sbjct: 537 FGYKLWYRDWKLFIPADKVDLESHRKIFDADLI--KQEDFEHKERIRNS 583

>SAKL0D02970g Chr4 (245449..247254) [1806 bp, 601 aa] {ON}
           uniprot|Q875S5 Saccharomyces kluyveri BAP2
          Length = 601

 Score =  249 bits (637), Expect = 5e-74,   Method: Compositional matrix adjust.
 Identities = 171/549 (31%), Positives = 277/549 (50%), Gaps = 25/549 (4%)

Query: 63  SSRLEDSEKQDDYMDDGKDEHTRLRKDLKARHISMIAXXXXXXXXXXXXXXXXXYTAGPM 122
           S   + S+  +    +    +++ ++ +K+RH+ M++                 +  GP 
Sbjct: 59  SDTFDASQDLEGASINSVRSNSKFKQSMKSRHVVMMSLGTGIGTGLLVANGKSLHFGGPA 118

Query: 123 SMFIAYAFVGVLVFFTMAALGEMA-SYIPLDG-FTSYASRYCDPALGFAVGYAYLCKYLI 180
            + I Y+ V V+ +  M A GEMA +Y  L G F  Y+S +   + GFA  + Y  ++L 
Sbjct: 119 GLLIGYSLVSVVAYIMMQAAGEMAVAYPTLPGNFNVYSSIFISKSFGFATVWLYCLQWLT 178

Query: 181 LPPNQLTAAALVIQYWLDREQVNPGVWITIFLVIIVAMNFIGVKFFGEFEFWLSTFKVIV 240
           + P +L  A+L I+YW     +NP  +I IF  +IV ++F G   +GE EF  ST KV +
Sbjct: 179 VLPLELITASLTIKYW--NSSINPDAFIAIFYAVIVFIHFFGAAGYGEAEFIFSTCKVSM 236

Query: 241 MIGLIILLFVIMLGGGPTHDRLGFRFYDHPGAFKPYSKSIDGSK-GKXXXXXXXXXXXXX 299
           + G IIL  VI  GG  T   +G  ++ +PGAF        GS  G              
Sbjct: 237 IAGFIILSIVINCGGAGTGGYIGGEYWRNPGAFA------GGSPIGHFKGIAYVLVTAYF 290

Query: 300 XXXGIELTGIVAAEAANPRKSIPKAIKLTMYRIIVFYLVTIFLLGMCVAYDDPLLXXXXX 359
              G+EL  +   E ANPRK++P A K  +YRI++ Y++T+ L+G  V Y+   L     
Sbjct: 291 SYGGMELFALTVNEQANPRKAVPSATKKCIYRILIIYMLTMILIGFLVPYNSDELMGSSG 350

Query: 360 XXXXXXXXPYVVAIINSGIKALPHIFNACVLMFVFSACNSDLYVASRTLYGLAIDNKAPK 419
                   PYV+A+ + G+K +PHI NA +L+ V S  NS +Y A R L  LA    APK
Sbjct: 351 KSATHAS-PYVIAVASHGVKVVPHIINAVILISVVSVGNSAMYSAPRLLNSLAEQGYAPK 409

Query: 420 IFAVTNRWGVPYYSLLMSSCFCLLAYMSVSSGSAKIFNYFVNVVSIFGLLSWISILITYL 479
           IF+  +R G P  +L+  S F LL++++ S    ++F +   +  +  L +W +I ++++
Sbjct: 410 IFSYVDRAGRPLVALVGCSIFGLLSFVAASDKEEQVFTWLAAIAGLSELFTWSAICLSHV 469

Query: 480 CFFRAVKAQNVDRSRFAYRAPFQPYGSYFTLAFCILIAFIKNFTVFL-----NHHFDYKN 534
            F  A+K Q    S   Y++    +GS + + F I++ F+  F V L         D + 
Sbjct: 470 RFRDAMKYQGYSLSELGYKSKTGYWGSIYAIFFNIIV-FVAQFWVALAPIGNGGKADAEA 528

Query: 535 FITGYIGIPVFVISYFGYK-FVKKTKIWKP-EEVDLYTFKAAIDEEEEQGKIADAERRER 592
           F   Y+  P+++  Y GYK + K+ K+  P +E+DL + +   D+   Q +  D E +E+
Sbjct: 529 FFQSYLAFPIWISCYVGYKIYSKEWKLLVPLDEIDLNSHRHIFDKHILQQE--DDEHKEK 586

Query: 593 LKNSKTKGW 601
           LKNS   GW
Sbjct: 587 LKNS---GW 592

>AFR698C Chr6 complement(1726387..1728216) [1830 bp, 609 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR508C
           (GNP1) and YCL025C (AGP1)
          Length = 609

 Score =  249 bits (637), Expect = 6e-74,   Method: Compositional matrix adjust.
 Identities = 160/526 (30%), Positives = 264/526 (50%), Gaps = 22/526 (4%)

Query: 82  EHTRLRKDLKARHISMIAXXXXXXXXXXXXXXXXXYTAGPMSMFIAYAFVGVLVFFTMAA 141
           +H  L++ +K+RH+ MI+                 +  GP    I +  +G+ V+  + A
Sbjct: 86  KHENLKQTIKSRHMIMISLGTGIGTGLLVGSGTALHDGGPAGSAIGFLIMGLCVYCVIQA 145

Query: 142 LGEMA-SYIPL-DGFTSYASRYCDPALGFAVGYAYLCKYLILPPNQLTAAALVIQYWLDR 199
            GE+A  Y  L  GF +Y S   DPALGFA  + Y  ++L + P +L  A++ I++W   
Sbjct: 146 AGELAVCYTSLAGGFNAYPSFLIDPALGFATAWVYCLQWLCVFPLELVTASITIKFWPGS 205

Query: 200 EQVNPGVWITIFLVIIVAMNFIGVKFFGEFEFWLSTFKVIVMIGLIILLFVIMLGGGPTH 259
             VNP +++ IF V+I+ +NF G + + E EF+ ++ KV++MIG  I+  +I  G   T 
Sbjct: 206 RSVNPDIYVAIFYVLIIVINFFGARGYAEAEFFFNSCKVLMMIGFFIVGILINTGAVGTS 265

Query: 260 DRLGFRFYDHPGAFKPYSKSIDGSKGKXXXXXXXXXXXXXXXXGIELTGIVAAEAANPRK 319
             +G +++  PG+    +   D  KG                   E   + AAE ANPRK
Sbjct: 266 GYIGGKYWRDPGSLGGRTH-FDHFKGIVATLVNAAFSLGCS----EFVALTAAEQANPRK 320

Query: 320 SIPKAIKLTMYRIIVFYLVTIFLLGMCVAYDDPLLXXXXXXXXXXXXXPYVVAIINSGIK 379
           SIP A K  +Y+I V +L ++ L+G  V  D   L             PYV+A+   G+ 
Sbjct: 321 SIPAAAKKMIYKIFVVFLGSVILIGFLVPKDSHEL--MGSNDSDLHVSPYVIAVRMHGVN 378

Query: 380 ALPHIFNACVLMFVFSACNSDLYVASRTLYGLAIDNKAPKIFAVTNRWGVPYYSLLMSSC 439
            +P   NA +L+ V S  NS  Y +SR L+ LA  N APKIF   +R G P  ++++S  
Sbjct: 379 VVPSFINAVILLSVLSVGNSAFYSSSRLLHSLAEQNYAPKIFKYIDRAGRPLMAMIISIL 438

Query: 440 FCLLAYMSVSSGSAKIFNYFVNVVSIFGLLSWISILITYLCFFRAVKAQNVDRSRFAYRA 499
           F  + +++ S    ++F + + +  +  L +W +I ++++ F RA+  Q        ++A
Sbjct: 439 FGTICFVAASPKEEEVFKWLLAISGLSQLFTWSTICLSHIRFRRALAVQGYSTDELGFKA 498

Query: 500 PFQPYGSYFTLAFCILIAFIKNFTVFL----NHHFDYKNFITGYIGIPVFVISYFGYKFV 555
                GSY + A  +++A I  F V L        D ++F TGY+ +P+F++ YFGYK  
Sbjct: 499 QTGIIGSYVS-AIMMVLALIGQFWVSLVPMGATEPDAESFFTGYLAMPMFLLFYFGYKIW 557

Query: 556 KKTKIW----KPEEVDLYTFKAAIDEEEEQGKIADAERRERLKNSK 597
            K   W    + +++DL + +   D +    K  D E R +L+NS 
Sbjct: 558 NKD--WRLFIRADQIDLVSHRRIFDADVL--KQEDIEYRAKLRNSS 599

>YBR132C Chr2 complement(499652..501442) [1791 bp, 596 aa] {ON}
           AGP2High affinity polyamine permease, preferentially
           uses spermidine over putrescine; expression is
           down-regulated by osmotic stress; plasma membrane
           carnitine transporter, also functions as a low-affinity
           amino acid permease
          Length = 596

 Score =  249 bits (636), Expect = 6e-74,   Method: Compositional matrix adjust.
 Identities = 151/527 (28%), Positives = 254/527 (48%), Gaps = 15/527 (2%)

Query: 65  RLEDSEKQDDYMDDGKDEH----TRLRKDLKARHISMIAXXXXXXXXXXXXXXXXXYTAG 120
            +++ E +   +DD    +    T  R+ L+ RH+ +IA                 Y  G
Sbjct: 59  HVDEHEDRGSSIDDDSRTYLLYFTETRRKLENRHVQLIAISGVIGTALFVAIGKALYRGG 118

Query: 121 PMSMFIAYAFVGVLVFFTMAALGEMASYIPLDG-FTSYASRYCDPALGFAVGYAYLCKYL 179
           P S+ +A+A   V +     +  EM  + P+   F   A++  D +L     + +     
Sbjct: 119 PASLLLAFALWCVPILCITVSTAEMVCFFPVSSPFLRLATKCVDDSLAVMASWNFWFLEC 178

Query: 180 ILPPNQLTAAALVIQYWLDREQVNPGVWITIFLVIIVAMNFIGVKFFGEFEFWLSTFKVI 239
           +  P ++ +   +I YW  R+  + G+ + + +V+ + ++   VK++GE EFWL++FK+I
Sbjct: 179 VQIPFEIVSVNTIIHYW--RDDYSAGIPLAVQVVLYLLISICAVKYYGEMEFWLASFKII 236

Query: 240 VMIGLIILLFVIMLGGGPTHDRLGFRFYDHPGAFKPY---SKSIDGSKGKXXXXXXXXXX 296
           + +GL    F+ MLGG P HDR GFR Y     FK Y      +  S G           
Sbjct: 237 LALGLFTFTFITMLGGNPEHDRYGFRNYGE-SPFKKYFPDGNDVGKSSGYFQGFLACLIQ 295

Query: 297 XXXXXXGIELTGIVAAEAANPRKSIPKAIKLTMYRIIVFYLVTIFLLGMCVAYDDP-LLX 355
                 G E   ++A E   PRK +PKA K    R+   +L +   +G+  + +DP L  
Sbjct: 296 ASFTIAGGEYISMLAGEVKRPRKVLPKAFKQVFVRLTFLFLGSCLCVGIVCSPNDPDLTA 355

Query: 356 XXXXXXXXXXXXPYVVAIINSGIKALPHIFNACVLMFVFSACNSDLYVASRTLYGLAIDN 415
                       PYV+A+ N  I+ LP I N  ++   FSA N+  Y +SRT YG+A+D 
Sbjct: 356 AINEARPGAGSSPYVIAMNNLKIRILPDIVNIALITAAFSAGNAYTYCSSRTFYGMALDG 415

Query: 416 KAPKIFAVTNRWGVPYYSLLMSSCFCLLAYMSVSSGSAKIFNYFVNVVSIFGLLSWISIL 475
            APKIF   NR GVP YS+ +S  + L++ + ++S SA + N+ +N+++   L++++ + 
Sbjct: 416 YAPKIFTRCNRHGVPIYSVAISLVWALVSLLQLNSNSAVVLNWLINLITASQLINFVVLC 475

Query: 476 ITYLCFFRAVKAQNVDRSRFAYRAPFQPYGSYFTLAFCILIAFIKNFTVFLNHHFDYKNF 535
           I YL F RA   Q     +  +R+  QPY +   L  C  +  I+ +TVF    ++ ++F
Sbjct: 476 IVYLFFRRAYHVQQDSLPKLPFRSWGQPYTAIIGLVSCSAMILIQGYTVFFPKLWNTQDF 535

Query: 536 ITGYIGIPVFVISYFGYKFV---KKTKIWKPEEVDLYTFKAAIDEEE 579
           +  Y+ + + +  Y GYKF+    K     P E+D       I+  E
Sbjct: 536 LFSYLMVFINIGIYVGYKFIWKRGKDHFKNPHEIDFSKELTEIENHE 582

>CAGL0H08393g Chr8 (821998..823836) [1839 bp, 612 aa] {ON} highly
           similar to uniprot|P41815 Saccharomyces cerevisiae
           YDR046c PAP1
          Length = 612

 Score =  249 bits (635), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 166/542 (30%), Positives = 268/542 (49%), Gaps = 21/542 (3%)

Query: 65  RLEDSEKQDDYMDDGKDEHTRLRKDLKARHISMIAXXXXXXXXXXXXXXXXXYTAGPMSM 124
           R +DS   +D ++     H   +K +K+RH+ M++                   AGP S+
Sbjct: 73  RADDSPDHND-LEKTTTAHQEQKKTMKSRHVIMMSLGTGIGTGLLVSNGKGLSLAGPASL 131

Query: 125 FIAYAFVGVLVFFTMAALGEMA-SYIPLDG-FTSYASRYCDPALGFAVGYAYLCKYLILP 182
            IAY  V  + +F + A GEMA +Y  L G F +Y S +     GFA  + +  ++L + 
Sbjct: 132 VIAYGLVSFVTYFMIQAAGEMAVTYPTLPGSFNAYTSFFISKPFGFATTWLFCIQWLTVL 191

Query: 183 PNQLTAAALVIQYWLDREQVNPGVWITIFLVIIVAMNFIGVKFFGEFEFWLSTFKVIVMI 242
           P +L  AA+ I+YW     ++P V++ IF V ++ ++F GV+ +GE EF  +  K++++ 
Sbjct: 192 PLELITAAMTIKYW--NTSIDPDVFVIIFYVFLMFIHFFGVQAYGETEFIFNACKILMIG 249

Query: 243 GLIILLFVIMLGGGPTHDRLGFRFYDHPGAFKPYSKSIDGSKGKXXXXXXXXXXXXXXXX 302
           G II   V+  GG      +G +++  PGAF     S +G+  +                
Sbjct: 250 GFIIFAIVVNCGGAGKDGYIGGKYWHDPGAFA----SSNGAS-RFKGICYNLVNAYFSYG 304

Query: 303 GIELTGIVAAEAANPRKSIPKAIKLTMYRIIVFYLVTIFLLGMCVAYDDPLLXXXXXXXX 362
           G EL  +   +  NPRKS P A K  +YRI+V YL+T+ L+G  V ++   L        
Sbjct: 305 GNELFVLSVNDQKNPRKSTPAAAKSNVYRIVVIYLLTMILIGFVVPHNSSELLGASGGNG 364

Query: 363 XXXXXPYVVAIINSGIKALPHIFNACVLMFVFSACNSDLYVASRTLYGLAIDNKAPKIFA 422
                PYV+A    GIK +PHI NA +L+ + S  NS LY   R L  LA    AP+  +
Sbjct: 365 LHAS-PYVLAASIHGIKVVPHIINAVILIALISVANSSLYAGPRLLSSLAQQGYAPRFLS 423

Query: 423 VTNRWGVPYYSLLMSSCFCLLAYMSVSSGSAKIFNYFVNVVSIFGLLSWISILITYLCFF 482
             +R G P  +LL+S+   ++ + + S    ++F +   +  +  L +W SI+ +++ F 
Sbjct: 424 YVDRRGRPLTALLLSALVGVIGFAATSPREEEVFTWLAAISGLSELFTWTSIMFSHIRFR 483

Query: 483 RAVKAQNVDRSRFAYRAPFQPYGSYFTLAFCILIAFIKNFTVFLN-----HHFDYKNFIT 537
           RA+K QN       Y+A    +GSYF + F IL+ F   F V L+        D  +F  
Sbjct: 484 RAMKLQNKSLDTLGYKANTGLWGSYFGVGFNILV-FAAQFWVALSPPNSGGKCDANSFFA 542

Query: 538 GYIGIPVFVISYFGYKFVKK--TKIWKPEEVDLYTFKAAIDEEEEQGKIADAERRERLKN 595
            Y+ +P++++ YFGY    K  T +    +VDL   +   D E  + +  D E +ERL+N
Sbjct: 543 SYLAMPIWLVFYFGYMCWYKDFTVLTDLNQVDLDNHRKVYDPEFLRQE--DLENKERLRN 600

Query: 596 SK 597
           S 
Sbjct: 601 SS 602

>YKR039W Chr11 (515063..516871) [1809 bp, 602 aa] {ON}  GAP1General
           amino acid permease; Gap1p senses the presence of amino
           acid substrates to regulate localization to the plasma
           membrane when needed
          Length = 602

 Score =  248 bits (634), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 162/526 (30%), Positives = 275/526 (52%), Gaps = 22/526 (4%)

Query: 83  HTRLRKDLKARHISMIAXXXXXXXXXXXXXXXXXYTAGPMSMFIAYAFVGVLVFFTMAAL 142
            T L+  LK RH+ MIA                  T GP S+ I +   G +++  + AL
Sbjct: 83  QTPLKHHLKNRHLQMIAIGGAIGTGLLVGSGTALRTGGPASLLIGWGSTGTMIYAMVMAL 142

Query: 143 GEMASYIPLDG-FTSYASRYCDPALGFAVGYAYLCKYLILPPNQLTAAALVIQYWLDREQ 201
           GE+A   P+ G FT+YA+R+ D + G+A  + Y+ ++L++ P ++ +A++ + +W    +
Sbjct: 143 GELAVIFPISGGFTTYATRFIDESFGYANNFNYMLQWLVVLPLEIVSASITVNFWGTDPK 202

Query: 202 VNPGVWITIFLVIIVAMNFIGVKFFGEFEFWLSTFKVIVMIGLIILLFVIMLGGGPTHDR 261
              G ++ +F + IV +N  GVK +GE EF  S  KVI ++G IIL  ++  GGGPT   
Sbjct: 203 YRDG-FVALFWLAIVIINMFGVKGYGEAEFVFSFIKVITVVGFIILGIILNCGGGPTGGY 261

Query: 262 LGFRFYDHPGAFKPYSKSIDGSKGKXXXXXXXXXXXXXXXXGIELTGIVAAEAANPRKSI 321
           +G +++  PGAF     + D    K                G EL G+ A+E+  PRKS+
Sbjct: 262 IGGKYWHDPGAF-----AGDTPGAKFKGVCSVFVTAAFSFAGSELVGLAASESVEPRKSV 316

Query: 322 PKAIKLTMYRIIVFYLVTIFLLGMCVAYDDPLLXXXXXXXXXXXXXPYVVAIINSGIKAL 381
           PKA K   +RI +FY++++ ++G+ V Y+D  L             P+V+AI   GIK L
Sbjct: 317 PKAAKQVFWRITLFYILSLLMIGLLVPYNDKSLIGASSVDAAAS--PFVIAIKTHGIKGL 374

Query: 382 PHIFNACVLMFVFSACNSDLYVASRTLYGLAIDNKAPKIFAVTNRWGVPYYSLLMSSCFC 441
           P + N  +L+ V S  NS +Y  SRT+  LA     P+IF+  +R G P   + ++S F 
Sbjct: 375 PSVVNVVILIAVLSVGNSAIYACSRTMVALAEQRFLPEIFSYVDRKGRPLVGIAVTSAFG 434

Query: 442 LLAYMSVSSGSAKIFNYFVNVVSIFGLLSWISILITYLCFFRAVKAQNVDRSRFAYRAPF 501
           L+A+++ S    ++FN+ + +  +  L +W  I I ++ F +A+ AQ       ++++P 
Sbjct: 435 LIAFVAASKKEGEVFNWLLALSGLSSLFTWGGICICHIRFRKALAAQGRGLDELSFKSPT 494

Query: 502 QPYGSYFTLAFCILIAFIKNFTVF---LNHHFDYKNFITGYIGIPVFVISYFGYKFVKKT 558
             +GSY+ L F ++I FI  F V    +      + F   Y+  P+ ++ Y G+K  K+ 
Sbjct: 495 GVWGSYWGL-FMVIIMFIAQFYVAVFPVGDSPSAEGFFEAYLSFPLVMVMYIGHKIYKRN 553

Query: 559 -KIWKP-EEVDLYTFKAAIDEE-------EEQGKIADAERRERLKN 595
            K++ P E++D+ T +  +D +       EE+  +A   R  R+ N
Sbjct: 554 WKLFIPAEKMDIDTGRREVDLDLLKQEIAEEKAIMATKPRWYRIWN 599

>CAGL0L03267g Chr12 (374784..376577) [1794 bp, 597 aa] {ON} highly
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039w GAP1 general amino acid permease
          Length = 597

 Score =  248 bits (633), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 168/534 (31%), Positives = 268/534 (50%), Gaps = 28/534 (5%)

Query: 66  LEDSEKQDDYMDDGK----DEHTRLRKDLKARHISMIAXXXXXXXXXXXXXXXXXYTAGP 121
           L+++   DD  D  K      H  L+  LK RH+ MIA                  TAGP
Sbjct: 57  LDEAVVTDDMSDIEKIAHRTAHAPLKHHLKNRHLQMIAIGGAIGTGLFVGSGTALRTAGP 116

Query: 122 MSMFIAYAFVGVLVFFTMAALGEMASYIPLDG-FTSYASRYCDPALGFAVGYAYLCKYLI 180
             + I +   G +++  + A+GE++   P+ G FT+YA+R+ D + GFA  + Y+ ++L 
Sbjct: 117 AGILIGWGLTGTMIYCMVMAMGELSVVFPISGGFTTYATRFIDESFGFANNFNYMLQWLC 176

Query: 181 LPPNQLTAAALVIQYWLDREQVNPGVWITIFLVIIVAMNFIGVKFFGEFEFWLSTFKVIV 240
           + P ++ AA++ + YW    +   G ++ +F V+IV +N  GVK +GE EF  S  KV+ 
Sbjct: 177 VLPLEIVAASITVNYWGTDPKYRDG-FVALFWVVIVIINLFGVKGYGEAEFVFSIIKVLT 235

Query: 241 MIGLIILLFVIMLGGGPTHDRLGFRFYDHPGAFKPYSKSIDGSKGKXXXXXXXXXXXXXX 300
           +IG II+  V+  GGGP    +G +++  PGAF       D +  +              
Sbjct: 236 VIGFIIMGIVLNCGGGPEGGYIGGKYFHDPGAFVG-----DTAGARFQGVCSVFVTAAFS 290

Query: 301 XXGIELTGIVAAEAANPRKSIPKAIKLTMYRIIVFYLVTIFLLGMCVAYDDPLLXXXXXX 360
             G EL GI AAE+A PRKS+PKA K   +RI +FY++++ ++G+ V Y D  L      
Sbjct: 291 FAGSELIGIAAAESAEPRKSVPKAAKQVFWRITLFYMLSLLMVGLLVPYTDERLIGASSV 350

Query: 361 XXXXXXXPYVVAIINSGIKALPHIFNACVLMFVFSACNSDLYVASRTLYGLAIDNKAPKI 420
                  P+V+AI + GI+ LP + N  +L+ V S  NS +Y  SRTL  LA  N  PKI
Sbjct: 351 DAAAS--PFVIAITSHGIRGLPSVVNVVILIAVLSVGNSAVYGCSRTLCALAQQNFLPKI 408

Query: 421 FAVTNRWGVPYYSLLMSSCFCLLAYMSVSSGSAKIFNYFVNVVSIFGLLSWISILITYLC 480
           F   +R G P + +  +S F L+A+++ S    ++F + + +  +  L +W  I   ++ 
Sbjct: 409 FGYIDRSGRPLFGIAFTSAFGLVAFVAQSKKEGEVFAWLLALSGLSSLFTWGGICFCHIR 468

Query: 481 FFRAVKAQNVDRSRFAYRAPFQPYGSYFTLAFCILIAFIKNFTVFL---NHHFDYKNFIT 537
           F  A+ AQ        ++AP   YGS + L F I++ F+  F V L         + F  
Sbjct: 469 FRAALTAQGRSTDELPFKAPAGIYGSMWGL-FMIVLMFMAQFYVALFPPGGKPSAEVFFQ 527

Query: 538 GYIGIPVFVISYFGYK-FVKKTKIWKP----------EEVDLYTFKAAIDEEEE 580
            Y+  PV +  YFG+K + +  K+  P           E+DL   +  I EE++
Sbjct: 528 SYLSFPVVLAFYFGHKLYARNWKLLIPLSKLDIDTGRREMDLDVLRQEIAEEKQ 581

>TPHA0A00240 Chr1 complement(28756..30567) [1812 bp, 603 aa] {ON}
           Anc_5.158 YGR191W
          Length = 603

 Score =  248 bits (632), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 169/530 (31%), Positives = 264/530 (49%), Gaps = 21/530 (3%)

Query: 77  DDGKDEHT-RLRKDLKARHISMIAXXXXXXXXXXXXXXXXXYTAGPMSMFIAYAFVGVLV 135
           D  +D HT  + +DL  RH+  +A                  T GP S+ I +  V   +
Sbjct: 76  DIKEDIHTSNMNQDLNVRHLITLAVGGAIGTGLFVNSGASLNTGGPASLVIGWTIVSTAL 135

Query: 136 FFTMAALGEMASYIPL-DGFTSYASRYCDPALGFAVGYAYLCKYLILPPNQLTAAALVIQ 194
           F  + +LGE+A+  P+  GF  Y +R+ DP+  F+V   YL ++L+L P +L AA+L I+
Sbjct: 136 FTVINSLGELAAAYPVVGGFNVYMTRFVDPSFAFSVNLNYLVQWLVLLPLELVAASLTIR 195

Query: 195 YWLDREQVNPGVWITIFLVIIVAMNFIGVKFFGEFEFWLSTFKVIVMIGLIILLFVIMLG 254
           YW D   +N   W+ IF  +I+  N + VK FGE EF LS  K++ +IG  IL  V+  G
Sbjct: 196 YWDD--TINSDAWVAIFYTLILIANLLDVKSFGETEFILSLVKILAIIGFFILGIVLTCG 253

Query: 255 GGPTHDRLGFRFYDHPGAFKPYSKSIDGSKGKXXXXXXXXXXXXXXXXGIELTGIVAAEA 314
           GGP    +G +++  PGAF       D +  +                GIE+  + AAE+
Sbjct: 254 GGPKGGYIGGKYWHDPGAFVG-----DSAGTQFKGLCSVFVTAAFSYAGIEMIAVSAAES 308

Query: 315 ANPRKSIPKAIKLTMYRIIVFYLVTIFLLGMCVAYDDPLLXXXXXXXXXXXXXPYVVAII 374
            NPRK+IP A K T + I   Y+  + L+G  VAY+D  L             P V+AI 
Sbjct: 309 QNPRKTIPTAAKRTFWIITFSYITILTLVGCLVAYNDTRLLNGSSSVDVAAS-PLVIAIE 367

Query: 375 NSGIKALPHIFNACVLMFVFSACNSDLYVASRTLYGLAIDNKAPKIFAVTNRWGVPYYSL 434
           N GIK LP + NA +L+ + S  NS +Y  SR +  +A+    PK  +V ++ G P  ++
Sbjct: 368 NGGIKGLPSLMNAIILIAILSVANSAVYACSRCMVSMALIGNLPKGLSVVDKRGRPLRAI 427

Query: 435 LMSSCFCLLAYMSVSSGSAKIFNYFVNVVSIFGLLSWISILITYLCFFRAVKAQNVDRSR 494
             +  F LL++++ S    ++F +   +  +  +  W+ I I ++ F +A+  QN     
Sbjct: 428 FTTLFFGLLSFVAASDKQEEVFTWLSALSGLSTIFCWMGINIAHIRFRQAMTVQNRSLDE 487

Query: 495 FAYRAPFQPYGSYFTLA--FCILIA-FIKNFTVFLNHHFDYKNFITGYIGIPVFVISYFG 551
             Y +    YGSY+  A  F +LIA F  +         D + F  GY+  P+ +  Y G
Sbjct: 488 MPYLSQTGIYGSYYGTAILFLVLIASFWTSLFPLGGDGADAEAFFEGYLSFPILIACYIG 547

Query: 552 YK-FVKKTKIWKP-EEVDLYTFKAAIDEE--EEQGKIADAERRERLKNSK 597
           +K + K  +I  P EE+DL T +  +D +  +E+ KI     RE L+ S 
Sbjct: 548 HKLYFKNWRIMTPLEEIDLLTGRKEVDIDILKEELKI----EREALRQSS 593

>Suva_2.203 Chr2 complement(347891..349705) [1815 bp, 604 aa] {ON}
           YDR046C (REAL)
          Length = 604

 Score =  247 bits (631), Expect = 4e-73,   Method: Compositional matrix adjust.
 Identities = 167/548 (30%), Positives = 275/548 (50%), Gaps = 30/548 (5%)

Query: 63  SSRLEDSEKQDDYMDDGKDE---HTRLRKDLKARHISMIAXXXXXXXXXXXXXXXXXYTA 119
           S RLED    D+ ++DG      +  L+K +K+RH+ M++                   A
Sbjct: 64  SQRLED----DNDLEDGTRSMRSNNHLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLKLA 119

Query: 120 GPMSMFIAYAFVGVLVFFTMAALGEMA-SYIPLDG-FTSYASRYCDPALGFAVGYAYLCK 177
           GP S+ I Y  V  + +F + A GEM  +Y  L G F +Y S +   + GFA  + +  +
Sbjct: 120 GPGSLVIGYVLVSFVTYFMVQAAGEMGVTYPTLPGNFNAYNSIFVSKSFGFATTWLFCIQ 179

Query: 178 YLILPPNQLTAAALVIQYWLDREQVNPGVWITIFLVIIVAMNFIGVKFFGEFEFWLSTFK 237
           +L + P +L  +++ I+YW D   +N  V+I IF V ++ ++F GVK +GE EF  ++ K
Sbjct: 180 WLTVLPLELITSSMTIKYWND--TINADVFIAIFYVFLLFIHFFGVKAYGETEFIFNSCK 237

Query: 238 VIVMIGLIILLFVIMLGGGPTHDRLGFRFYDHPGAFKPYSKSIDGSKG-KXXXXXXXXXX 296
           ++++ G IIL  +I  GG      +G  ++ +PG+F       DGS   +          
Sbjct: 238 ILMIAGFIILSVIINCGGAGVDGYIGGEYWRNPGSFA------DGSSATRFKGICFILVT 291

Query: 297 XXXXXXGIELTGIVAAEAANPRKSIPKAIKLTMYRIIVFYLVTIFLLGMCVAYDDPLLXX 356
                 GIEL  +   E ANPRKS P A K ++YRI++ YL+T+ L+G  V +D+  L  
Sbjct: 292 AYFSFGGIELFVLSINEQANPRKSTPVAAKRSIYRILIIYLLTMILIGFNVPHDNDQLMG 351

Query: 357 XXXXXXXXXXXPYVVAIINSGIKALPHIFNACVLMFVFSACNSDLYVASRTLYGLAIDNK 416
                      PYV+A    G+K +PHI NA +L+ V S  NS LY A R +  LA    
Sbjct: 352 SGSSATHAS--PYVLAASIHGVKVIPHIINAVILISVISVANSALYAAPRLMCSLAQQGY 409

Query: 417 APKIFAVTNRWGVPYYSLLMSSCFCLLAYMSVSSGSAKIFNYFVNVVSIFGLLSWISILI 476
           APK     +R G P  +L++ S   L+ +++ SS   + F +   +  +  + +W  I++
Sbjct: 410 APKFLNYIDREGRPLRALVVCSFVGLVGFVACSSQEEQAFTWLAAIAGLSEIFTWSGIML 469

Query: 477 TYLCFFRAVKAQNVDRSRFAYRAPFQPYGSYFTLAFCILIAFIKNFTVFL-----NHHFD 531
           +++ F +A+K Q        Y++    +GSY+ + F IL+ F+  F V L     +   D
Sbjct: 470 SHIRFRKAMKVQGRSLDEVGYKSNTGIWGSYYGVIFNILV-FMAQFWVALSPPGSDGKCD 528

Query: 532 YKNFITGYIGIPVFVISYFGYKFVKK--TKIWKPEEVDLYTFKAAIDEEEEQGKIADAER 589
            ++F   Y+  P+++  Y GY    K  T +   +++DL   +   D E  + +  D E 
Sbjct: 529 VESFFQSYLAAPLWIFMYLGYMIYNKDFTLLNPLDKIDLDFHRRVYDPEIMRQE--DEEN 586

Query: 590 RERLKNSK 597
           +ERL+NS 
Sbjct: 587 KERLRNSS 594

>Kwal_33.13204 s33 complement(120622..122445) [1824 bp, 607 aa] {ON}
           YDR508C (GNP1) - high-affinity glutamine permease
           [contig 121] FULL
          Length = 607

 Score =  247 bits (631), Expect = 4e-73,   Method: Compositional matrix adjust.
 Identities = 161/529 (30%), Positives = 270/529 (51%), Gaps = 21/529 (3%)

Query: 80  KDEHTRLRKDLKARHISMIAXXXXXXXXXXXXXXXXXYTAGPMSMFIAYAFVGVLVFFTM 139
           +   T+L++ +  RH+ M++                 +  GP  + I YA +G  ++  +
Sbjct: 84  RQTETKLKQTITFRHVFMMSLGTGIGTGMLVGNGKALHNGGPAGLVIGYAIMGSCLYCII 143

Query: 140 AALGEMA-SYIPLDG-FTSYASRYCDPALGFAVGYAYLCKYLILPPNQLTAAALVIQYWL 197
            A GE+A SY  L G F +Y S   + A GF+V + Y  ++L + P +L  A++ I+YW 
Sbjct: 144 QAAGELAVSYSSLSGNFNAYPSMLIEQAFGFSVAWIYCLQWLCVLPLELVTASITIKYW- 202

Query: 198 DREQVNPGVWITIFLVIIVAMNFIGVKFFGEFEFWLSTFKVIVMIGLIILLFVIMLGGGP 257
               VNP +++ IF V+I+ +N  G + + E EF+ +  KV+++IG  IL  ++  GG  
Sbjct: 203 -TTSVNPDIFVAIFYVLIILVNMFGARGYAEAEFFFNCCKVLMIIGFFILGIIVNCGGAG 261

Query: 258 THDRLGFRFYDHPGAFKPYSKSIDGSKGKXXXXXXXXXXXXXXXXGIELTGIVAAEAANP 317
               +G R++++PGAF   +K I   KG                   E   + AAE ANP
Sbjct: 262 NDGYIGGRYWNNPGAFYG-TKPIHHFKG----IISTMVTAAFAFGATEFIALTAAEQANP 316

Query: 318 RKSIPKAIKLTMYRIIVFYLVTIFLLGMCVAYDDPLLXXXXXXXXXXXXXPYVVAIINSG 377
           R++IP A K  +YRI++ +L  I L+G  V ++ P L             PYV+A+ + G
Sbjct: 317 RRAIPSAAKKVVYRILLIFLAPIVLIGFLVPHNSPELMGSGSSATHAS--PYVIAVASHG 374

Query: 378 IKALPHIFNACVLMFVFSACNSDLYVASRTLYGLAIDNKAPKIFAVTNRWGVPYYSLLMS 437
           ++ +PH  NA +L+ V S  NS  Y +SR L  LA  + AP      +R G P  ++L+S
Sbjct: 375 VRVVPHFINAVILLSVLSVGNSAFYSSSRLLLALADQHYAPAWLKFIDRSGRPMRAMLVS 434

Query: 438 SCFCLLAYMSVSSGSAKIFNYFVNVVSIFGLLSWISILITYLCFFRAVKAQNVDRSRFAY 497
             F L+++++ S     +F + + +  +  L +WISI ++++ F +A+  Q        Y
Sbjct: 435 CVFGLISFVAASPKEETVFTWLLAISGLSQLFTWISICVSHIRFRKALIVQGKPIGELGY 494

Query: 498 RAPFQPYGSYFT--LAFCILIA-FIKNFTVFLNHHFDYKNFITGYIGIPVFVISYFGYKF 554
           ++     GSY+   +  CILI  F        +   D  +F   Y+ +P+FV+ YFG+K 
Sbjct: 495 KSQTGVAGSYYATFIMGCILIGQFWVAIAPMGSAKLDANSFFENYLALPLFVVLYFGFKI 554

Query: 555 VKKT-KIWKP-EEVDLYTFKAAIDEEEEQGKIADAERRERLKNSKTKGW 601
            K+  +++ P E++DL + +   DEE    K  DAE  E ++N   KGW
Sbjct: 555 WKRDWRLYIPLEQIDLDSHRKTFDEELL--KQEDAEYEENIRN---KGW 598

>KLTH0F01606g Chr6 complement(122821..124635) [1815 bp, 604 aa] {ON}
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508C GNP1 High-affinity glutamine permease also
           transports Leu Ser Thr Cys Met and Asn expression is
           fully dependent on Grr1p and modulated by the
           Ssy1p-Ptr3p- Ssy5p (SPS) sensor of extracellular amino
           acids
          Length = 604

 Score =  247 bits (631), Expect = 4e-73,   Method: Compositional matrix adjust.
 Identities = 168/559 (30%), Positives = 279/559 (49%), Gaps = 21/559 (3%)

Query: 47  KKDGLDINDMDNLSTVSSRLEDSEKQDDYMDDGKDEHTRLRKDLKARHISMIAXXXXXXX 106
           K+   + N  D + +   R+   E  +    D   +H  L++++K RH+ MI+       
Sbjct: 49  KRPEEEYNGGDGIHSTHERV-SGEDFERLAPDDSSKHKTLKQNIKPRHVLMISLATGIGT 107

Query: 107 XXXXXXXXXXYTAGPMSMFIAYAFVGVLVFFTMAALGEMAS-YIPLDG-FTSYASRYCDP 164
                     +  GP S+ I YA V  +++  + +  E+A  Y  L G F +Y +   D 
Sbjct: 108 GMLVGNGKSLHNGGPASLLIGYAIVSTMLYCVIQSASELAIIYTSLSGGFNAYPALLVDK 167

Query: 165 ALGFAVGYAYLCKYLILPPNQLTAAALVIQYWLDREQVNPGVWITIFLVIIVAMNFIGVK 224
           A  F+V + Y  ++L + P +L  A++ I+YW D   +NP  ++ IF V+++ +NFIG  
Sbjct: 168 AFAFSVSWVYCLQWLCILPLELVTASMTIKYWND--SINPDAFVVIFYVVLIVINFIGAA 225

Query: 225 FFGEFEFWLSTFKVIVMIGLIILLFVIMLGGGPTHDRLGFRFYDHPGAFKPYSKSIDGSK 284
            + E EF+ +T KV+++IG  IL  ++  GG      LG  ++  PGAF+  +  I+  K
Sbjct: 226 GYAEAEFFFNTCKVLMLIGFFILGIIVNCGGAGNDGYLGSVYWHDPGAFRG-NNGINRFK 284

Query: 285 GKXXXXXXXXXXXXXXXXGIELTGIVAAEAANPRKSIPKAIKLTMYRIIVFYLVTIFLLG 344
           G                 G E + + AAE  NP+KSI  A K  +YRII  YL+T  LLG
Sbjct: 285 G----LVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSASKKLVYRIIGIYLMTAALLG 340

Query: 345 MCVAYDDPLLXXXXXXXXXXXXXPYVVAIINSGIKALPHIFNACVLMFVFSACNSDLYVA 404
             V Y+ P L             P+V+AI + G+K +PHI NA +L+ V S  NS LY +
Sbjct: 341 FLVPYNSPELLGSGSAATHAS--PFVIAIASHGVKVVPHIINAVILLSVLSVANSALYSS 398

Query: 405 SRTLYGLAIDNKAPKIFAVTNRWGVPYYSLLMSSCFCLLAYMSVSSGSAKIFNYFVNVVS 464
           SR L  L+    APK+F   +R G P   LL+S  F LL +++ S     +F + + +  
Sbjct: 399 SRILLSLSEQGFAPKLFNYVDRRGRPVRCLLVSCVFGLLCFVAASPKEETVFTWLLAISG 458

Query: 465 IFGLLSWISILITYLCFFRAVKAQNVDRSRFAYRAPFQPYGSYFTLAFCILIAFIKNFTV 524
           +  L +W SI ++++ F R++  Q        Y++    +G+Y+ +   +LI  I  F V
Sbjct: 459 LSELFTWFSISLSHVRFRRSMIVQGRSLDELGYQSWTGVWGAYYAMIMILLI-LIGQFWV 517

Query: 525 FL----NHHFDYKNFITGYIGIPVFVISYFGYK-FVKKTKIWKP-EEVDLYTFKAAIDEE 578
            +    ++  D  NF   Y+ +P+ +  Y GYK + +  ++  P  EVDL + +   D E
Sbjct: 518 AISPVGSNKLDANNFFENYLAMPILIGLYLGYKLWYRDWRVIIPANEVDLVSHRKIFDAE 577

Query: 579 EEQGKIADAERRERLKNSK 597
             Q +    E +E+L+++ 
Sbjct: 578 IMQSE--QLEEKEQLRHAS 594

>TDEL0C05340 Chr3 complement(951770..953497) [1728 bp, 575 aa] {ON}
           Anc_3.397 YBR132C
          Length = 575

 Score =  246 bits (628), Expect = 5e-73,   Method: Compositional matrix adjust.
 Identities = 162/552 (29%), Positives = 267/552 (48%), Gaps = 22/552 (3%)

Query: 47  KKDGLDINDMDNLST--VSSRLEDSEKQD------DYMDDGKD--EHTRLRKDLKARHIS 96
           K   LD ND+D++ T  V S ++ ++K D      D  D   D    T+  + LK RH+ 
Sbjct: 13  KFQQLDTNDLDSVRTTIVESSVKPAKKTDWLGCVTDDEDSSSDLLYSTQTFRRLKNRHVQ 72

Query: 97  MIAXXXXXXXXXXXXXXXXXYTAGPMSMFIAYAFVGVLVFFTMAALGEMASYIPLDG-FT 155
           +IA                 Y  GP  + IA+A   V +     +  EM  ++P+   F 
Sbjct: 73  LIAISGVIGTALFVAIGKALYKGGPAFLLIAFALWCVPILCITVSTAEMVCFLPVSSPFL 132

Query: 156 SYASRYCDPALGFAVGYAYLCKYLILPPNQLTAAALVIQYWLDREQVNPGVWITIFLVII 215
             A+R  D +L     + +     +  P ++ +   +I YW  R+  +  + + + +V+ 
Sbjct: 133 RLAARCADDSLAVMASWNFWFLQCVQIPFEIVSVNTIIHYW--RDDYSAAIPLVVQIVLY 190

Query: 216 VAMNFIGVKFFGEFEFWLSTFKVIVMIGLIILLFVIMLGGGPTHDRLGFRFYDHPGAFKP 275
             ++   VK++GE EFWL++FK+I+ +GL +  F+ MLGG P HDR GFR+Y     FK 
Sbjct: 191 FLISICAVKYYGETEFWLASFKIILALGLFLFTFITMLGGNPKHDRYGFRYYGET-PFKK 249

Query: 276 Y----SKSIDGSKGKXXXXXXXXXXXXXXXXGIELTGIVAAEAANPRKSIPKAIKLTMYR 331
           Y     K    S G                 G E   ++A E   PRK +P+A K   YR
Sbjct: 250 YYPNGDKDAGASVGYFQGFLACLIQASFTIAGGEYISMLAGEVKLPRKVLPRAFKQVFYR 309

Query: 332 IIVFYLVTIFLLGMCVAYDDPLLXXXXXXXX-XXXXXPYVVAIINSGIKALPHIFNACVL 390
           +   +L +   +G+  + +DP L              PYV+A+ N GIK LP I NA ++
Sbjct: 310 LTFLFLGSCLCVGIICSANDPALTAAIDESRPGAGSSPYVIAMNNLGIKVLPDIVNAALI 369

Query: 391 MFVFSACNSDLYVASRTLYGLAIDNKAPKIFAVTNRWGVPYYSLLMSSCFCLLAYMSVSS 450
              FSA N+  Y +SRTLYG+A+D  AP+IF   N+ GVP YS+L+S  + L++ + ++ 
Sbjct: 370 TAAFSAGNAYTYCSSRTLYGMALDGYAPRIFTRCNKHGVPIYSVLISLLWGLISLLQLND 429

Query: 451 GSAKIFNYFVNVVSIFGLLSWISILITYLCFFRAVKAQNVDRSRFAYRAPFQPYGSYFTL 510
            SA + N+ +N+++   L+++  + I YL F RA         +  +++  QPY +   L
Sbjct: 430 NSAVVLNWLINLITASQLINFTVLCIIYLFFRRAYLLHKDILPKLPFKSWGQPYTAIVGL 489

Query: 511 AFCILIAFIKNFTVFLNHHFDYKNFITGYIGIPVFVISYFGYKFV---KKTKIWKPEEVD 567
                +  I+ +TVF    +  ++F+  Y+ + + +  Y GYKF+    + K   P+ VD
Sbjct: 490 VSATAMILIQGYTVFFPSLWTVRDFLFCYLMVFIDIGIYIGYKFIWRRGRDKFKDPKTVD 549

Query: 568 LYTFKAAIDEEE 579
                  I+  E
Sbjct: 550 FSKDLKEIESHE 561

>YDR508C Chr4 complement(1466453..1468444) [1992 bp, 663 aa] {ON}
           GNP1High-affinity glutamine permease, also transports
           Leu, Ser, Thr, Cys, Met and Asn; expression is fully
           dependent on Grr1p and modulated by the
           Ssy1p-Ptr3p-Ssy5p (SPS) sensor of extracellular amino
           acids
          Length = 663

 Score =  248 bits (634), Expect = 5e-73,   Method: Compositional matrix adjust.
 Identities = 163/538 (30%), Positives = 267/538 (49%), Gaps = 25/538 (4%)

Query: 68  DSEKQDDYMDDGKDEHTRLRKDLKARHISMIAXXXXXXXXXXXXXXXXXYTAGPMSMFIA 127
           D  KQ     + K E+  L+K +K RH  M++                   AGP  + I 
Sbjct: 129 DGIKQSPQEQEQKQEN--LKKSIKPRHTVMMSLGTGIGTGLLVGNSKVLNNAGPGGLIIG 186

Query: 128 YAFVGVLVFFTMAALGEMASYIP--LDGFTSYASRYCDPALGFAVGYAYLCKYLILPPNQ 185
           YA +G  V+  + A GE+A      + GF +Y     DPALGF+V + +  ++L + P +
Sbjct: 187 YAIMGSCVYCIIQACGELAVIYSDLIGGFNTYPLFLVDPALGFSVAWLFCLQWLCVCPLE 246

Query: 186 LTAAALVIQYWLDREQVNPGVWITIFLVIIVAMNFIGVKFFGEFEFWLSTFKVIVMIGLI 245
           L  A++ I+YW     VNP V++ IF V+IV +N  G K + E +F+ +  K+++++G  
Sbjct: 247 LVTASMTIKYWTT--SVNPDVFVVIFYVLIVVINVFGAKGYAEADFFFNCCKILMIVGFF 304

Query: 246 ILLFVIMLGGGPTHDRLGFRFYDHPGAFKPYSKSIDGSKGKXXXXXXXXXXXXXXXXGIE 305
           IL  +I  GG  T   +G +++  PGAF+     I   KG                   E
Sbjct: 305 ILAIIIDCGGAGTDGYIGSKYWRDPGAFRG-DTPIQRFKGVVATFVTAAFAFGMS----E 359

Query: 306 LTGIVAAEAANPRKSIPKAIKLTMYRIIVFYLVTIFLLGMCVAY-DDPLLXXXXXXXXXX 364
              + A+E +NPRK+IP A K  +YRI+  +L ++ L+G  V Y  D LL          
Sbjct: 360 QLAMTASEQSNPRKAIPSAAKKMIYRILFVFLASLTLVGFLVPYTSDQLLGAAGSATKAS 419

Query: 365 XXXPYVVAIINSGIKALPHIFNACVLMFVFSACNSDLYVASRTLYGLAIDNKAPKIFAVT 424
              PYV+A+ + G++ +PH  NA +L+ V S  N   Y +SR L  LA    APK F   
Sbjct: 420 ---PYVIAVSSHGVRVVPHFINAVILLSVLSVANGAFYTSSRILMSLAKQGNAPKCFDYI 476

Query: 425 NRWGVPYYSLLMSSCFCLLAYMSVSSGSAKIFNYFVNVVSIFGLLSWISILITYLCFFRA 484
           +R G P  ++L+S+ F ++A+ + S     +F + + +  +  L +WI+I ++++ F RA
Sbjct: 477 DREGRPAAAMLVSALFGVIAFCASSKKEEDVFTWLLAISGLSQLFTWITICLSHIRFRRA 536

Query: 485 VKAQNVDRSRFAYRAPFQPYGSYFTLAFCILIAFIKNFTVFL-----NHHFDYKNFITGY 539
           +K Q        Y++    +GS + +   +L A I  F V +           ++F   Y
Sbjct: 537 MKVQGRSLGEVGYKSQVGVWGSAYAVLMMVL-ALIAQFWVAIAPIGGGGKLSAQSFFENY 595

Query: 540 IGIPVFVISYFGYKFVKKT-KIWKP-EEVDLYTFKAAIDEEEEQGKIADAERRERLKN 595
           + +P+++  Y  YK  KK   ++ P ++VDL + +   DEE    K  D E +ERL+N
Sbjct: 596 LAMPIWIALYIFYKVWKKDWSLFIPADKVDLVSHRNIFDEELL--KQEDEEYKERLRN 651

>Smik_11.302 Chr11 (505026..506684) [1659 bp, 553 aa] {ON} YKR039W
           (REAL)
          Length = 553

 Score =  245 bits (626), Expect = 6e-73,   Method: Compositional matrix adjust.
 Identities = 153/480 (31%), Positives = 250/480 (52%), Gaps = 13/480 (2%)

Query: 83  HTRLRKDLKARHISMIAXXXXXXXXXXXXXXXXXYTAGPMSMFIAYAFVGVLVFFTMAAL 142
            T L+  LK RH+ MIA                  T GP S+ I +   G +++  + AL
Sbjct: 83  QTPLKHHLKNRHLQMIAIGGAIGTGLLVGSGTALRTGGPASLLIGWGSTGTMIYAMVMAL 142

Query: 143 GEMASYIPLDG-FTSYASRYCDPALGFAVGYAYLCKYLILPPNQLTAAALVIQYWLDREQ 201
           GE+A   P+ G FT+YA+R+ D + G+A  + Y+ ++L++ P ++ +A++ + +W    +
Sbjct: 143 GELAVIFPISGGFTTYATRFIDESFGYANNFNYMLQWLVVLPLEIVSASITVNFWGTDPK 202

Query: 202 VNPGVWITIFLVIIVAMNFIGVKFFGEFEFWLSTFKVIVMIGLIILLFVIMLGGGPTHDR 261
              G ++ +F V+IV +N  GVK +GE EF  S  KVI ++G IIL  ++  GGGP    
Sbjct: 203 YRDG-FVALFWVVIVIINMFGVKGYGEAEFVFSFIKVITVVGFIILGIILNCGGGPEGGY 261

Query: 262 LGFRFYDHPGAFKPYSKSIDGSKGKXXXXXXXXXXXXXXXXGIELTGIVAAEAANPRKSI 321
           +G +++  PGAF       D    K                G EL G+ A+E+  PRKS+
Sbjct: 262 IGGKYWHDPGAFAG-----DTPGAKFKGVCSVFVTSAFSFAGSELVGLAASESVEPRKSV 316

Query: 322 PKAIKLTMYRIIVFYLVTIFLLGMCVAYDDPLLXXXXXXXXXXXXXPYVVAIINSGIKAL 381
           PKA K   +RI +FY++++ ++G+ V Y+D  L             P+V+AI   GIK L
Sbjct: 317 PKAAKQVFWRITLFYILSLLMIGLLVPYNDKNLIGASSVDAAAS--PFVIAIKTHGIKGL 374

Query: 382 PHIFNACVLMFVFSACNSDLYVASRTLYGLAIDNKAPKIFAVTNRWGVPYYSLLMSSCFC 441
           P + N  +L+ V S  NS +Y  SRT+  LA     P+IFA  +R G P   + ++S F 
Sbjct: 375 PSVVNVVILIAVLSVGNSAIYACSRTMVALAEQRFLPQIFAYVDRKGRPLVGIGVTSAFG 434

Query: 442 LLAYMSVSSGSAKIFNYFVNVVSIFGLLSWISILITYLCFFRAVKAQNVDRSRFAYRAPF 501
           L+A+++ S     +FN+ + +  +  L +W  I I ++ F +A+ AQ  D    ++++P 
Sbjct: 435 LIAFVAASKKEGDVFNWLLALSGLSSLFTWGGICICHIRFRKALTAQGRDLDELSFKSPT 494

Query: 502 QPYGSYFTLAFCILIAFIKNFTVFL---NHHFDYKNFITGYIGIPVFVISYFGYKFVKKT 558
             +GSY+ L F ++I FI  F V L         + F   Y+  P+ +  Y G+K  K+ 
Sbjct: 495 GVWGSYWGL-FMVVIMFIAQFYVALFPVGGSPSAEGFFEAYLSFPLVMAMYIGHKIYKRN 553

>Kpol_1010.32 s1010 (82500..84299) [1800 bp, 599 aa] {ON}
           (82500..84299) [1800 nt, 600 aa]
          Length = 599

 Score =  246 bits (628), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 167/534 (31%), Positives = 273/534 (51%), Gaps = 17/534 (3%)

Query: 69  SEKQDDYMDDGKD-EHTRLRKDLKARHISMIAXXXXXXXXXXXXXXXXXYTAGPMSMFIA 127
           S   D  M   +D + + L KDL  RH+  +A                  T GP S+ I 
Sbjct: 71  SNPNDSNMLSKEDIDGSNLNKDLNIRHLLTLAVGGAIGTGLFVNSGASLNTGGPASLVIG 130

Query: 128 YAFVGVLVFFTMAALGEMASYIPL-DGFTSYASRYCDPALGFAVGYAYLCKYLILPPNQL 186
           +  V   +F  + +LGE+A+  P+  GF+ Y +R+ DP++ F++   YL ++L+L P +L
Sbjct: 131 WVIVSTALFTVINSLGELAAAYPVVGGFSVYMTRFIDPSIAFSINLNYLVQWLVLLPLEL 190

Query: 187 TAAALVIQYWLDREQVNPGVWITIFLVIIVAMNFIGVKFFGEFEFWLSTFKVIVMIGLII 246
            AA++ I+YW D+  +N   W++IF  +I  +N + VK FGE EF LS  K++ +IG  I
Sbjct: 191 VAASITIRYWNDK--INSDAWVSIFYTVIGLLNMLDVKSFGETEFVLSFIKILAIIGFTI 248

Query: 247 LLFVIMLGGGPTHDRLGFRFYDHPGAFKPYSKSIDGSKGKXXXXXXXXXXXXXXXXGIEL 306
           L  V+  GGGP    +G +++  PGAF  ++    GS+ K                GIE+
Sbjct: 249 LGIVLSCGGGPVGGYIGGKYWHDPGAFVGHTA---GSQFKGLCSVFVTAAFSYS--GIEM 303

Query: 307 TGIVAAEAANPRKSIPKAIKLTMYRIIVFYLVTIFLLGMCVAYDDPLLXXXXXXXXXXXX 366
             + AAE+ +PRK+IP A K T + I   Y+  + L+G  V YDDP L            
Sbjct: 304 IAVSAAESIDPRKTIPVAAKRTFWLITASYVTILTLIGCLVPYDDPRLLNGSSSVDVASS 363

Query: 367 XPYVVAIINSGIKALPHIFNACVLMFVFSACNSDLYVASRTLYGLAIDNKAPKIFAVTNR 426
            P V+AI N GIK LP + NA +L+ V S  NS +Y  SR +  +AI    PK     ++
Sbjct: 364 -PLVIAIENGGIKGLPSLMNAIILIAVLSVANSAVYACSRYMVSMAIIGNLPKQLGRIDK 422

Query: 427 WGVPYYSLLMSSCFCLLAYMSVSSGSAKIFNYFVNVVSIFGLLSWISILITYLCFFRAVK 486
            G P  + L++  F L+++++ S   A++F +   +  +  +  W+ I I+++ F RA+ 
Sbjct: 423 KGRPINATLVTLFFGLISFVAASDKQAEVFTWLSALSGLSTIFCWMGINISHIRFRRAMD 482

Query: 487 AQNVDRSRFAYRAPFQPYGSYF--TLAFCILI-AFIKNFTVFLNHHFDYKNFITGYIGIP 543
            Q        Y +    YGS++   + F +LI AF  +     +   +   F  GY+ +P
Sbjct: 483 IQGRSLEEMPYLSQVGVYGSWYGCIILFLVLIAAFWTSLFPVGSSQANATTFFEGYLSLP 542

Query: 544 VFVISYFGYKF-VKKTKIWKP-EEVDLYTFKAAIDEE--EEQGKIADAERRERL 593
           + +  Y G+KF  K  +++ P  E+DL + K  ID E   E+ K+ +   +++L
Sbjct: 543 ILLACYVGHKFYFKNWRLFTPYNEIDLDSGKRDIDLELLREEKKMEELALKKQL 596

>KLLA0A10813g Chr1 complement(936126..937880) [1755 bp, 584 aa] {ON}
           similar to uniprot|P38967 Saccharomyces cerevisiae
           YOL020W TAT2 Tryptophan permease high affinity
          Length = 584

 Score =  245 bits (626), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 187/598 (31%), Positives = 292/598 (48%), Gaps = 67/598 (11%)

Query: 47  KKDGLDINDMDNL-STVSSRLE--------------DSEKQDDYMD-------------- 77
           K+D  D++ MDNL S  S  LE              D +K++D                 
Sbjct: 2   KEDEYDMSKMDNLLSPSSGDLEMKFSDGIMSKETEIDLDKKEDKNKNIVRRMIDSFKPPL 61

Query: 78  DGKDEHTRLRKDLKARHISMIAXXXXXXXXXXXXXXXXXYTAGPMSMFIAYAFVGVLVFF 137
           DG      L++ LK+RH+ MIA                  T GP++M I ++  G  +  
Sbjct: 62  DGSYHSDNLKRKLKSRHLIMIAIGGSIGTGLFVGSGKALATGGPLAMIIGWSIAGSQMVG 121

Query: 138 TMAALGEMASYIPLDG-FTSYASRYCDPALGFAVGYAYLCKYLILPPNQLTAAALVIQYW 196
           T+  LGE+    P+ G F +Y++R  DP++ F V   Y+C++  + P +L A+A+ +Q+W
Sbjct: 122 TIHGLGEITMRFPVVGAFANYSTRLLDPSISFMVSSIYICQWYFVLPIELIASAMTVQFW 181

Query: 197 LDREQVNPGVWITIFLVIIVAMNFIGVKFFGEFEFWLSTFKVIVMIGLIILLFVIMLGGG 256
             +  V+P VW+ IF VI+V++N  GVK FGE EF  S  KVI +IG IIL  +++ GGG
Sbjct: 182 TTK--VDPVVWVAIFYVIVVSVNLFGVKVFGEAEFAFSLVKVITIIGFIILSIILICGGG 239

Query: 257 PTHDRLGFRFYDHPGAFKPYSKSIDGSKGKXXXXXXXXXXXXXXXXGIELTGIVAAEAAN 316
           P H  +G  ++ HPGA        +G KG                 G E+  + +AE  +
Sbjct: 240 PDHRFIGTEYWHHPGALA------NGFKG----VASVFVTASYSLGGSEMVCLCSAET-D 288

Query: 317 PRKSIPKAIKLTMYRIIVFYLVTIFLLGMCVAYDDPLLXXXXXXXXXXXXXPYVVAIINS 376
           P K +P AIK   +RI+ F+LV++ L+G  V Y +  L             P+V+AI  S
Sbjct: 289 P-KELPHAIKQVFWRIVFFFLVSLTLVGFLVPYTNENLLGGSSVNNS----PFVIAIKLS 343

Query: 377 GIKALPHIFNACVLMFVFSACNSDLYVASRTLYGLAIDNKAPKIFAVTNRWGVPYYSLLM 436
           GI+ LP I NA +L+ + S  NS ++ +SRTL  +A     P++F   +R G P   +++
Sbjct: 344 GIRVLPSIINAVILISILSVGNSCIFASSRTLCSMAHQGLIPRVFGYVDRAGRPLVGIIV 403

Query: 437 SSCFCLLAYMSVSSGSAKIFNYFVNVVSIFGLLSWISILITYLCFFRAVKAQNVDRSRFA 496
           +S F LLA++  S+    +F++ + +  +   + W+SI I+++ F  A+KAQN       
Sbjct: 404 NSLFGLLAFLVKSASMGVVFDWLMAIAGLATCVVWLSINISHIRFRLAMKAQNRSLDELE 463

Query: 497 YRAPFQPYGSYFTLAFCILIAFIKNFTVFL-------NHHFDYKNFITGYIGIPVFVISY 549
           +++    YGS ++    ILI  I  F + L       +     ++F   Y+   V V  +
Sbjct: 464 FKSSVGVYGSIYSATVNILI-LIAQFYISLWPVGGWTSSQQRTESFFKNYLCALVLVFVF 522

Query: 550 FGYK--FVKKTKIW---KP-EEVDLYTFKAAIDEEEEQGKIADAERRERLKNSKTKGW 601
             +K  F   T  W   KP  E+DL T +  ID E     I   E RER     +K W
Sbjct: 523 VTHKIYFKCSTGKWFDFKPLAEIDLETDRKNIDIE-----IVKQEVREREMYLASKPW 575

>SAKL0D02926g Chr4 (240708..242459) [1752 bp, 583 aa] {ON}
           uniprot|Q875S6 Saccharomyces kluyveri TAT1
          Length = 583

 Score =  245 bits (626), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 158/551 (28%), Positives = 269/551 (48%), Gaps = 34/551 (6%)

Query: 62  VSSRLEDSEKQDDYMDDGKDEH----TRLRKDLKARHISMIAXXXXXXXXXXXXXXXXXY 117
           ++S     E +D     G++E     T+++K +K+RH+ MI+                  
Sbjct: 42  INSFRRKGESEDVKELKGENEECGAATKMKKSIKSRHLLMISLGTGIGTGLLVGNGKALA 101

Query: 118 TAGPMSMFIAYAFVGVLVFFTMAALGEMA-SYIPLDG-FTSYASRYCDPALGFAVGYAYL 175
            AGP  + I YA   ++++  + A GE+   Y  + G +T+Y+S   DPALGF+V + Y 
Sbjct: 102 KAGPAGLVIGYAVASIMLYCIIQAAGELGICYSGMAGNYTAYSSLLVDPALGFSVSWVYC 161

Query: 176 CKYLILPPNQLTAAALVIQYWLDREQVNPGVWITIFLVIIVAMNFIGVKFFGEFEFWLST 235
            +++ + P QL  AA+ ++YW +    NP +++ +F V+I+ +N  G K + E EF  + 
Sbjct: 162 VQWMTVLPLQLVTAAMTVRYWTN---ANPDIFVAVFFVVIMVINMFGAKGYAEAEFLFNI 218

Query: 236 FKVIVMIGLIILLFVIMLGGGPTHDRLGFRFYDHPGAFKPYSKSIDGSKGKXXXXXXXXX 295
            KV+++ G +IL   I  GG  T   +G +++  PG+F        G KG          
Sbjct: 219 CKVLMIAGFVILGIAINCGGAGTSGYIGAKYWHSPGSFAA------GFKG----VCYVFC 268

Query: 296 XXXXXXXGIELTGIVAAEAANPRKSIPKAIKLTMYRIIVFYLVTIFLLGMCVAYDDPLLX 355
                  GIE+  + A+E  NPRKSIP A K  +YRI++ Y++T  ++   V Y+   L 
Sbjct: 269 YAAFSYGGIEVMVLTASEQENPRKSIPNACKKVIYRILMIYMLTTIIVCFLVPYNSSELM 328

Query: 356 XXXXXXXXXXXXPYVVAIINSGIKALPHIFNACVLMFVFSACNSDLYVASRTLYGLAIDN 415
                       P V+A+ + G+K +PHI NA +L+ V S  NS +Y A R L  L+   
Sbjct: 329 GSSGESASHAS-PLVIAVASHGVKIVPHIINAVILISVISVGNSSMYSAPRLLLSLSEQG 387

Query: 416 KAPKIFAVTNRWGVPYYSLLMSSCFCLLAYMSVSSGSAKIFNYFVNVVSIFGLLSWISIL 475
            APK     +R G P     ++    L+A+++ S     IF + + +  +  +  W SI 
Sbjct: 388 YAPKFLNYVDRQGRPLICFAITLLVALIAFVAASDAEEDIFAWLLAISGLSQIFIWTSIC 447

Query: 476 ITYLCFFRAVKAQNVDRSRFAYRAPFQPYGSYFTLAFCILIAFIKNFTVFL-----NHHF 530
           ++++ F  A+ AQ +   +  Y++    +GS+F +   +L+  I  F V +         
Sbjct: 448 LSHVRFRDAMHAQGLSLGQIGYKSQTGYWGSWFAIVISVLV-LIAQFWVAIAPIGEEGRL 506

Query: 531 DYKNFITGYIGIPVFVISYFGYKFVKKTKIWK----PEEVDLYTFKAAIDEEEEQGKIAD 586
           + + F   Y+  P+ + +YFGYK   K   W+      EVDL + +   DEE  + +  D
Sbjct: 507 NAETFFQNYLAFPILLGAYFGYKVYHKD--WRLCIPASEVDLSSHRNISDEEILRQE--D 562

Query: 587 AERRERLKNSK 597
            E  E++ NS 
Sbjct: 563 YEWNEKMSNSS 573

>Smik_16.115 Chr16 complement(214120..215931) [1812 bp, 603 aa] {ON}
           YGR191W (REAL)
          Length = 603

 Score =  246 bits (627), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 170/557 (30%), Positives = 273/557 (49%), Gaps = 31/557 (5%)

Query: 46  DKKDGLDINDMDNLSTVSSRLEDSE--KQDDYMDDGKDEHTRLRKDLKARHISMIAXXXX 103
             K    IN   N  T S     SE  +Q+D        +T L KDL  RH+  +A    
Sbjct: 50  SSKGSPGINQTTNDVTSSDHFRGSEGIEQEDI------NNTNLSKDLSVRHLLTLAVGGA 103

Query: 104 XXXXXXXXXXXXXYTAGPMSMFIAYAFVGVLVFFTMAALGEMASYIPL-DGFTSYASRYC 162
                         T GP S+ I +  +   +F  + +LGE+++  P+  GF  Y+ R+ 
Sbjct: 104 IGTGLYVNTGAALSTGGPASLVIDWVIISTCLFTVINSLGELSAAFPVVGGFNVYSMRFV 163

Query: 163 DPALGFAVGYAYLCKYLILPPNQLTAAALVIQYWLDREQVNPGVWITIFLVIIVAMNFIG 222
           +P+  FAV   YL ++L+L P +L AA++ I+YW D+  +N   W+ IF   I   N + 
Sbjct: 164 EPSFAFAVNLNYLAQWLVLLPLELVAASITIKYWNDK--INSDAWVAIFYATIALANMLD 221

Query: 223 VKFFGEFEFWLSTFKVIVMIGLIILLFVIMLGGGPTHDRLGFRFYDHPGAFKPYSKSIDG 282
           VK FGE EF LS  K++ +IG  IL  V+  GGGP    +G +++  PGAF  +S     
Sbjct: 222 VKSFGETEFVLSMIKILSIIGFTILGIVLSCGGGPHGGYIGGKYWHDPGAFVGHS----- 276

Query: 283 SKGKXXXXXXXXXXXXXXXXGIELTGIVAAEAANPRKSIPKAIKLTMYRIIVFYLVTIFL 342
           S  +                GIE+T + AAE+ NPR++IPKA K T + I   Y+  + L
Sbjct: 277 SGTQFKGLCSVFVTAAFSYSGIEMTAVSAAESKNPRETIPKAAKRTFWLITASYVAILTL 336

Query: 343 LGMCVAYDDPLLXXXXXXXXXXXXXPYVVAIINSGIKALPHIFNACVLMFVFSACNSDLY 402
           +G  V  +DP L             P V+AI N GIK LP + NA +L+ V S  NS +Y
Sbjct: 337 IGCLVPSNDPRLLNGSSSVDAASS-PLVIAIENGGIKGLPSLMNAIILIAVVSVANSAVY 395

Query: 403 VASRTLYGLAIDNKAPKIFAVTNRWGVPYYSLLMSSCFCLLAYMSVSSGSAKIFNYFVNV 462
             SR +  +A     PK     ++ G P  ++L++  F LL++++ S   A++F +   +
Sbjct: 396 ACSRCMVAMAHIGNLPKFLNRVDKRGRPMNAILLTLFFGLLSFVAASDKQAEVFTWLSAL 455

Query: 463 VSIFGLLSWISILITYLCFFRAVKAQNVDRSRFAYRAPFQPYGSY--FTLAFCILIA-FI 519
             +  +  W++I ++++ F +A+K Q        + +     GS+  F + F +LIA F 
Sbjct: 456 SGLSTIFCWMAINLSHIRFRQAMKVQERSLDELPFISQTGVKGSWYGFIVLFLVLIASFW 515

Query: 520 KNFTVFLNHHFDYKNFITGYIGIPVFVISYFGYKFVKK--TKIWKPEEVDLYTFKAAIDE 577
            +     +   + ++F  GY+  P+ ++ YFG+K   +  T + K E++DL T +  +D 
Sbjct: 516 TSLFPLGSSGANAESFFEGYLSFPILIVCYFGHKIYTRNWTLMVKLEDIDLDTGRKQVDL 575

Query: 578 EEEQGKIADAERRERLK 594
                    A RRE +K
Sbjct: 576 ---------ALRREEMK 583

>NCAS0A10680 Chr1 complement(2127039..2128820) [1782 bp, 593 aa]
           {ON} 
          Length = 593

 Score =  245 bits (625), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 164/544 (30%), Positives = 275/544 (50%), Gaps = 26/544 (4%)

Query: 65  RLEDSEKQDDYMDDGKD---EHTRLRKDLKARHISMIAXXXXXXXXXXXXXXXXXYTAGP 121
           R +DS + D  ++DG     + + L+K +K+RH+ M+                     GP
Sbjct: 53  RAQDSTEND--LEDGTKPLGDASHLKKAMKSRHVIMMCVGTGIGTGLLVANASGLSYGGP 110

Query: 122 MSMFIAYAFVGVLVFFTMAALGEMA-SYIPLDG-FTSYASRYCDPALGFAVGYAYLCKYL 179
            S+ I Y  V  + +F + A GEMA +Y  L G F SY S +     GFA  + +  ++L
Sbjct: 111 GSLVIGYVLVSFVTYFMIQAAGEMAVAYPTLPGNFNSYTSMFISKPFGFATVWLFFIQWL 170

Query: 180 ILPPNQLTAAALVIQYWLDREQVNPGVWITIFLVIIVAMNFIGVKFFGEFEFWLSTFKVI 239
            + P +L  A+L I+YW D+  +N  V+I IF V ++ ++F GVK +GE EF  ++ KV+
Sbjct: 171 TVFPLELITASLTIKYWNDK--INADVFIVIFYVFLLFIHFFGVKAYGEAEFIFNSCKVL 228

Query: 240 VMIGLIILLFVIMLGGGPTHDRLGFRFYDHPGAFKPYSKSIDGSKGKXXXXXXXXXXXXX 299
           ++ G IIL  VI  GG      +G +++  PG+F     S++  KG              
Sbjct: 229 MIAGFIILSIVINCGGAGKDGYIGAKYWRDPGSFAE-GDSVEKFKG----ICYILVTAYF 283

Query: 300 XXXGIELTGIVAAEAANPRKSIPKAIKLTMYRIIVFYLVTIFLLGMCVAYDDPLLXXXXX 359
              G EL  +   E  NPRKS P+A K ++YRI++ YL+T+ L+G  V +++  L     
Sbjct: 284 SYGGAELFSLSVNEQENPRKSTPQAAKQSIYRILIIYLLTMILIGFNVPHNNDQLMGSGG 343

Query: 360 XXXXXXXXPYVVAIINSGIKALPHIFNACVLMFVFSACNSDLYVASRTLYGLAIDNKAPK 419
                   PYV+A    G+K +PH  NA +L+ V S  NS LY + R +  LA    APK
Sbjct: 344 SATHAS--PYVLAASIHGVKVVPHFINAVILISVISVANSALYASPRLMCSLAEQGYAPK 401

Query: 420 IFAVTNRWGVPYYSLLMSSCFCLLAYMSVSSGSAKIFNYFVNVVSIFGLLSWISILITYL 479
                +R G P  +L++ + F ++ ++S SS   ++F +   +  +  L +W  I+++++
Sbjct: 402 FLDYVDREGRPLRALILCAVFGVIGFVSASSKEEEVFTWLAAIAGLSELFTWSGIMLSHV 461

Query: 480 CFFRAVKAQNVDRSRFAYRAPFQPYGSYFTLAFCILIAFIKNFTVF-----LNHHFDYKN 534
            F + +K          +RA    +GS + ++F +L+ FI  F V      L+   D ++
Sbjct: 462 RFRQCMKLHGRSEEEIGFRAVTGIWGSMYGISFNMLV-FIAQFWVALAPPSLHGKVDAES 520

Query: 535 FITGYIGIPVFVISYFGYKFVKK--TKIWKPEEVDLYTFKAAIDEEEEQGKIADAERRER 592
           F   Y+  P+++  YFGY   K+  T +   +++DL   +   D E  + +  D E +E+
Sbjct: 521 FFQSYLAAPIWLFFYFGYMLYKRDFTFLVPLDKIDLNFHRRIYDPELIRQE--DEENKEK 578

Query: 593 LKNS 596
           +KNS
Sbjct: 579 IKNS 582

>Kwal_26.9612 s26 complement(1291552..1293183) [1632 bp, 543 aa]
           {ON} YFL055W (AGP3) - Amino acid permease [contig 363]
           FULL
          Length = 543

 Score =  244 bits (622), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 159/547 (29%), Positives = 267/547 (48%), Gaps = 23/547 (4%)

Query: 54  NDMDNLSTVSSRLEDSEKQDDYMDDGKDEHTRLRKDLKARHISMIAXXXXXXXXXXXXXX 113
            D+D L    + +E    + D +++  D H+ +++ LK RHIS++A              
Sbjct: 11  EDLDKLEPKIAEVELQRLETDSLNE-FDPHSGVKRALKNRHISLLALGGIIGPGCLIGAG 69

Query: 114 XXXYTAGPMSMFIAYAFVGVLVFFTMAALGEMASYIPLDG-FTSYASRYCDPALGFAVGY 172
                 GP+++ + +  +G++ F  M ++GE+ +  P  G F + A R+    L    GY
Sbjct: 70  NALNKGGPLALLLGFGIIGLVCFSIMESIGELVTLYPSGGGFITLARRFHSEGLSAVSGY 129

Query: 173 AYLCKYLILPPNQLTAAALVIQYWLDREQVNPGVWITIFLVIIVAMNFIGVKFFGEFEFW 232
           AY+  +  +  N+    + ++Q+W    QV    +  IF    +    IGV  FGE E+W
Sbjct: 130 AYIVVFFAVLANEYNTISSILQFW--GPQVPIYGYTLIFWFFFLVFQLIGVGAFGECEYW 187

Query: 233 LSTFKVIVMIGLIILLFVIMLGGGPTHDRLGFRFYDHPGAFKPYSKSIDGSKGKXXXXXX 292
           L+ FK++ ++   I   V M GG P    +GF+++ +PGA         G +G       
Sbjct: 188 LAWFKILGLVAFYIFSIVYMSGGIPGKPPIGFQYWKNPGALS------HGFRG----IAV 237

Query: 293 XXXXXXXXXXGIELTGIVAAEAANPRKSIPKAIKLTMYRIIVFYLVTIFLLGMCVAYDDP 352
                     G E   + A E+ NPRK++P A++ T +RI++ YL   F  G+ V Y+DP
Sbjct: 238 VFVFCSTFYSGTESVALAATESRNPRKAVPLAVRQTFWRILIVYLGISFFYGVTVPYNDP 297

Query: 353 LLXXXXXXXXXXXXXPYVVAIINSGIKALPHIFNACVLMFVFSACNSDLYVASRTLYGLA 412
            L             P  +A+  +G     H+ NA +LM   SA NS LY+ SRTL  LA
Sbjct: 298 TLGAQTKSLKS----PISIALSRAGWAGGVHLVNAFILMTCISAINSSLYIGSRTLSHLA 353

Query: 413 IDNKAPKIFAVTNRWGVPYYSLLMSSCFCLLAYMSVSSGSAKIFNYFVNVVSIFGLLSWI 472
            +  AP+I A T++ GVP  +L++ +   L++ M+VS G++  +NY VN+  +   + W 
Sbjct: 354 HEGLAPRILAWTDKRGVPVPALIVFNALGLISLMNVSVGASNAYNYIVNLSGVGVFIVWS 413

Query: 473 SILITYLCFFRAVKAQNVDRSRFAYRAPFQPYGSYFTLAFCILIAFIKNFTVFLNHHFDY 532
           +I IT+L F +A  AQ    S   YRA F P+ + F+LA  I +A I+ +T  +   F  
Sbjct: 414 AISITHLRFRKAWVAQGRSLSELPYRALFYPWTTIFSLAANIFLALIQGWTSLV--PFVA 471

Query: 533 KNFITGYIGIPVFVISYFGYKFVKKTKIWKPEEVDLYTFKAAIDEEEEQGKIADAERRER 592
           K+F+  YI +P   + Y G  F K       + V+++       +  +  + +D E    
Sbjct: 472 KDFVDAYILLPAAGLLYVGINFWKNRNF---KTVNIHGINLEEGQRRDLDEDSDDETGTA 528

Query: 593 LKNSKTK 599
            K+++ K
Sbjct: 529 PKSTRMK 535

>KAFR0D00500 Chr4 complement(77541..79394) [1854 bp, 617 aa] {ON} 
          Length = 617

 Score =  245 bits (626), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 156/554 (28%), Positives = 274/554 (49%), Gaps = 27/554 (4%)

Query: 54  NDMDNLSTVSSRLEDSEKQDDYMDDGKDEHTRLRKDLKARHISMIAXXXXXXXXXXXXXX 113
           N+M+ + +  S  + +  +   +D+  +E  +L+K ++ RH+ MI               
Sbjct: 69  NEMNPILSHESVFDTAVVEISAVDNQINE--KLKKTIQPRHVIMITLGTGVGTGLLVGNG 126

Query: 114 XXXYTAGPMSMFIAYAFVGVLVFFTMAALGEMA-SYIPL-DGFTSYASRYCDPALGFAVG 171
                AGP  + I YA +   ++  M A+GEMA +Y+ L  GF++Y     DP L FAV 
Sbjct: 127 TTLSHAGPAGLIIGYAIMSTCIYCVMQAVGEMAVNYLTLIGGFSAYPGFLIDPGLNFAVS 186

Query: 172 YAYLCKYLILPPNQLTAAALVIQYWLDREQVNPGVWITIFLVIIVAMN-FIGVKFFGEFE 230
           + Y  ++  + P +L  A++ IQYW  +  VN  +++ IF ++++ +N F G + + E E
Sbjct: 187 WIYCIQWFCVCPLELVTASMTIQYWTTK--VNADIFVLIFYLLMIGINIFGGARGYAEAE 244

Query: 231 FWLSTFKVIVMIGLIILLFVIMLGGGPTHDRLGFRFYDHPGAFKPYSKSIDGSKGKXXXX 290
           F+ +  K+++M G  IL  +++ GG      +G R++  PGAF+      D    +    
Sbjct: 245 FFCNVCKILMMTGFFILGIILICGGAGNSGFIGARYWHSPGAFRG-----DNGINRFKGI 299

Query: 291 XXXXXXXXXXXXGIELTGIVAAEAANPRKSIPKAIKLTMYRIIVFYLVTIFLLGMCVAYD 350
                       G E   I A+E ANPRK+IP A K  +YR ++ Y+ +I ++G  V Y+
Sbjct: 300 VSTLVTAAFAFGGTEFLAITASEQANPRKAIPSAAKKVIYRALIIYVGSIIIVGFLVPYN 359

Query: 351 DPLLXXXXXXXXXXXXXPYVVAIINSGIKALPHIFNACVLMFVFSACNSDLYVASRTLYG 410
              L             PYV+A+ + GI+ +PH  NA +L+ VFS  +S  Y +SR L  
Sbjct: 360 SSELLGSSGPATKAS--PYVIAVASHGIRVVPHFINAVILISVFSVADSAFYSSSRLLLT 417

Query: 411 LAIDNKAPKIFAVTNRWGVPYYSLLMSSCFCLLAYMSVSSGSAKIFNYFVNVVSIFGLLS 470
           LA    APKIF   ++ G P    ++ +   ++++ + SS  A +FN+ +++  +  + +
Sbjct: 418 LARQGFAPKIFTYVDKRGRPTLGFVVGAIIAIISFCACSSKEADVFNWLLSISGLSEVFT 477

Query: 471 WISILITYLCFFRAVKAQNVDRSRFAYRAPFQPYGSYFTLAFCILIAFIKNFTVFL---- 526
           W  I ++++ F RA+K Q        +++    +GS +     IL+  I  F V +    
Sbjct: 478 WAIISLSHIRFRRAMKVQGRSLDEIGFKSQAGVWGSVYAFVMMILV-LIGQFWVGIVPVG 536

Query: 527 NHHFDYKNFITGYIGIPVFVISYFGYKFVKKTKIW----KPEEVDLYTFKAAIDEEEEQG 582
               D  +F   Y+ +PVF++ YFGYK   +   W    + + +DL   +   D E  + 
Sbjct: 537 EDSADAVSFFQAYLAMPVFIVLYFGYKIWNRD--WRLFIRAKNIDLIAHRHIYDPELLRQ 594

Query: 583 KIADAERRERLKNS 596
           +    E RER +N+
Sbjct: 595 E--RKEMRERARNA 606

>Kpol_1052.16 s1052 (44303..46144) [1842 bp, 613 aa] {ON}
           (44303..46144) [1842 nt, 614 aa]
          Length = 613

 Score =  245 bits (626), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 174/545 (31%), Positives = 270/545 (49%), Gaps = 20/545 (3%)

Query: 65  RLEDSEKQDDYMDDGKD-EHTRLRKDLKARHISMIAXXXXXXXXXXXXXXXXXYTAGPMS 123
           R E   +  D  +DG+  +   L+K +K RH+ M++                 + AGP  
Sbjct: 73  RAEHPREHIDGFEDGESKDGIHLKKQMKTRHVVMMSLGTGIGTGLLIANAKGLHFAGPAP 132

Query: 124 MFIAYAFVGVLVFFTMAALGEMA-SYIPLDG-FTSYASRYCDPALGFAVGYAYLCKYLIL 181
           + I Y  V  + +F + A GE+A +Y  L G F SY         GFA  +    ++L +
Sbjct: 133 LVIGYGMVSFVTYFMIQAAGELAVAYPTLPGNFNSYFGILISKPFGFATVWLAAVQWLTV 192

Query: 182 PPNQLTAAALVIQYWLDREQVNPGVWITIFLVIIVAMNFIGVKFFGEFEFWLSTFKVIVM 241
            P +  AA+L I+YW DR  ++  V++ IF V ++ ++F+GV+ +GE EF  +  KV+++
Sbjct: 193 LPLEFIAASLTIKYWNDR--ISGDVFVVIFYVFLLFIHFVGVRAYGETEFIFNLCKVLMI 250

Query: 242 IGLIILLFVIMLGGGPTHDRLGFRFYDHPGAFKPYSKSIDGSKGKXXXXXXXXXXXXXXX 301
           IG IIL  VI  GG      +G ++++ PGAF   +    GS+ K               
Sbjct: 251 IGFIILSIVINAGGAGNDGYIGGKYWNDPGAF---AGETAGSRFKGVCYILVTGYFSYG- 306

Query: 302 XGIELTGIVAAEAANPRKSIPKAIKLTMYRIIVFYLVTIFLLGMCVAYDDPLLXXXXXXX 361
            G EL  +   E  NPRKS P+A K ++YRI++ YL+T+ L+G  V Y+DP L       
Sbjct: 307 -GTELFVLSVNEQENPRKSTPQAAKHSIYRIVIIYLLTMILIGFNVPYNDPRLMGADDAS 365

Query: 362 XXXXXXPYVVAIINSGIKALPHIFNACVLMFVFSACNSDLYVASRTLYGLAIDNKAPKIF 421
                 PYV+A    G+K +PH  NA VL+ + S  NS LY A R +  LA    APKI 
Sbjct: 366 GSHAS-PYVLAASIHGVKIVPHFINAVVLIALISVGNSALYAAPRMMVSLAEQGFAPKIM 424

Query: 422 AVTNRWGVPYYSLLMSSCFCLLAYMSVSSGSAKIFNYFVNVVSIFGLLSWISILITYLCF 481
           A  +R G P  SL + + F L+ + + SS   ++F +   +  +  L +W +  I+++ F
Sbjct: 425 AYVDREGRPLVSLGICALFGLIGFAASSSKEEQVFTWLAAIAGLSELFTWSAFFISHIRF 484

Query: 482 FRAVKAQNVDRSRFAYRAPFQPYGSYFTLAFCILIAFIKNFTVFL----NHHFDYKNFIT 537
             A+K Q  D     + A    YGS++ L F IL+ F   F V L    +     ++F  
Sbjct: 485 RWAMKLQGKDIKEVGFLASTGLYGSFYGLFFNILV-FAAQFWVALSPIGSKKVGAESFFE 543

Query: 538 GYIGIPVFVISYFGYK-FVKKTKIWKP-EEVDLYTFKAAIDEEEEQGKIADAERRERLKN 595
            Y+  P+++  YFGY  + K      P E +DL  F   I + EE  +I + + +E  KN
Sbjct: 544 SYLAFPIWLFFYFGYMVWAKDFTFLNPLESIDL-DFHRRIYDPEEMAEI-NRQEKEEYKN 601

Query: 596 SKTKG 600
           S   G
Sbjct: 602 SSIVG 606

>TPHA0B04750 Chr2 (1119282..1121201) [1920 bp, 639 aa] {ON} Anc_1.50
           YDR508C
          Length = 639

 Score =  246 bits (628), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 174/551 (31%), Positives = 278/551 (50%), Gaps = 27/551 (4%)

Query: 59  LSTVSSRLEDSE-----KQDDYMDDGKDEHTRLRKDLKARHISMIAXXXXXXXXXXXXXX 113
           +  VS   ED E        ++      E   L+K +K RH+ MI+              
Sbjct: 90  VHAVSKAREDDEIMQSVASAEHRKVNNTESDDLQKTIKPRHVIMISLGTGIGTGLLVGNS 149

Query: 114 XXXYTAGPMSMFIAYAFVGVLVFFTMAALGEMAS-YIPLDG-FTSYASRYCDPALGFAVG 171
                AGP  + I Y+ +G  ++  + A GEMA  Y  L+G F +Y S   DPALGF+V 
Sbjct: 150 SVLSAAGPAPLVIGYSIMGSCLYCIIQAAGEMAVVYSDLNGGFNNYPSFLLDPALGFSVA 209

Query: 172 YAYLCKYLILPPNQLTAAALVIQYWLDREQVNPGVWITIFLVIIVAMNFIGVKFFGEFEF 231
           + Y  ++L + P +L  A+L I+YW  +  V+P V++ IF V+I+++N  G + + E EF
Sbjct: 210 WVYCLQWLCVCPLELVTASLTIKYWTTK--VDPDVFVIIFYVLIISINVFGARGYAEAEF 267

Query: 232 WLSTFKVIVMIGLIILLFVIMLGGGPTHDRLGFRFYDHPGAFKPYSKSIDGSKGKXXXXX 291
           + +  KV++MIG  IL  +I  GG      LG +++  PGAF+    ++D  KG      
Sbjct: 268 FFNVCKVLMMIGFFILGIIITAGGAGNDGYLGAKYWHEPGAFRG-EHAVDRFKG----VM 322

Query: 292 XXXXXXXXXXXGIELTGIVAAEAANPRKSIPKAIKLTMYRIIVFYLVTIFLLGMCVAYD- 350
                        E   + AAE +NPRK+IP A K  +YRI++ +LV+I +LG  V YD 
Sbjct: 323 DTFVAAAFAFGATEFIALTAAEQSNPRKAIPSAAKKVLYRIVLIFLVSIIMLGFLVPYDS 382

Query: 351 DPLLXXXXXXXXXXXXXPYVVAIINSGIKALPHIFNACVLMFVFSACNSDLYVASRTLYG 410
           D LL             PYV+A+   G++ +PH  NA +L+ V S  NS  Y +SR L  
Sbjct: 383 DQLLGSSGSGVKAS---PYVLAVSLHGVRVVPHFINAVILLSVLSVGNSAFYSSSRLLLS 439

Query: 411 LAIDNKAPKIFAVTNRWGVPYYSLLMSSCFCLLAYMSVSSGSAKIFNYFVNVVSIFGLLS 470
           L+    APK F   +R G P  ++LMS+ F ++A+ + S     +FN+ + +  +  L +
Sbjct: 440 LSQQGYAPKWFDYVDRQGRPARAMLMSALFGVIAFCATSPKETDVFNWLLAISGLSQLFT 499

Query: 471 WISILITYLCFFRAVKAQNVDRSRFAYRAPFQPYGSYFTLAFCILIAFIKNFTVFL---- 526
           W +I ++++ F  A+K Q        + +    YGS +     IL A +  F V +    
Sbjct: 500 WFAICMSHVRFRYAMKVQGRSIGEVGFHSQTGVYGSLYAATMMIL-ALMAQFWVAIAPLN 558

Query: 527 NHHFDYKNFITGYIGIPVFVISYFGYK-FVKKTKIW-KPEEVDLYTFKAAIDEEEEQGKI 584
               D +NF   Y+ +P+ +  YFGYK + +  K++ K +++DL + +   DE     K 
Sbjct: 559 EGKLDAQNFFQSYLAMPILIALYFGYKLYYRDWKLYIKADKIDLISHRQIFDENIL--KQ 616

Query: 585 ADAERRERLKN 595
            D E +E+L+N
Sbjct: 617 EDEEYKEKLRN 627

>Suva_2.716 Chr2 complement(1256781..1258592) [1812 bp, 603 aa] {ON}
           YKR039W (REAL)
          Length = 603

 Score =  245 bits (625), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 174/563 (30%), Positives = 290/563 (51%), Gaps = 32/563 (5%)

Query: 51  LDINDMDNLSTVS-----SRLEDS------EKQDDYMDDGKD-----EHTRLRKDLKARH 94
           L  N+ DN S  S     +R  DS      E+ D  + D +        + L+  LK+RH
Sbjct: 36  LSSNNNDNESRGSIRCKWTRFVDSFKRIELEELDPNLTDAEKIAIATARSPLKHTLKSRH 95

Query: 95  ISMIAXXXXXXXXXXXXXXXXXYTAGPMSMFIAYAFVGVLVFFTMAALGEMASYIPLDG- 153
           + MIA                  TAGP  + I +   G +++  + A+GE+A   P+ G 
Sbjct: 96  LHMIAVGGAIGTGLFVGSGKALRTAGPAGILIGWTVTGTMIYSMVMAVGELAVVFPVSGG 155

Query: 154 FTSYASRYCDPALGFAVGYAYLCKYLILPPNQLTAAALVIQYWLDREQVNPGVWITIFLV 213
           FT+YA+R+ D + GFA+ + Y+ ++LI  P ++ +A++ + YW    +   G ++ +F V
Sbjct: 156 FTTYATRFIDESFGFAINFNYMLQWLITLPLEIVSASITVNYWGVDAKYRDG-FVALFWV 214

Query: 214 IIVAMNFIGVKFFGEFEFWLSTFKVIVMIGLIILLFVIMLGGGPTHDRLGFRFYDHPGAF 273
             V +N  GVK +GE EF  +  KV+ +IG II+  +++ GGGP    +G +++ HPGAF
Sbjct: 215 FTVIINLFGVKGYGEAEFVFAIIKVVTIIGFIIMAVILICGGGPVGGYIGAKYWHHPGAF 274

Query: 274 KPYSKSIDGSKGKXXXXXXXXXXXXXXXXGIELTGIVAAEAANPRKSIPKAIKLTMYRII 333
                  D +  K                G E+ G+  +E+ NPRKS+P A K   +RI 
Sbjct: 275 VG-----DTAGQKFKGFCTVFITASFSFGGSEVVGVAGSESENPRKSVPGAAKQVFWRIT 329

Query: 334 VFYLVTIFLLGMCVAYDDPLLXXXXXXXXXXXXXPYVVAIINSGIKALPHIFNACVLMFV 393
           +FY++ + L+GM V Y+D  L             P+V+A++N GI+ LP + N  +L+ V
Sbjct: 330 LFYVLCLLLIGMLVPYNDKRLIGASSVDAAAS--PFVIAVVNQGIRGLPSVINVVILISV 387

Query: 394 FSACNSDLYVASRTLYGLAIDNKAPKIFAVTNRWGVPYYSLLMSSCFCLLAYMSVSSGSA 453
            S  NS +Y+ SRTL  LA     PKI A  +R G P  ++ ++S F L+A+++ SS   
Sbjct: 388 LSVGNSSIYLCSRTLTALAEQGFLPKIVAYIDRNGRPLVAIGIASAFGLIAFVAESSHEG 447

Query: 454 KIFNYFVNVVSIFGLLSWISILITYLCFFRAVKAQNVDRSRFAYRAPFQPYGSYFTLAFC 513
           ++FN+ + +  +  L SW +I I ++ F RA+ AQ        + +     GSY+ +  C
Sbjct: 448 EVFNWLLALSGLSSLFSWSAICICHIRFRRALVAQGRSTDELPFVSTVGIAGSYWGIFIC 507

Query: 514 ILIAFIKNFTVFL---NHHFDYKNFITGYIGIPVFVISYFGYKFVKKT-KIW-KPEEVDL 568
           +L+  I  F V L       + K+F   Y+  P+ +  Y  +K  KK  K++ K E++D+
Sbjct: 508 VLM-LIAQFYVGLFPAGASPNAKDFFMAYLSFPIVLAFYIFHKIWKKNWKLYIKAEDMDI 566

Query: 569 YTFKAAIDEEEEQGKIADAERRE 591
            T +  +D +  + ++A AER +
Sbjct: 567 DTGRREVDRDLLKQEVA-AERAD 588

>ZYRO0F13838g Chr6 (1139293..1141803) [2511 bp, 836 aa] {ON} similar
           to uniprot|Q03770 Saccharomyces cerevisiae YDR160W SSY1
           Component of the SPS plasma membrane amino acid sensor
           system (Ssy1p-Ptr3p-Ssy5p) which senses external amino
           acid concentration and transmits intracellular signals
           that result in regulation of expression of amino acid
           permease genes
          Length = 836

 Score =  249 bits (637), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 163/576 (28%), Positives = 277/576 (48%), Gaps = 61/576 (10%)

Query: 79  GKDEHTRLRKDLKARHISMIAXXXXXXXXXXXXXXXXXYTAGPMSMFIAYAFVGVLVFFT 138
           G  +   +++ L+ RHI MI                    AGP    + ++  G +V  T
Sbjct: 255 GTGDSHHIQRKLRVRHIQMIGIGACLGVGIFLTSGKAFSIAGPFGTLLGFSLSGSIVLAT 314

Query: 139 MAALGEMASYIPLD-GFTSYASRYCDPALGFAVGYAYLCKYLILPPNQLTAAALVIQYWL 197
           + +  E+++ IPL  GF+  ASR+ + A GFA+G+ Y    +I  P Q+ A    ++Y+ 
Sbjct: 315 LLSFTELSTLIPLSSGFSGLASRFVEDAFGFALGWTYWFSCMITMPTQVVACTFYLKYF- 373

Query: 198 DREQVNPGV---WITIFLVIIVAMNFIGVKFFGEFEFWLSTFKVIVMIGLIILLFVIMLG 254
           D   +N G    + T+F++  V +N + V+  GE  +     K+I+ I +I+ + ++  G
Sbjct: 374 DSLNLNKGAIAGFATLFMLYAVLVNLLDVRLMGEIVYITGLIKIIISIIMILAMVILNSG 433

Query: 255 GGPTHDRLGFRFYDHP--------GAFKPY----------SKSIDGSKGKXXXXXXXXXX 296
            G  +DR+GFRF+D          G F+P           +K I+GS G+          
Sbjct: 434 TGTKYDRVGFRFWDSSKSSSNLTYGLFRPTFDLNDIGDGSTKGIEGSGGRFLALASTMLI 493

Query: 297 XXXXXXGIELTGIVAAEAANPRKSIPKAIKLTMYRIIVFYLVTIFLLGMCVAYDDPLLX- 355
                 G+E+  + + EA NPRK+IP A K T   ++V Y+ TIF + + +   DP L  
Sbjct: 494 STFAYTGVEMAFVASGEAINPRKTIPSATKRTFCIVLVIYVFTIFSVSINIYCGDPRLQP 553

Query: 356 --------------------------------XXXXXXXXXXXXPYVVAIINSGIKALPH 383
                                                       P+V+A+ N G+     
Sbjct: 554 YFTGSYSARYQAVQRGVGSQWQLSHKCHTNIPYSTKDPVDHNSSPWVLALQNFGLCTFAA 613

Query: 384 IFNACVLMFVFSACNSDLYVASRTLYGLAIDNKAPKIFAVTNRWGVPYYSLLMSSCFCLL 443
           +FN  ++ F   A  S L+ +SRTLY +A+  KAP IF   N+ GVPY S++ S  F ++
Sbjct: 614 VFNGILIFFTSGAEISSLFSSSRTLYSMAVQRKAPTIFQRCNKRGVPYVSVIFSGMFGVV 673

Query: 444 AYMSVSSGSAKIFNYFVNVVSIFGLLSWISILITYLCFFRAVKAQ----NVDRSRFAYRA 499
            Y++V SG+ + FN   N+ S    + W+ + +++L F+ A+K +    + D   + YR+
Sbjct: 674 GYLAVDSGAVENFNVLSNMSSASTSIIWMGLNVSFLRFYYALKTRRDIISRDEKSYPYRS 733

Query: 500 PFQPYGSYFTLAFCILIAFIKNFTVFLNHHFDYKNFITGYIGIPVFVISYFGYKFVKKTK 559
           PFQPY +++ L  C L      FT F++H ++ K+F + Y G+ +FV+ Y GYK +  +K
Sbjct: 734 PFQPYLAFYGLFGCCLFIIFMGFTNFIHHFWNVKSFFSAYGGLILFVVCYLGYKMIGTSK 793

Query: 560 IWKPEEVDLYTFKAAIDEE-EEQGKIADAERRERLK 594
           I + +++D+ T +  +D     + +      RERLK
Sbjct: 794 IQRLDQLDMDTGRREMDRVIWNEYRQYSGPYRERLK 829

>KNAG0J02200 Chr10 complement(407267..409090) [1824 bp, 607 aa] {ON}
           
          Length = 607

 Score =  245 bits (625), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 171/554 (30%), Positives = 273/554 (49%), Gaps = 29/554 (5%)

Query: 67  EDSEKQDDYMDDGK-----DEHTRLRKDLKARHISMIAXXXXXXXXXXXXXXXXXYTAGP 121
           + SE   D   +G      +  T L+K +K RH+ M+                  +  GP
Sbjct: 67  KHSEVDSDVERNGDAAYSVNTDTHLKKAMKTRHVIMMTLGTGIGTGLLVANAKGLHFGGP 126

Query: 122 MSMFIAYAFVGVLVFFTMAALGEMA-SYIPLDG-FTSYASRYCDPALGFAVGYAYLCKYL 179
            ++ I Y  V ++ +  + A GEMA +Y  L G F +YAS +     GFA  + +  ++L
Sbjct: 127 AALVIGYGLVSMVTYIMIQAAGEMAVAYPTLPGNFNTYASIFVSKPFGFATVWLFCIQWL 186

Query: 180 ILPPNQLTAAALVIQYWLDREQVNPGVWITIFLVIIVAMNFIGVKFFGEFEFWLSTFKVI 239
            + P +L  A+L+I+YW   E+VN  V++ IF V ++ ++FIGVK +GE EF  +  K++
Sbjct: 187 TVLPLELITASLIIKYW--TEKVNADVFVVIFYVFLLFIHFIGVKAYGETEFVFNLCKIL 244

Query: 240 VMIGLIILLFVIMLGGGPTHDRLGFRFYDHPGAFKPYSKSIDGSKGKXXXXXXXXXXXXX 299
           ++ G II   V+  GG      +G +++  PGAF   + + +  KG              
Sbjct: 245 MIAGFIIFSIVVNCGGAGHDGYIGGKYWHSPGAFAG-TNAAERFKG----VCYVLVSGYF 299

Query: 300 XXXGIELTGIVAAEAANPRKSIPKAIKLTMYRIIVFYLVTIFLLGMCVAYDDPLLXXXXX 359
              G EL  +   E  NPRKS P A K ++YRI+V YL+T+ L+G  V ++D  L     
Sbjct: 300 SYGGTELYVLSVNEQENPRKSTPIAAKQSIYRILVIYLLTMILIGFTVPFNDDQLMGAGG 359

Query: 360 XXXXXXXXPYVVAIINSGIKALPHIFNACVLMFVFSACNSDLYVASRTLYGLAIDNKAPK 419
                   PYV+A    G++ +PHI NA +L+ V S  NS LY A R L  LA    APK
Sbjct: 360 SATHAS--PYVLAASIHGVRVVPHIINAVILIAVISVANSSLYAAPRLLCSLAEQGYAPK 417

Query: 420 IFAVTNRWGVPYYSLLMSSCFCLLAYMSVSSGSAKIFNYFVNVVSIFGLLSWISILITYL 479
                +R G P Y+LL  + F ++A+ + S    ++F +   +  +  L +W SI+++++
Sbjct: 418 FMTYVDREGRPLYALLACAVFGVIAFSACSDQEEQVFTWLAAIAGLSELFTWSSIMLSHV 477

Query: 480 CFFRAVKAQNVDRSRFAYRAPFQPYGSYFTLAFCILIAFIKNFTVFL---NHHFDYKNFI 536
            F +A+K Q  D +   Y A    +GS + + F IL+ FI  F V L         ++F 
Sbjct: 478 RFRQAMKLQGRDLNEVGYIANTGYWGSVYGVVFNILV-FIAQFWVALAPPKSPITAQSFF 536

Query: 537 TGYIGIPVFVISYFGYKFVKK--TKIWKPEEVDLYTFKAAIDEEEEQGKIADAERRERLK 594
             Y+  P+++  YFGY    K  T +   +++DL   +   D E    K  D E +ER++
Sbjct: 537 ESYLAFPIWIAFYFGYMIWNKDYTFLNPLDKIDLDHHRRIYDPEVL--KQEDMENKERVR 594

Query: 595 NSKTKGW---DWFY 605
           N     W    WF+
Sbjct: 595 NGNI--WTKLKWFW 606

>NCAS0B08580 Chr2 complement(1646220..1648103) [1884 bp, 627 aa]
           {ON} Anc_1.50
          Length = 627

 Score =  245 bits (626), Expect = 4e-72,   Method: Compositional matrix adjust.
 Identities = 161/539 (29%), Positives = 269/539 (49%), Gaps = 25/539 (4%)

Query: 68  DSEKQDDYMDDGKDEHTRLRKDLKARHISMIAXXXXXXXXXXXXXXXXXYTAGPMSMFIA 127
           D E +     +  D+   L+K +K RH+ MI+                   +GP  + I 
Sbjct: 91  DIEGKPRTEPEKDDDARELKKTIKPRHVVMISLGTGIGTGMLVGNGTSLANSGPAGLVIG 150

Query: 128 YAFVGVLVFFTMAALGEMAS-YIPL-DGFTSYASRYCDPALGFAVGYAYLCKYLILPPNQ 185
           YA +G  ++  + A GE+A  Y  L  GF +Y S   DPA GFAV + Y  ++L + P +
Sbjct: 151 YAIMGSCIYCIIQATGELAVLYTKLTGGFNAYPSMLIDPAFGFAVAWVYCIQWLCVCPLE 210

Query: 186 LTAAALVIQYWLDREQVNPGVWITIFLVIIVAMNFIG-VKFFGEFEFWLSTFKVIVMIGL 244
           L  A++ I+YW  +  V+P V++ IF  +I+ +N +G    + E EF+ ++FK++++ G 
Sbjct: 211 LVTASMTIKYWTTK--VDPDVFVVIFYCLILCINVLGGAAGYAEAEFFFNSFKILMLTGF 268

Query: 245 IILLFVIMLGGGPTHDRLGFRFYDHPGAFKPYSKSIDGSKGKXXXXXXXXXXXXXXXXGI 304
            IL  V++ GG      +G R + +PG+F+   K +D  KG                   
Sbjct: 269 FILGIVVICGGAGNDGYIGTRLWHNPGSFRG-DKPVDRFKGVVSTLVNAAFAFGMS---- 323

Query: 305 ELTGIVAAEAANPRKSIPKAIKLTMYRIIVFYLVTIFLLGMCVAYD-DPLLXXXXXXXXX 363
           E  G+ A+E +NPRK+IP A K  +YRII  YL ++ ++G  V YD D LL         
Sbjct: 324 EFLGVTASEQSNPRKAIPSAAKKMLYRIICIYLGSVTIVGFLVPYDSDQLLGSSGAATKA 383

Query: 364 XXXXPYVVAIINSGIKALPHIFNACVLMFVFSACNSDLYVASRTLYGLAIDNKAPKIFAV 423
               PYV+AI   G++ +PH  NA +L+ V S  NS  Y +SR L  L+    AP     
Sbjct: 384 S---PYVLAISLHGVRVVPHFINAVILLSVLSVGNSAFYSSSRQLLSLSQLGYAPSFLNY 440

Query: 424 TNRWGVPYYSLLMSSCFCLLAYMSVSSGSAKIFNYFVNVVSIFGLLSWISILITYLCFFR 483
            +R G P  +  +S+   ++A+ + S    ++F + + +  +  L +W SI +++L F R
Sbjct: 441 VDRNGRPLKAYCVSALVGVIAFCATSPKEDQVFVWLLAISGLSQLFTWFSICLSHLRFRR 500

Query: 484 AVKAQNVDRSRFAYRAPFQPYGSYFTLAFCILIAFIKNFTVFL---NHHFDYKNFITGYI 540
           A++ Q        +++    YGS ++    +LI   + +T  +       D + F   Y+
Sbjct: 501 AMRVQGRSMGEVGFKSQVGIYGSLYSCVMMVLILIAQFWTALVPVGEGKPDVQAFFENYL 560

Query: 541 GIPVFVISYFGYKFVKKTKIW----KPEEVDLYTFKAAIDEEEEQGKIADAERRERLKN 595
            +P+F++ YFG+K  KK   W    + E++DL + +   DEE    K  D E R +L++
Sbjct: 561 AMPIFIVLYFGFKIWKKD--WRLFIRAEDIDLVSHREIFDEELL--KQEDEEYRRKLRD 615

>AAR038W Chr1 (409071..410771) [1701 bp, 566 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YBR132C (AGP2)
          Length = 566

 Score =  243 bits (621), Expect = 4e-72,   Method: Compositional matrix adjust.
 Identities = 156/538 (28%), Positives = 268/538 (49%), Gaps = 22/538 (4%)

Query: 62  VSSRLEDSEKQDDYMDDGKDE----------HTRLRKDLKARHISMIAXXXXXXXXXXXX 111
           V+ R +DS    ++  +  DE          H+  RK L+ RH+ +I             
Sbjct: 20  VAIRRKDSWVPSEHSSEVGDEASSAGFAGKYHSTYRK-LENRHVQLIGISGVIGTALFVS 78

Query: 112 XXXXXYTAGPMSMFIAYAFVGVLVFFTMAALGEMASYIPLDG-FTSYASRYCDPALGFAV 170
                Y  G +S+ + +A   V +     +  EM  Y+PL+  F   ASR  + +L    
Sbjct: 79  IGKALYRGGSVSLLLGFALWCVPILCITVSTAEMVCYLPLNSPFLRLASRCVNDSLTVMA 138

Query: 171 GYAYLCKYLILPPNQLTAAALVIQYWLDREQVNPGVWITIFLVIIVAMNFIGVKFFGEFE 230
           G+ +     +  P ++ A   +I YW  R+  +  + + + +++ + ++   V+++GE E
Sbjct: 139 GWNFWFLECVQIPFEIVAVNSIIHYW--RDDYSAAITLVVQVMLYLLISLFAVRYYGEIE 196

Query: 231 FWLSTFKVIVMIGLIILLFVIMLGGGPTHDRLGFRFYDHPGAFKPYSKS---IDGSKGKX 287
           FWL++FKV++ +GL    FV M+GG P  DR GFR Y     FK YS +   I  S G  
Sbjct: 197 FWLASFKVLLAVGLFCFTFVTMVGGNPKRDRYGFR-YIGEAPFKQYSPTMEPISSSAGYF 255

Query: 288 XXXXXXXXXXXXXXXGIELTGIVAAEAANPRKSIPKAIKLTMYRIIVFYLVTIFLLGMCV 347
                          G +   ++A E   PRK +P A K    R+ V +L     +G+  
Sbjct: 256 QGFLACLIQASFTIAGPDYVSMIAGETKLPRKVLPVAFKQVFIRLTVLFLGGCLCVGIVC 315

Query: 348 AYDDP-LLXXXXXXXXXXXXXPYVVAIINSGIKALPHIFNACVLMFVFSACNSDLYVASR 406
           + +DP L              PYV+A+ + GIK LP I NA ++   FSA N+  Y +SR
Sbjct: 316 SANDPDLTAAINASRPGAGSSPYVIAMNHLGIKILPDIVNAALVTAAFSAGNAYTYCSSR 375

Query: 407 TLYGLAIDNKAPKIFAVTNRWGVPYYSLLMSSCFCLLAYMSVSSGSAKIFNYFVNVVSIF 466
           +LYGLA+D  AP IF   NR+GVP Y++ +S  + +L+ + ++S SA + N+ +++++  
Sbjct: 376 SLYGLALDGYAPAIFKRCNRFGVPIYAVSVSVMWSVLSLLQLNSNSAVVLNWLISLITAS 435

Query: 467 GLLSWISILITYLCFFRAVKAQNVDRSRFAYRAPFQPYGSYFTLAFCILIAFIKNFTVFL 526
            L+++  + + YL F RA  AQ  +    ++++ +QPY +Y  L   +LI  ++ +TVF 
Sbjct: 436 QLINFGVLCVVYLYFRRAYLAQQDNLPELSFKSWWQPYTAYVGLTCVLLIVVVQGYTVFY 495

Query: 527 NHHFDYKNFITGYIGIPVFVISYFGYKFV---KKTKIWKPEEVDLYTFKAAIDEEEEQ 581
           +  ++ K+F+  Y+ + + +  Y GY+++    K  +  P EVDL T    I+  E  
Sbjct: 496 SALWNVKDFLFCYLMVFIDIAIYLGYRYIWRRGKDAVIPPTEVDLTTGLLEIELHERH 553

>YGR191W Chr7 (880420..882231) [1812 bp, 603 aa] {ON}
           HIP1High-affinity histidine permease, also involved in
           the transport of manganese ions
          Length = 603

 Score =  244 bits (623), Expect = 5e-72,   Method: Compositional matrix adjust.
 Identities = 166/540 (30%), Positives = 267/540 (49%), Gaps = 24/540 (4%)

Query: 46  DKKDGLDINDMDNLSTVSSRL---EDSEKQDDYMDDGKDEHTRLRKDLKARHISMIAXXX 102
             KD   IN   N  T S R    ED+E++D         +T L KDL  RH+  +A   
Sbjct: 50  SSKDSPGINQTTNDITSSDRFRRNEDTEQEDI-------NNTNLSKDLSVRHLLTLAVGG 102

Query: 103 XXXXXXXXXXXXXXYTAGPMSMFIAYAFVGVLVFFTMAALGEMASYIPL-DGFTSYASRY 161
                          T GP S+ I +  +   +F  + +LGE+++  P+  GF  Y+ R+
Sbjct: 103 AIGTGLYVNTGAALSTGGPASLVIDWVIISTCLFTVINSLGELSAAFPVVGGFNVYSMRF 162

Query: 162 CDPALGFAVGYAYLCKYLILPPNQLTAAALVIQYWLDREQVNPGVWITIFLVIIVAMNFI 221
            +P+  FAV   YL ++L+L P +L AA++ I+YW D+  +N   W+ IF   I   N +
Sbjct: 163 IEPSFAFAVNLNYLAQWLVLLPLELVAASITIKYWNDK--INSDAWVAIFYATIALANML 220

Query: 222 GVKFFGEFEFWLSTFKVIVMIGLIILLFVIMLGGGPTHDRLGFRFYDHPGAFKPYSKSID 281
            VK FGE EF LS  K++ +IG  IL  V+  GGGP    +G +++  PGAF  +S    
Sbjct: 221 DVKSFGETEFVLSMIKILSIIGFTILGIVLSCGGGPHGGYIGGKYWHDPGAFVGHS---- 276

Query: 282 GSKGKXXXXXXXXXXXXXXXXGIELTGIVAAEAANPRKSIPKAIKLTMYRIIVFYLVTIF 341
            S  +                GIE+T + AAE+ NPR++IPKA K T + I   Y+  + 
Sbjct: 277 -SGTQFKGLCSVFVTAAFSYSGIEMTAVSAAESKNPRETIPKAAKRTFWLITASYVTILT 335

Query: 342 LLGMCVAYDDPLLXXXXXXXXXXXXXPYVVAIINSGIKALPHIFNACVLMFVFSACNSDL 401
           L+G  V  +DP L             P V+AI N GIK LP + NA +L+ V S  NS +
Sbjct: 336 LIGCLVPSNDPRLLNGSSSVDAASS-PLVIAIENGGIKGLPSLMNAIILIAVVSVANSAV 394

Query: 402 YVASRTLYGLAIDNKAPKIFAVTNRWGVPYYSLLMSSCFCLLAYMSVSSGSAKIFNYFVN 461
           Y  SR +  +A     PK     ++ G P  ++L++  F LL++++ S   A++F +   
Sbjct: 395 YACSRCMVAMAHIGNLPKFLNRVDKRGRPMNAILLTLFFGLLSFVAASDKQAEVFTWLSA 454

Query: 462 VVSIFGLLSWISILITYLCFFRAVKAQNVDRSRFAYRAPFQPYGSY--FTLAFCILIA-F 518
           +  +  +  W++I ++++ F +A+K Q        + +     GS+  F + F +LIA F
Sbjct: 455 LSGLSTIFCWMAINLSHIRFRQAMKVQERSLDELPFISQTGVKGSWYGFIVLFLVLIASF 514

Query: 519 IKNFTVFLNHHFDYKNFITGYIGIPVFVISYFGYKFVKK--TKIWKPEEVDLYTFKAAID 576
             +           ++F  GY+  P+ ++ Y G+K   +  T + K E++DL T +  +D
Sbjct: 515 WTSLFPLGGSGASAESFFEGYLSFPILIVCYVGHKLYTRNWTLMVKLEDMDLDTGRKQVD 574

>SAKL0D00836g Chr4 complement(65731..67536) [1806 bp, 601 aa] {ON}
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039W GAP1 General amino acid permease localization to
           the plasma membrane is regulated by nitrogen source
          Length = 601

 Score =  244 bits (623), Expect = 5e-72,   Method: Compositional matrix adjust.
 Identities = 159/516 (30%), Positives = 259/516 (50%), Gaps = 21/516 (4%)

Query: 86  LRKDLKARHISMIAXXXXXXXXXXXXXXXXXYTAGPMSMFIAYAFVGVLVFFTMAALGEM 145
           L++ LK RH+ MIA                    GP ++ IA+   G +V+  + ALGE+
Sbjct: 89  LKRHLKNRHLQMIAIGGSIGTGLFVGSGKALRIGGPAAVVIAWIMTGSMVYSVVQALGEL 148

Query: 146 ASYIPLDG-FTSYASRYCDPALGFAVGYAYLCKYLILPPNQLTAAALVIQYWLDREQVNP 204
           A  +P+ G + SY SR+ +P+ GFA+ Y YL   LI  P +L AA++ + YW D +    
Sbjct: 149 AVALPVSGSYLSYVSRFIEPSFGFAIAYNYLIGNLITMPLELIAASITVNYW-DVDSKYA 207

Query: 205 GVWITIFLVIIVAMNFIGVKFFGEFEFWLSTFKVIVMIGLIILLFVIMLGGGPTHDR-LG 263
             ++ +F ++IV +N  GVK +GE EF  S  KV  ++G IIL  V++ GGGP+ +  +G
Sbjct: 208 DAFVALFYIVIVGINLFGVKGYGEAEFVFSVIKVTAIVGFIILGIVLVCGGGPSDEGYIG 267

Query: 264 FRFYDHPGAFKPYSKSIDGSKGKXXXXXXXXXXXXXXXXGIELTGIVAAEAANPRKSIPK 323
            R++ +PG F        G KG                 G E+  + AAE  NPRK +P+
Sbjct: 268 ARYWYNPGGFA------HGFKG----FAAIFVTSAFSFAGSEMFALAAAETENPRKDLPR 317

Query: 324 AIKLTMYRIIVFYLVTIFLLGMCVAYDDPLLXXXXXXXXXXXXXPYVVAIINSGIKALPH 383
           A K   +RI +FY++++ L+G  V Y D  L             P+V+AI  +GIK LP 
Sbjct: 318 AAKQVFWRITLFYVISLTLIGCLVPYTDKHLFAASSVDASAS--PFVIAIARAGIKGLPS 375

Query: 384 IFNACVLMFVFSACNSDLYVASRTLYGLAIDNKAPKIFAVTNRWGVPYYSLLMSSCFCLL 443
           + N  +L+ V S  N  +Y ASR +  LA     P+ F   +R G P   +L+ + F LL
Sbjct: 376 VVNVVILIAVLSVGNCCVYAASRAVLSLAHYGFLPRRFGYVDRKGRPLVGILLCAIFGLL 435

Query: 444 AYMSVSSGSAKIFNYFVNVVSIFGLLSWISILITYLCFFRAVKAQNVDRSRFAYRAPFQP 503
           +++S SS   ++F++ + +  +     W SI + +L F RA+  Q       +Y+A    
Sbjct: 436 SFLSASSNYGEVFDWMLAISGLNSFFIWGSICVCHLRFRRALSVQGRSTDELSYKAQTGI 495

Query: 504 YGSYFTLAFCILIAFIKNFTVFL---NHHFDYKNFITGYIGIPVFVISYFGYKFVKK--T 558
           +GS + +   I I     F V L       +  +F + Y+ +PV +  Y  +K   +  T
Sbjct: 496 WGSLYGIGL-IFIVLCFQFWVALFPIGGSPNANHFFSAYLSLPVVIFFYTCHKLYTRSWT 554

Query: 559 KIWKPEEVDLYTFKAAIDEEEEQGKIADAERRERLK 594
            + K  ++D+ T +  +D E  + +I + ++  R K
Sbjct: 555 FLIKSSDIDIDTGRREMDLELLKQEIQEEQQYIRSK 590

>Skud_7.525 Chr7 (856072..857883) [1812 bp, 603 aa] {ON} YGR191W
           (REAL)
          Length = 603

 Score =  244 bits (623), Expect = 6e-72,   Method: Compositional matrix adjust.
 Identities = 170/555 (30%), Positives = 274/555 (49%), Gaps = 25/555 (4%)

Query: 50  GLDINDMDNLSTVSSRLEDSEKQDDYMDDGKDEHTRLRKDLKARHISMIAXXXXXXXXXX 109
           G+     D  S+  SR  D  +Q D        +T L KDL  RH+  +A          
Sbjct: 56  GMKQTTNDITSSERSRDNDDVEQVDI------NNTNLNKDLSVRHLLTLAVGGAIGTGLY 109

Query: 110 XXXXXXXYTAGPMSMFIAYAFVGVLVFFTMAALGEMASYIPL-DGFTSYASRYCDPALGF 168
                   T GP S+ I +  +G  +F  + +LGE+++  P+  GF  Y  R+ +P+  F
Sbjct: 110 VNTGTALSTGGPASLVIDWVIIGTCLFTVINSLGELSAAFPVVGGFNVYGMRFVEPSFAF 169

Query: 169 AVGYAYLCKYLILPPNQLTAAALVIQYWLDREQVNPGVWITIFLVIIVAMNFIGVKFFGE 228
           AV   YL ++L+L P +L AA++ I+YW D+  +N   W+ IF   I   N + VK FGE
Sbjct: 170 AVNLNYLAQWLVLLPLELVAASITIKYWNDK--INSDAWVAIFYATIALANMLDVKSFGE 227

Query: 229 FEFWLSTFKVIVMIGLIILLFVIMLGGGPTHDRLGFRFYDHPGAFKPYSKSIDGSKGKXX 288
            EF LS  K++ +IG  IL  V+  GGGP    +G +++ +PGAF  ++     S  K  
Sbjct: 228 TEFVLSMIKILSIIGFSILGIVLSCGGGPHGGYIGGKYWRNPGAFVGHN-----SGTKFK 282

Query: 289 XXXXXXXXXXXXXXGIELTGIVAAEAANPRKSIPKAIKLTMYRIIVFYLVTIFLLGMCVA 348
                         GIE+T + AAE+ NPR++IPKA K T + I   Y+  + L+G  V 
Sbjct: 283 GLCSVFVTAAFSYSGIEMTAVSAAESKNPRETIPKAAKRTFWLITASYVTILTLIGCLVP 342

Query: 349 YDDPLLXXXXXXXXXXXXXPYVVAIINSGIKALPHIFNACVLMFVFSACNSDLYVASRTL 408
            +DP L             P V+AI N  IK LP + NA +L+ V S  NS +Y  SR +
Sbjct: 343 SNDPRLLNGSSSVDAASS-PLVIAIENGRIKGLPSLMNAIILIAVVSVANSAVYACSRCM 401

Query: 409 YGLAIDNKAPKIFAVTNRWGVPYYSLLMSSCFCLLAYMSVSSGSAKIFNYFVNVVSIFGL 468
             +A     PK     ++ G P  ++L++  F LL++++ S+  A++F +   +  +  +
Sbjct: 402 VAMAHIGNLPKFLNRVDKRGRPMNAILLTLFFGLLSFVAASNKEAEVFTWLSALSGLSTI 461

Query: 469 LSWISILITYLCFFRAVKAQNVDRSRFAYRAPFQPYGSY--FTLAFCILIA-FIKNFTVF 525
             W++I ++++ F +A+K Q        + +     GS+  F + F +LIA F  +    
Sbjct: 462 FCWMAINLSHIRFRKAMKVQERSLDELPFISQTGVLGSWYGFVVLFLVLIASFWTSLFPI 521

Query: 526 LNHHFDYKNFITGYIGIPVFVISYFGYKFVKK--TKIWKPEEVDLYTFKAAID--EEEEQ 581
            +     ++F  GY+  P+ ++ YFG+K   +  T + K E++DL T +  +D     E+
Sbjct: 522 GSSGASAESFFEGYLSFPILIVCYFGHKIYTRNWTLMVKIEDIDLDTGRKQVDLTLRREE 581

Query: 582 GKIADAERRERLKNS 596
            KI   ER    K S
Sbjct: 582 MKI---ERENLAKKS 593

>NDAI0D02160 Chr4 (505202..506965) [1764 bp, 587 aa] {ON} Anc_5.158
          Length = 587

 Score =  243 bits (621), Expect = 6e-72,   Method: Compositional matrix adjust.
 Identities = 164/555 (29%), Positives = 274/555 (49%), Gaps = 27/555 (4%)

Query: 60  STVSSRLEDSEKQDD-----------YMDDGKDEHTRLRKDLKARHISMIAXXXXXXXXX 108
           ST SS L+ + K+ D            + +    +  L K+L  RH+  +A         
Sbjct: 33  STQSSLLDLTLKKCDNGIEVVNDATSTVSNASVTNVNLNKNLSIRHLLTLAVGGAIGVGL 92

Query: 109 XXXXXXXXYTAGPMSMFIAYAFVGVLVFFTMAALGEMASYIPL-DGFTSYASRYCDPALG 167
                    + GP S+ I +  +   +F  + ALGEMA+  P+  GF  Y +R+ DP++G
Sbjct: 93  FVNSGAALASGGPASLVIDWVIISTCLFTVINALGEMAAAFPVVGGFNVYITRFVDPSVG 152

Query: 168 FAVGYAYLCKYLILPPNQLTAAALVIQYWLDREQVNPGVWITIFLVIIVAMNFIGVKFFG 227
           FAV   YL ++L+L P +L AA++ I+YW D   +N   W+ IF  +I   N + VK FG
Sbjct: 153 FAVNINYLAQWLVLLPLELVAASMTIKYWND--TINSDAWVAIFYAVIAFANMLEVKSFG 210

Query: 228 EFEFWLSTFKVIVMIGLIILLFVIMLGGGPTHDRLGFRFYDHPGAFKPYSKSIDGSKGKX 287
           E EF LS  K++ +IG  IL  V+  GGGP    LG +++ +PG+F  ++     S  K 
Sbjct: 211 ETEFVLSMVKILAIIGFTILGIVLSCGGGPQGGYLGGKYWHNPGSFVGHT-----SGTKF 265

Query: 288 XXXXXXXXXXXXXXXGIELTGIVAAEAANPRKSIPKAIKLTMYRIIVFYLVTIFLLGMCV 347
                          GIE+T + AAE+ +PR++IPKA K T + I   Y+  + L+G  V
Sbjct: 266 KGLCSVFVTAAFSYSGIEMTAVSAAESKDPRRTIPKAAKRTFWLITASYITILTLIGCLV 325

Query: 348 AYDDPLLXXXXXXXXXXXXXPYVVAIINSGIKALPHIFNACVLMFVFSACNSDLYVASRT 407
            YD+P L             P V+AI N GIK LP + NA +L+ + S  NS +Y  SR 
Sbjct: 326 PYDEPRLLSGSSSVDAASS-PLVIAIENGGIKGLPSLMNAIILISIISVANSAVYACSRC 384

Query: 408 LYGLAIDNKAPKIFAVTNRWGVPYYSLLMSSCFCLLAYMSVSSGSAKIFNYFVNVVSIFG 467
           +  +A     P++    ++ G P  ++L +  F LL++++ S   A++F +   +  +  
Sbjct: 385 MVAMAHIGNLPQVLKHIDKKGRPVNAILFTLFFGLLSFVAASDKQAEVFTWLSALSGLST 444

Query: 468 LLSWISILITYLCFFRAVKAQNVDRSRFAYRAPFQPYGSYFTLAFCILIAFIKNFTVFL- 526
           +  W++I I+++ F +A+K Q        Y +    +GS++ +    L+  +  +T    
Sbjct: 445 IFCWMAINISHIRFRQAMKKQRKSLDELPYLSQTGVWGSWYGVIVLFLVLIVSFWTSLFP 504

Query: 527 --NHHFDYKNFITGYIGIPVFVISYFGYKFV--KKTKIWKPEEVDLYTFKAAIDEEEEQG 582
                 D ++F  GY+  P+ +  Y G+K V  KK  +   E++D+ T +  +D    + 
Sbjct: 505 LGGSGADAESFFQGYLSFPILIACYVGHKLVYRKKQIVVALEDMDIDTGRRQVDLTIRRQ 564

Query: 583 KIADAERRERLKNSK 597
           ++   E +E L  S 
Sbjct: 565 EM--KEEQEHLAKSS 577

>Skud_4.784 Chr4 complement(1386623..1388614) [1992 bp, 663 aa] {ON}
           YDR508C (REAL)
          Length = 663

 Score =  245 bits (626), Expect = 7e-72,   Method: Compositional matrix adjust.
 Identities = 169/588 (28%), Positives = 287/588 (48%), Gaps = 45/588 (7%)

Query: 46  DKKDGLDINDMDNLST--VSSRLE------------DSEKQDDYMDDGKDEHTRLRKDLK 91
           +  D  ++N    +ST   SSRL+            D  KQ     + K E+  L+K +K
Sbjct: 93  NSPDSTNLNGSTPISTKDSSSRLDNELNPKSSYITVDGIKQSSQEQEPKQEN--LKKSIK 150

Query: 92  ARHISMIAXXXXXXXXXXXXXXXXXYTAGPMSMFIAYAFVGVLVFFTMAALGEMASYIP- 150
            RH  M++                   AGP  + I YA +G  V+  + A GE+A     
Sbjct: 151 PRHTVMMSLGTGIGTGLLVGNSKVLNNAGPGGLIIGYAIMGSCVYCIIQACGELAVIYSD 210

Query: 151 -LDGFTSYASRYCDPALGFAVGYAYLCKYLILPPNQLTAAALVIQYWLDREQVNPGVWIT 209
            + GF +Y S   DPA+GF+V + +  ++L + P +L  A++ I+YW  +  VN  V++ 
Sbjct: 211 LIGGFNTYPSFLVDPAVGFSVAWLFCLQWLCVCPLELVTASMTIKYWTVK--VNADVFVI 268

Query: 210 IFLVIIVAMNFIGVKFFGEFEFWLSTFKVIVMIGLIILLFVIMLGGGPTHDRLGFRFYDH 269
           IF V+I+ +N  G K + E +F+ +  K++++ G  IL  +I  GG  T   +G R++  
Sbjct: 269 IFYVLILVINIFGAKGYAEADFFFNCCKILMITGFFILAIIIDCGGAGTDGYIGSRYWRD 328

Query: 270 PGAFKPYSKSIDGSKGKXXXXXXXXXXXXXXXXGIELTGIVAAEAANPRKSIPKAIKLTM 329
           PGAF+    SI   KG                   E   + A+E +NPRK+IP A K  +
Sbjct: 329 PGAFRG-DTSIQRFKGVVATFVTAAFAFGMS----EQLAMTASEQSNPRKAIPSAAKKMI 383

Query: 330 YRIIVFYLVTIFLLGMCVAY-DDPLLXXXXXXXXXXXXXPYVVAIINSGIKALPHIFNAC 388
           YRI+  +L ++ L+G  V Y  D LL             PYV+A+ + G++ +PH  NA 
Sbjct: 384 YRILFVFLASLALVGFLVPYTSDQLLGAAGSATKAS---PYVIAVSSHGVRVVPHFINAV 440

Query: 389 VLMFVFSACNSDLYVASRTLYGLAIDNKAPKIFAVTNRWGVPYYSLLMSSCFCLLAYMSV 448
           +L+ V S  NS  Y +SR L  LA    APK F   +R G P  ++++S+ F ++A+ + 
Sbjct: 441 ILLSVLSVANSAFYTSSRILMSLAKQGNAPKCFDYIDREGRPAVAMIVSAVFGVIAFCAS 500

Query: 449 SSGSAKIFNYFVNVVSIFGLLSWISILITYLCFFRAVKAQNVDRSRFAYRAPFQPYGSYF 508
           S     +F + + +  +  L +WI+I ++++ F + +K Q        Y++    +GS +
Sbjct: 501 SKKEEDVFTWLLAISGLSQLFTWITICLSHIRFRKGMKVQGRSLGEVGYKSQVGVWGSAY 560

Query: 509 TLAFCILIAFIKNFTVFL-----NHHFDYKNFITGYIGIPVFVISYFGYKFVKKT-KIWK 562
            +   +L A I  F V +     +     ++F   Y+ +P+ +  Y  YK  K+   ++ 
Sbjct: 561 AVVLMVL-ALIGQFWVAISPIGGDKKLSAQSFFENYLAMPILIALYIFYKVWKRDWSLFI 619

Query: 563 P-EEVDLYTFKAAIDEEEEQGKIADAERRERLKNSKTKGWDWFYEKVL 609
           P +++DL + +   DEE    K  D E ++RL+N        F+++VL
Sbjct: 620 PADKIDLVSHRNIFDEELL--KQEDEEYKDRLRNGP------FWKRVL 659

>Kpol_543.79 s543 (197876..199693) [1818 bp, 605 aa] {ON}
           (197876..199693) [1818 nt, 606 aa]
          Length = 605

 Score =  244 bits (622), Expect = 8e-72,   Method: Compositional matrix adjust.
 Identities = 168/543 (30%), Positives = 271/543 (49%), Gaps = 19/543 (3%)

Query: 54  NDMDNLSTVSSRLEDSEKQDDYMDDGKDEHTRLRKDLKARHISMIAXXXXXXXXXXXXXX 113
           N +D+   V     D    D      K   + L+  LK+RH+ MIA              
Sbjct: 56  NFLDSFKRVEVEEVDPNLTDLEKIAIKTARSPLQHKLKSRHLQMIAIGGAIGTGLFVGSG 115

Query: 114 XXXYTAGPMSMFIAYAFVGVLVFFTMAALGEMASYIPLDG-FTSYASRYCDPALGFAVGY 172
               TAGP  + I ++  G ++F  + ALGE+A   P+ G FT+YA+R+ D + GFA  +
Sbjct: 116 RALRTAGPAGILIGWSITGTMIFTMVMALGELAVMFPVSGGFTTYATRFIDESFGFACNF 175

Query: 173 AYLCKYLILPPNQLTAAALVIQYWLDREQVNPGVWITIFLVIIVAMNFIGVKFFGEFEFW 232
            Y+ ++L++ P ++ AA++ + YW    +   G ++ +F +++V +N  GV+ +GE EF 
Sbjct: 176 NYMLQWLVVLPLEIVAASITVAYWETPVRYTDG-FVALFWLVVVIINMFGVRGYGEAEFV 234

Query: 233 LSTFKVIVMIGLIILLFVIMLGGGPTHDRLGFRFYDHPGAFKPYSKSIDGSKGKXXXXXX 292
            S  KV  +IG IIL  V++ GGGP    +G R++ +PGAF   +     S  K      
Sbjct: 235 FSIIKVTAVIGFIILGIVLVCGGGPVGGYVGARYWHNPGAFVGST-----SGQKFHGFCS 289

Query: 293 XXXXXXXXXXGIELTGIVAAEAANPRKSIPKAIKLTMYRIIVFYLVTIFLLGMCVAYDDP 352
                     G EL G+  +EA NPRK++P A K   +RI++FY++ + L+G  V Y+DP
Sbjct: 290 VFVTAAFSFAGSELIGLAGSEAKNPRKAVPSAAKQVFWRILLFYIICLLLIGFLVPYNDP 349

Query: 353 LLXXXXXXXXXXXXXPYVVAIINSGIKALPHIFNACVLMFVFSACNSDLYVASRTLYGLA 412
            L             P+V+AI+  GI  LP + N  +L+ V S  NS +Y  SRTL  L+
Sbjct: 350 RLISSSSVDASAS--PFVIAIVTHGISGLPSVINVVILISVLSVGNSAIYSCSRTLVALS 407

Query: 413 IDNKAPKIFAVTNRWGVPYYSLLMSSCFCLLAYMSVSSGSAKIFNYFVNVVSIFGLLSWI 472
                PKI +  +R G P   + +SS F L+A+++ S+   ++FN+ + +  +    +W 
Sbjct: 408 EQGFLPKIVSYIDRKGRPLVGIAISSTFGLIAFVAASNKQNEMFNWLLAISGLSSFFTWS 467

Query: 473 SILITYLCFFRAVKAQNVDRSRFAYRAPFQPYGSYFTLAFCILIAFIKNFTVFL---NHH 529
           +I I ++ F  A+KAQ        + +P    GSY+ L   IL+  I  F + L      
Sbjct: 468 AICICHIRFRGALKAQGRGTDELPFVSPAGVIGSYWGLFLNILM-LIAQFYIALFPIGGS 526

Query: 530 FDYKNFITGYIGIPVFVISYFGYKFVKKTKIWK----PEEVDLYTFKAAIDEEEEQGKIA 585
                F + Y+  PV +  Y  +K  KK   WK     E+VD+ T +   D    + +IA
Sbjct: 527 PSAYEFFSAYLAAPVILAFYIAHKLWKKN--WKFLIPLEDVDIDTGRRDTDVNLLKQEIA 584

Query: 586 DAE 588
           + +
Sbjct: 585 EEK 587

>KLTH0E15642g Chr5 (1389937..1391727) [1791 bp, 596 aa] {ON} similar
           to uniprot|P19145 Saccharomyces cerevisiae YKR039W GAP1
           General amino acid permease localization to the plasma
           membrane is regulated by nitrogen source
          Length = 596

 Score =  243 bits (620), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 161/527 (30%), Positives = 270/527 (51%), Gaps = 25/527 (4%)

Query: 86  LRKDLKARHISMIAXXXXXXXXXXXXXXXXXYTAGPMSMFIAYAFVGVLVFFTMAALGEM 145
           L++ LK RH+ MIA                  T GP ++ I +  +G++++  + A+GE+
Sbjct: 80  LQRHLKNRHLQMIAIGGAIGTGLFVGSGSALRTGGPAAVLIGWGLIGLMIYSVVMAMGEL 139

Query: 146 ASYIPL-DGFTSYASRYCDPALGFAVGYAYLCKYLILPPNQLTAAALVIQYWLDREQVNP 204
           A   P+  GFT+Y  R+ D + GFA+ Y Y+ ++L++ P ++ AA++ + YW    +   
Sbjct: 140 AVTFPVAGGFTTYIPRFVDDSFGFAINYIYMLQWLVVLPLEIVAASITVNYWGTPAKYRD 199

Query: 205 GVWITIFLVIIVAMNFIGVKFFGEFEFWLSTFKVIVMIGLIILLFVIMLGGGPTHDRLGF 264
           G ++ +F V+IV +N  GVK +GE EF  S  KV  ++G IIL  V++ GGGP    +G 
Sbjct: 200 G-FVALFYVVIVIINMFGVKGYGEAEFVFSIIKVTTVVGFIILGIVLICGGGPVGGYVGG 258

Query: 265 RFYDHPGAFKPYSKSIDGSKGKXXXXXXXXXXXXXXXXGIELTGIVAAEAANPRKSIPKA 324
           +++ +PGAF       D +  +                G EL G+ AAE  NPRK++P+A
Sbjct: 259 KYWHNPGAFNG-----DNAGQRFKAVCSVFVTAAFSFAGTELVGLAAAETENPRKALPRA 313

Query: 325 IKLTMYRIIVFYLVTIFLLGMCVAYDDPLLXXXXXXXXXXXXXPYVVAIINSGIKALPHI 384
            K   +RI +FY++++ L+G+ V Y    L             P+V+AI   GI  LP +
Sbjct: 314 AKQVFWRITLFYIISLCLIGLLVPYTSENLIGSSSVDAAAS--PFVLAIKTHGISGLPSV 371

Query: 385 FNACVLMFVFSACNSDLYVASRTLYGLAIDNKAPKIFAVTNRWGVPYYSLLMSSCFCLLA 444
            N  +L+ V S  NS +Y  SRTL  LA     P+IF+  +R G P   +L +  F LL 
Sbjct: 372 INVVILISVLSVGNSSVYACSRTLSALADQGFLPQIFSYIDRKGRPLVGILATCTFGLLC 431

Query: 445 YMSVSSGSAKIFNYFVNVVSIFGLLSWISILITYLCFFRAVKAQNVDRSRFAYRAPFQPY 504
           +++ S     +FN+ + +  +  L +W  I I +L F RA+ AQ       A+ +    +
Sbjct: 432 FIAQSKKEGDVFNWLMALSGLSSLFTWGFICICHLRFRRALAAQGRSTDELAFTSYVGVW 491

Query: 505 GSYFTLAFCILIAFIKNFTVF---LNHHFDYKNFITGYIGIPVFVISYFGYKFVKKTKIW 561
           GSYF +    L+ FI  F +    +    +  +F   Y+ + V +  Y  +K    T+ W
Sbjct: 492 GSYFGVILICLV-FIAQFWIAVWPMGGTPNASDFFQAYLSVVVVLFFYLAHKLY--TRNW 548

Query: 562 ----KPEEVDLYTFKAAIDEEEEQGKIADAERRERLKNSKTKGWDWF 604
               + +++D+ T +  +D +  + +IA+    E+L+ S TK W W+
Sbjct: 549 TFAKRAKDIDIDTGRRELDLDALKQEIAE----EKLRLS-TKPW-WY 589

>Suva_4.307 Chr4 complement(540768..542597) [1830 bp, 609 aa] {ON}
           YDR046C (REAL)
          Length = 609

 Score =  243 bits (621), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 156/518 (30%), Positives = 256/518 (49%), Gaps = 19/518 (3%)

Query: 84  TRLRKDLKARHISMIAXXXXXXXXXXXXXXXXXYTAGPMSMFIAYAFVGVLVFFTMAALG 143
           ++L+K +K+RH+ M+                  +  GP ++ I Y  V  + +F + A G
Sbjct: 89  SKLKKSMKSRHVVMMTLGTGIGTGLLVANAKGLHYGGPAALVIGYFLVSFVTYFMIQAAG 148

Query: 144 EMASYIPL--DGFTSYASRYCDPALGFAVGYAYLCKYLILPPNQLTAAALVIQYWLDREQ 201
           EMA   P     F +Y+S +     GFA  + Y  ++L + P +L  AA+ I++W D   
Sbjct: 149 EMAVTYPTLPANFNAYSSIFISKPFGFATVWVYCFQWLTVLPLELITAAMTIKFWND--T 206

Query: 202 VNPGVWITIFLVIIVAMNFIGVKFFGEFEFWLSTFKVIVMIGLIILLFVIMLGGGPTHDR 261
           +NP ++I IF V ++ ++F GVK +GE EF  +  K++++ G IIL  VI  GG      
Sbjct: 207 INPDIFILIFFVFLLFIHFFGVKGYGETEFIFNCCKILMIAGFIILSVVINCGGAGNDGY 266

Query: 262 LGFRFYDHPGAFKPYSKSIDGSKGKXXXXXXXXXXXXXXXXGIELTGIVAAEAANPRKSI 321
           +G +++ +PGAF       D S G+                G+EL  +   E ANPRK+ 
Sbjct: 267 IGGKYWRNPGAFAG-----DTSAGRFKNVCYILVTAYFSFGGMELFALSVQEQANPRKTT 321

Query: 322 PKAIKLTMYRIIVFYLVTIFLLGMCVAYDDPLLXXXXXXXXXXXXXPYVVAIINSGIKAL 381
           P A K ++YRI+V YL+T+ L+G  V Y+D  L             PYV+A    G+K +
Sbjct: 322 PVAAKRSIYRILVIYLLTMILIGFNVPYNDDQLMGAGGSATHAS--PYVLAASIHGVKVV 379

Query: 382 PHIFNACVLMFVFSACNSDLYVASRTLYGLAIDNKAPKIFAVTNRWGVPYYSLLMSSCFC 441
           PHI NA +L+ V S  NS LY   R +  LA     PK     +R G P  +L++ S F 
Sbjct: 380 PHIINAVILISVISVANSSLYAGPRLMCSLAQQGYGPKFLDYVDREGRPLIALIVCSVFG 439

Query: 442 LLAYMSVSSGSAKIFNYFVNVVSIFGLLSWISILITYLCFFRAVKAQNVDRSRFAYRAPF 501
           ++ +++ SS    +F +   +  +  L +W SI++++L F +A+K Q        Y+A  
Sbjct: 440 VIGFVAASSKEEVVFAWLAAIAGLSELFTWTSIMLSHLRFRQAMKVQGRSLDELGYKATT 499

Query: 502 QPYGSYFTLAFCILIAFIKNFTVFL-----NHHFDYKNFITGYIGIPVFVISYFGYKFVK 556
             +GS + + F IL+ FI  F V L           ++F   Y+  P+++  Y GY    
Sbjct: 500 GIWGSAYGVFFNILV-FIAQFWVALAPLNNGGKCSAESFFQSYLAFPIWIAFYLGYMIYN 558

Query: 557 K--TKIWKPEEVDLYTFKAAIDEEEEQGKIADAERRER 592
           +  T +   +++DL   +   D E  + +  + E R+R
Sbjct: 559 RDFTFLNPLDKIDLDFHRHIYDPELMRQEDLENEERKR 596

>AGR039C Chr7 complement(779720..781480) [1761 bp, 586 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR046C
           (BAP3) and YBR068C (BAP2); Tandem gene duplication in
           this genome
          Length = 586

 Score =  242 bits (618), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 163/554 (29%), Positives = 271/554 (48%), Gaps = 34/554 (6%)

Query: 64  SRLEDSEKQ---DDYMD-DGKD-------EHTRLRKDLKARHISMIAXXXXXXXXXXXXX 112
           +R  DS K+   D  +D +GKD           L+ ++K RH++MI+             
Sbjct: 35  TRFTDSFKRAQVDTAVDLEGKDADNGLNKTQQTLKHNIKTRHLTMISLGTGIGTGLLVAS 94

Query: 113 XXXXYTAGPMSMFIAYAFVGVLVFFTMAALGEMA-SYIPLDG-FTSYASRYCDPALGFAV 170
               +  GP  + I Y     +++  + A  E+  +Y  L G + +Y +   D   GFAV
Sbjct: 95  GKALHFGGPAGLVIGYVTTSTMLYCVVQACCELGVAYATLPGNYNAYPTFLVDKGFGFAV 154

Query: 171 GYAYLCKYLILPPNQLTAAALVIQYWLDREQVNPGVWITIFLVIIVAMNFIGVKFFGEFE 230
              Y  ++  + P +L  A++ ++YW     VNP V++ IF V ++ ++F G + + E E
Sbjct: 155 ALVYGLQWATVLPLELVTASMTVKYWTS--SVNPDVFVAIFYVFLLFIHFFGSRGYAEAE 212

Query: 231 FWLSTFKVIVMIGLIILLFVIMLGGGPTHDRLGFRFYDHPGAFKPYSKSIDGSKGKXXXX 290
           F  ++ KV++M G II+  + +  G      +G +++  PGAF    ++ID  KG     
Sbjct: 213 FIFNSLKVLLMAGFIIMA-ISLTAGASEQGYIGGQYWHDPGAFGG-DRAIDRFKG----I 266

Query: 291 XXXXXXXXXXXXGIELTGIVAAEAANPRKSIPKAIKLTMYRIIVFYLVTIFLLGMCVAYD 350
                       G E   + AAE ANPR+S+PKA K  +YR++V +L+ + L+G  V ++
Sbjct: 267 CSVWVQAAFAYGGSEFIALTAAEQANPRESVPKATKRWLYRVVVVFLLPVILIGFLVPHN 326

Query: 351 -DPLLXXXXXXXXXXXXXPYVVAIINSGIKALPHIFNACVLMFVFSACNSDLYVASRTLY 409
            D LL             P+V+A    G++ +PHI N  +L  V S  NS +Y A R L 
Sbjct: 327 SDQLLSAEGGSGSRAS--PFVIAAALHGVRVVPHIINFIILTSVISVGNSAMYSAPRILL 384

Query: 410 GLAIDNKAPKIFAVTNRWGVPYYSLLMSSCFCLLAYMSVSSGSAKIFNYFVNVVSIFGLL 469
            LA     PKIF   +R G P  +L+  S F L+A+++ S+    +F +   +  +  L 
Sbjct: 385 SLAEHGMCPKIFTYVDRQGRPLVTLIFVSLFGLIAFVAASNQEENVFTWLSAIAGLSQLF 444

Query: 470 SWISILITYLCFFRAVKAQNVDRSRFAYRAPFQPYGSYFTLAFCILIAFIKNFTVFL--- 526
           +W +I ++++ F RA++ Q        YRA     GSY+ + F +++  I  F + +   
Sbjct: 445 TWTAIAVSHVRFRRAMRVQGRSLGELGYRANTGALGSYYAIFFNVIV-LIAQFWIAIAPI 503

Query: 527 --NHHFDYKNFITGYIGIPVFVISYFGYKFVKK--TKIWKPEEVDLYTFKAAIDEEEEQG 582
             +   D + F   Y+  PV V+ Y GYK  K+    +    EVDL + +   DEE    
Sbjct: 504 PKHGELDVEFFFQNYLAFPVLVVFYLGYKLWKRDFRLVIPSSEVDLLSHRQIFDEEVLLQ 563

Query: 583 KIADAERRERLKNS 596
           +  +AER+ERL+NS
Sbjct: 564 E--EAERKERLRNS 575

>Smik_4.790 Chr4 complement(1389278..1391269) [1992 bp, 663 aa] {ON}
           YDR508C (REAL)
          Length = 663

 Score =  243 bits (620), Expect = 4e-71,   Method: Compositional matrix adjust.
 Identities = 160/538 (29%), Positives = 267/538 (49%), Gaps = 25/538 (4%)

Query: 68  DSEKQDDYMDDGKDEHTRLRKDLKARHISMIAXXXXXXXXXXXXXXXXXYTAGPMSMFIA 127
           D  KQ     + K E+  L+K +K RH  M++                   AGP  + I 
Sbjct: 129 DGIKQAPQEQEQKQEN--LKKSIKPRHTVMMSLGTGIGTGLLVGNSKVLNNAGPGGLIIG 186

Query: 128 YAFVGVLVFFTMAALGEMASYIP--LDGFTSYASRYCDPALGFAVGYAYLCKYLILPPNQ 185
           YA +G  V+  + A GE+A      + GF +Y     DPALGF+V + +  ++L + P +
Sbjct: 187 YAIMGSCVYCIIQACGELAVIYSDLIGGFNTYPLFLVDPALGFSVAWLFCLQWLCVCPLE 246

Query: 186 LTAAALVIQYWLDREQVNPGVWITIFLVIIVAMNFIGVKFFGEFEFWLSTFKVIVMIGLI 245
           L  A++ I+YW  +  V+P V++ IF V+I+ +N  G K + E +F+ +  K++++IG  
Sbjct: 247 LVTASMTIKYWTVK--VDPDVFVVIFYVLIIVINVFGAKGYAEADFFFNCCKILMIIGFF 304

Query: 246 ILLFVIMLGGGPTHDRLGFRFYDHPGAFKPYSKSIDGSKGKXXXXXXXXXXXXXXXXGIE 305
           IL  +I  GG  T   +G +++  PGAF+     I   KG                   E
Sbjct: 305 ILAIIIDCGGAGTDGYIGSKYWRDPGAFRG-DTPIQRFKGIVATFVTAAFAFGMS----E 359

Query: 306 LTGIVAAEAANPRKSIPKAIKLTMYRIIVFYLVTIFLLGMCVAY-DDPLLXXXXXXXXXX 364
              + A+E +NPRK+IP A K  +YRI+  +L ++ L+G  V Y  D LL          
Sbjct: 360 QLAMTASEQSNPRKAIPSAAKKMIYRILFVFLASLTLVGFLVPYTSDQLLGAAGSATKAS 419

Query: 365 XXXPYVVAIINSGIKALPHIFNACVLMFVFSACNSDLYVASRTLYGLAIDNKAPKIFAVT 424
              PYV+A+ + G++ +PH  NA +L+ V S  NS  Y +SR L  LA    APK F   
Sbjct: 420 ---PYVIAVSSHGVRVVPHFINAVILLSVLSVANSAFYTSSRILMSLAKQGNAPKCFDYI 476

Query: 425 NRWGVPYYSLLMSSCFCLLAYMSVSSGSAKIFNYFVNVVSIFGLLSWISILITYLCFFRA 484
           +R G P  ++L+S+ F ++A+ + S     +F + + +  +  L +WI+I ++++ F RA
Sbjct: 477 DREGRPAVAMLVSALFGVIAFCASSKKEEDVFTWLLAISGLSQLFTWITICLSHIRFRRA 536

Query: 485 VKAQNVDRSRFAYRAPFQPYGSYFTLAFCILIAFIKNFTVFL-----NHHFDYKNFITGY 539
           +K Q        Y++    +GS + +   +++A I  F V +           ++F   Y
Sbjct: 537 MKVQGRSLGEVGYKSQVGVWGSAYAV-LMMMLALIAQFWVAIAPIGGGGKLSAQSFFENY 595

Query: 540 IGIPVFVISYFGYKFVKKT-KIWKP-EEVDLYTFKAAIDEEEEQGKIADAERRERLKN 595
           + +P+ +  Y  +K  K    ++ P  +VDL + +   DEE    K  D E +ERL+N
Sbjct: 596 LAMPILIALYIFFKVWKNDWSLFIPANKVDLVSHRNIFDEELL--KQEDEEYKERLRN 651

>ZYRO0C17182g Chr3 complement(1334883..1336619) [1737 bp, 578 aa]
           {ON} similar to uniprot|P38090 Saccharomyces cerevisiae
           YBR132C AGP2 Plasma membrane carnitine transporter
           expression is down-regulated by osmotic stress also
           functions as a low-affinity amino acid permease
          Length = 578

 Score =  241 bits (615), Expect = 5e-71,   Method: Compositional matrix adjust.
 Identities = 145/520 (27%), Positives = 253/520 (48%), Gaps = 10/520 (1%)

Query: 67  EDSEKQDDYMDDGKDEHTRLRKDLKARHISMIAXXXXXXXXXXXXXXXXXYTAGPMSMFI 126
           E SE ++  + + +     +++ LK RH+ +I+                 Y  G  ++ +
Sbjct: 29  ESSEVENGGVVNFERSTRHVQRKLKNRHVQLISISGVIGTALFVSIGKALYHGGAANLLL 88

Query: 127 AYAFVGVLVFFTMAALGEMASYIPLDG-FTSYASRYCDPALGFAVGYAYLCKYLILPPNQ 185
            +A   + +        EM  ++P+   F   A    D +LG    + +     +  P +
Sbjct: 89  GFAIWCIPIMCITVCTAEMVCFLPVSSPFLRLAHMCVDDSLGVMASWNFWFLECVQIPYE 148

Query: 186 LTAAALVIQYWLDREQVNPGVWITIFLVIIVAMNFIGVKFFGEFEFWLSTFKVIVMIGLI 245
           + +   +I YW  R+  N  + + + LV+   ++   V+++GE EFWL++FK+++ IGL 
Sbjct: 149 IVSVNTIIHYW--RDDYNAAIPLVVQLVLYGFISLCTVRYYGEAEFWLASFKIVLAIGLY 206

Query: 246 ILLFVIMLGGGPTHDRLGFRFYDHPGAFKPYSKSIDGSK--GKXXXXXXXXXXXXXXXXG 303
              FV MLGG P HDR GFR+Y     FK Y  +  GS   G                 G
Sbjct: 207 FFTFVTMLGGNPRHDRYGFRYYGE-APFKKYWPNGHGSNASGHFQGFLACVIQAAFTVAG 265

Query: 304 IELTGIVAAEAANPRKSIPKAIKLTMYRIIVFYLVTIFLLGMCVAYDDP-LLXXXXXXXX 362
            E   ++A E   PRK +P+A K    R+ V +L +   +G+  + +DP L         
Sbjct: 266 GEYVSMLAGEVVLPRKVMPRAFKQVFIRLTVLFLGSCLCVGILCSPNDPDLTAAINESRP 325

Query: 363 XXXXXPYVVAIINSGIKALPHIFNACVLMFVFSACNSDLYVASRTLYGLAIDNKAPKIFA 422
                PYV+A+ +  I  LP I NA ++   FS+ N+  Y +SRTLYG+A+D  APKIFA
Sbjct: 326 GAGSSPYVIAMKHLHIHVLPDIVNAALITAAFSSGNAYTYCSSRTLYGMALDGYAPKIFA 385

Query: 423 VTNRWGVPYYSLLMSSCFCLLAYMSVSSGSAKIFNYFVNVVSIFGLLSWISILITYLCFF 482
                G P +++ +S C+  L+ + +   SA + N+ +N+++   L++++ + +TYL F 
Sbjct: 386 RCTPQGTPIFAMAVSMCWGFLSLLQLGDNSAVVLNWLINLITTSQLINFVILCVTYLFFR 445

Query: 483 RAVKAQNVDRSRFAYRAPFQPYGSYFTLAFCILIAFIKNFTVFLNHHFDYKNFITGYIGI 542
           R  K    +  R  +++ +QP+ +Y  +     + FI+ + VF +  +  K F+  Y+ +
Sbjct: 446 RVYKVNEHNLPRLPFKSWWQPWPAYIGIICAGSMTFIQGYAVFFSSLWSTKQFLFSYLML 505

Query: 543 PVFVISYFGYKFV---KKTKIWKPEEVDLYTFKAAIDEEE 579
            + +  Y GYKF+    K K+  P EV+ +   A ID  E
Sbjct: 506 FIDIGLYLGYKFIWRRGKDKLRNPTEVNFFPLLAEIDAHE 545

>CAGL0L07546g Chr12 complement(833821..835725) [1905 bp, 634 aa]
           {ON} highly similar to uniprot|P38084 Saccharomyces
           cerevisiae YBR068c BAP2 or uniprot|P41815 Saccharomyces
           cerevisiae YDR046c PAP1
          Length = 634

 Score =  242 bits (618), Expect = 5e-71,   Method: Compositional matrix adjust.
 Identities = 163/538 (30%), Positives = 272/538 (50%), Gaps = 20/538 (3%)

Query: 67  EDSEKQDDYMDDGKDEHTRLRKDLKARHISMIAXXXXXXXXXXXXXXXXXYTAGPMSMFI 126
           EDS   +    D    +T L+K +K+RH+ M++                 +  GP ++ I
Sbjct: 96  EDSLDLEGSDHDSIITNTHLKKAMKSRHVMMMSLGTGIGTGLLVANAKGLHFGGPAALVI 155

Query: 127 AYAFVGVLVFFTMAALGEMA-SYIPLDG-FTSYASRYCDPALGFAVGYAYLCKYLILPPN 184
            Y  V  + +F + A GEMA +Y  L G F +Y+S +   A GFA  + +  ++L + P 
Sbjct: 156 GYVLVSFVTYFMIQAAGEMAVTYPTLPGNFNAYSSIFVSNAFGFATVWIFCIQWLTVLPL 215

Query: 185 QLTAAALVIQYWLDREQVNPGVWITIFLVIIVAMN-FIGVKFFGEFEFWLSTFKVIVMIG 243
           +L  A+L I+YW D+  +N  V+I IF V ++ ++ F GV  +GE EF  +  K++++IG
Sbjct: 216 ELITASLTIKYWNDK--INADVFIVIFYVFLLCIHLFGGVIAYGETEFLFNLCKILMVIG 273

Query: 244 LIILLFVIMLGGGPTHDRLGFRFYDHPGAFKPYSKSIDGSKGKXXXXXXXXXXXXXXXXG 303
            II+  VI  GG    + +G +F+  PGAF   +    GS+ K                G
Sbjct: 274 FIIMSIVINAGGAGNREYIGGKFWHDPGAF---AGKTAGSRFKGICYVLVSGYFSYG--G 328

Query: 304 IELTGIVAAEAANPRKSIPKAIKLTMYRIIVFYLVTIFLLGMCVAYDDPLLXXXXXXXXX 363
            EL  +   E +NPR+S P+A K ++YRI++ YL+T+ L+G  V YD   L         
Sbjct: 329 TELFALSVNEQSNPRRSTPQASKSSLYRILIIYLLTMILIGFNVPYDSDELMGSGGSATH 388

Query: 364 XXXXPYVVAIINSGIKALPHIFNACVLMFVFSACNSDLYVASRTLYGLAIDNKAPKIFAV 423
               PYV+A   +G+K  PH  NA +L+ V S  NS LY A R +  LA    APK    
Sbjct: 389 AS--PYVLAASLNGVKIAPHFINAVILISVISVANSSLYAAPRLMCSLAQQGYAPKFLDY 446

Query: 424 TNRWGVPYYSLLMSSCFCLLAYMSVSSGSAKIFNYFVNVVSIFGLLSWISILITYLCFFR 483
            +R G P  +L+      ++ +++ S    ++F +   +  +  L +W SI+++++ F  
Sbjct: 447 VDRQGRPLLALIACLLVGVIGFVAASPKEEEVFTWLAAIAGLSELFTWSSIMLSHVRFRM 506

Query: 484 AVKAQNVDRSRFAYRAPFQPYGSYFTLAFCILIAFIKNFTVFLNHHFDYK----NFITGY 539
           A+K QN       Y+A    YGS + + F +L+   + +T       D K    +F   Y
Sbjct: 507 AMKLQNRSLEELGYKATTGIYGSIYGVCFNLLVFAAQFWTALFPFGGDGKANANSFFANY 566

Query: 540 IGIPVFVISYFGYK-FVKKTKIWKP-EEVDLYTFKAAIDEEEEQGKIADAERRERLKN 595
           + +P++++ YFGY  + +  ++ KP +++DL   +   D E  + +  D E +ERL+N
Sbjct: 567 LAMPIWLVFYFGYMLWTRDFQLLKPLDKIDLDFHRRIYDPELMRQE--DEESKERLRN 622

>NCAS0I01530 Chr9 (286882..288669) [1788 bp, 595 aa] {ON} 
          Length = 595

 Score =  241 bits (615), Expect = 7e-71,   Method: Compositional matrix adjust.
 Identities = 163/556 (29%), Positives = 271/556 (48%), Gaps = 33/556 (5%)

Query: 64  SRLEDSEKQDDYMDDGKD---------EHTRLRKDLKARHISMIAXXXXXXXXXXXXXXX 114
           +R  DS K+ +   +G D             L+K +K+RH+ M++               
Sbjct: 46  NRFVDSFKRAEVNHNGIDLEDGTNSIQSDDNLKKAMKSRHVIMMSLGTGIGTGLLVANAK 105

Query: 115 XXYTAGPMSMFIAYAFVGVLVFFTMAALGEMASYIPL--DGFTSYASRYCDPALGFAVGY 172
             Y AGP S+ I Y  V  + +F + A GEMA   P    GF +YAS +     GFA  +
Sbjct: 106 GLYLAGPASLVIGYFMVSFITYFVIQAAGEMAVTYPTLPGGFNNYASIFVSKPFGFATVW 165

Query: 173 AYLCKYLILPPNQLTAAALVIQYWLDREQVNPGVWITIFLVIIVAMNFIGVKFFGEFEFW 232
            +  ++L + P +L  A++ I+YW D+  +N  V++ I  V ++ ++F GV+ +GE EF 
Sbjct: 166 LFCIQWLTVLPLELITASMTIKYWNDK--INADVFVVILYVFLLFIHFFGVRAYGEAEFI 223

Query: 233 LSTFKVIVMIGLIILLFVIMLGGGPTHDRLGFRFYDHPGAFKPYSKSIDGSKGKXXXXXX 292
            ++ K++++ G +IL  V+  GG      +G +++  PGAF       D +  +      
Sbjct: 224 FNSCKILMIGGFVILSIVVNCGGAGVDGYIGGKYWRDPGAFAS-----DNAASRFKGVAF 278

Query: 293 XXXXXXXXXXGIELTGIVAAEAANPRKSIPKAIKLTMYRIIVFYLVTIFLLGMCVAYDDP 352
                     G+EL  +   E  NPR+S P A K ++YRI++ YL+T+ L+G  V ++  
Sbjct: 279 VLVTAYFSYGGVELFALSVNEQENPRRSTPAAAKQSIYRILIIYLLTMILIGFNVPHNSD 338

Query: 353 LLXXXXXXXXXXXXXPYVVAIINSGIKALPHIFNACVLMFVFSACNSDLYVASRTLYGLA 412
            L             PYV+A+   G+K +PHI NA +L+ V S  NS LY + R L  LA
Sbjct: 339 QLMGAGGSATHAS--PYVLAVSIHGVKVVPHIINAVILISVTSVANSALYASPRLLRSLA 396

Query: 413 IDNKAPKIFAVTNRWGVPYYSLLMSSCFCLLAYMSVSSGSAKIFNYFVNVVSIFGLLSWI 472
               APK F   +R G P  +L++ S F ++A+ + S     IF +   +  +  L +W 
Sbjct: 397 EQGYAPKYFNYVDREGRPLRALILCSIFGVIAFCACSDQEEVIFTWLAAIAGLSELFTWS 456

Query: 473 SILITYLCFFRAVKAQNVDRSRFAYRAPFQPYGSYFTLAFCILIAFIKNFTVFLNHH--- 529
           SIL++++ F  A+KAQ    +   Y +    +GS +   F +L+ FI  F V L+     
Sbjct: 457 SILLSHVRFRLAMKAQGKSLNELGYISITGIWGSLYGCFFNVLV-FIAQFWVALSPPGSK 515

Query: 530 --FDYKNFITGYIGIPVFVISYFGYKFVKK--TKIWKPEEVDLYTFKAAIDEEEEQGKIA 585
             +  + F   Y+  PV++  Y GY    +  T +   +++DL   +   D E  + +  
Sbjct: 516 GVYSAEAFFESYLAFPVWLFFYLGYMLYSRDFTFLTDLKKIDLDNHRRLYDPELLRQE-- 573

Query: 586 DAERRERLKNSKTKGW 601
           D E +ER++N    GW
Sbjct: 574 DEETKERIRNG---GW 586

>TBLA0I02010 Chr9 complement(455681..457567) [1887 bp, 628 aa] {ON}
           Anc_3.285 YBR069C
          Length = 628

 Score =  242 bits (617), Expect = 7e-71,   Method: Compositional matrix adjust.
 Identities = 159/532 (29%), Positives = 256/532 (48%), Gaps = 31/532 (5%)

Query: 65  RLEDSEKQDDYMDDGK--DEHTRLRKDLKARHISMIAXXXXXXXXXXXXXXXXXYTAGPM 122
           R+ DS K+    +DG+  +  T+L K +K RHI MI+                   +GP 
Sbjct: 83  RIVDSFKRQKVRNDGEFAETETQLNKTMKPRHIVMISLGTGIGTGLLVGNGQVLSKSGPA 142

Query: 123 SMFIAYAFVGVLVFFTMAALGEMA-SYIPLDG-FTSYASRYCDPALGFAVGYAYLCKYLI 180
            + I Y    ++++  + A GE+   Y  L G +T+Y +   DPA+GFAV   Y  ++L 
Sbjct: 143 GLVIGYGVASIMIYCVVQAAGELGLVYSRLTGNYTTYPTYLIDPAVGFAVSMLYTLQWLT 202

Query: 181 LPPNQLTAAALVIQYWLDREQVNPGVWITIFLVIIVAMNFIGVKFFGEFEFWLSTFKVIV 240
           + P QL  AA+ I+YW     VNP +++   LV+++A+N  G K + E EF+ +  K+++
Sbjct: 203 VLPLQLVTAAMTIRYW--TTNVNPDIFVAAILVLVIAINMFGAKGYAEAEFFCNCCKLLM 260

Query: 241 MIGLIILLFVIMLGGGPTHDRLGFRFYDHPGAFKPYSKSIDGSKGKXXXXXXXXXXXXXX 300
           M G +IL  VI  GG    + +G +++  PGAF       +G KG               
Sbjct: 261 MAGFVILGIVINCGGAGDKEYIGVKYWQTPGAFA------NGFKG----VAAVFCYAAFS 310

Query: 301 XXGIELTGIVAAEAANPRKSIPKAIKLTMYRIIVFYLVTIFLLGMCVAYDDPLLXXXXXX 360
             GIE+  + A E ANPRK+IP A +  +YR++  Y++T  ++   V Y+ P L      
Sbjct: 311 YGGIEVLVLTANEQANPRKAIPDACRKVVYRVLFLYMLTTIIVCFLVPYNSPALLGSNND 370

Query: 361 XXXXXXXPYVVAIINSGIKALPHIFNACVLMFVFSACNSDLYVASRTLYGLAIDNKAPKI 420
                  P+V+A+ + G++ +PHI NA +L+ V S  NS LY   R L  L+    APK 
Sbjct: 371 GSGSDASPFVIAVASHGVQVVPHIINAAILISVISVANSSLYSGPRLLLSLSQQGYAPKC 430

Query: 421 FAVTNRWGVPYYSLLMSSCFCLLAYMSVSSGSAKIFNYFVNVVSIFGLLSWISILITYLC 480
           F   +R G P   +L+S    L+A+++      ++F + + V  +  +  W+SI I++L 
Sbjct: 431 FNYIDRRGRPIICVLVSVAMGLIAFLAAIPAREEVFTWLLAVSGLSQIFIWMSITISHLR 490

Query: 481 FFRAVKAQNVD---RSRFAYRAPFQPYGSYFTLAFCILIAFIKNFTVFL-----NHHFDY 532
           F  A+++Q      R    Y A     GS   LA  I I  +  F V +     N   D 
Sbjct: 491 FRDAIRSQLGGLRARDVVEYTAQTGYVGSLVALAISIFI-LVCQFWVAIAPLGHNGQLDV 549

Query: 533 KNFITGYIGIPVFVISYFGYKFVKKTKIWK----PEEVDLYTFKAAIDEEEE 580
           + F   Y+  PV +  Y  YK   +   W+      E+DL     A +  ++
Sbjct: 550 QIFFENYLAAPVLLGGYLAYKIWHRD--WRLCIPANEIDLSVLPLARESPQD 599

>Skud_2.191 Chr2 complement(342307..344136) [1830 bp, 609 aa] {ON}
           YBR068C (REAL)
          Length = 609

 Score =  241 bits (616), Expect = 7e-71,   Method: Compositional matrix adjust.
 Identities = 161/547 (29%), Positives = 270/547 (49%), Gaps = 25/547 (4%)

Query: 61  TVSSRLEDSEKQDDYMDDGKDEHT---RLRKDLKARHISMIAXXXXXXXXXXXXXXXXXY 117
           +++   + +E   D ++DG +  T   +L+K +K+RH+ M++                 +
Sbjct: 64  SITKTRQINENTSD-LEDGIESITSDSKLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLH 122

Query: 118 TAGPMSMFIAYAFVGVLVFFTMAALGEMASYIPL--DGFTSYASRYCDPALGFAVGYAYL 175
             GP ++ I Y  V  + +F + A GEMA   P     F +Y+S +     GFA  + Y 
Sbjct: 123 YGGPAALVIGYVLVSFVTYFMIQAAGEMAVTYPTLPANFNAYSSIFISKPFGFATVWLYC 182

Query: 176 CKYLILPPNQLTAAALVIQYWLDREQVNPGVWITIFLVIIVAMNFIGVKFFGEFEFWLST 235
            ++L + P +L  A++ IQYW D+  +NP V+I IF + ++ ++  GVK +GE EF  + 
Sbjct: 183 FQWLTVLPLELITASMTIQYWNDK--LNPDVYILIFYIFLLFIHVFGVKAYGETEFIFNC 240

Query: 236 FKVIVMIGLIILLFVIMLGGGPTHDRLGFRFYDHPGAFKPYSKSIDGSKGKXXXXXXXXX 295
            K++++ G IIL  VI  GG      +G  ++ +PGAF       D S  +         
Sbjct: 241 CKILMIAGFIILSVVINCGGAGDDGYIGGAYWHNPGAFAG-----DTSIARFKNVCYILV 295

Query: 296 XXXXXXXGIELTGIVAAEAANPRKSIPKAIKLTMYRIIVFYLVTIFLLGMCVAYDDPLLX 355
                  G+EL  +   E +NPRKS P A K ++YRI++ YL+T+ L+G  V Y+D  L 
Sbjct: 296 TGYFSFGGMELFALSVQEQSNPRKSTPVAAKRSIYRIVIIYLLTMILIGFNVPYNDDQLM 355

Query: 356 XXXXXXXXXXXXPYVVAIINSGIKALPHIFNACVLMFVFSACNSDLYVASRTLYGLAIDN 415
                       PYV+A    G+K +PHI NA +L+ V S  NS LY   R +  L+   
Sbjct: 356 GAGGSATHAS--PYVLAASIHGVKIVPHIINAVILISVVSVANSSLYAGPRLICSLSQQG 413

Query: 416 KAPKIFAVTNRWGVPYYSLLMSSCFCLLAYMSVSSGSAKIFNYFVNVVSIFGLLSWISIL 475
            APK     +R G P  +L++   F ++A+++ SS    +F +   +  +  L +W SI+
Sbjct: 414 YAPKFLDYVDREGRPLRALIVCCIFGVIAFVAASSKEEIVFTWLAAIAGLSELFTWTSIM 473

Query: 476 ITYLCFFRAVKAQNVDRSRFAYRAPFQPYGSYFTLAFCILIAFIKNFTVFL-----NHHF 530
           +++L F +A+K Q        Y+A    +GS +   F IL+ FI  F V L     +   
Sbjct: 474 LSHLRFRQAMKVQGRSLDELGYKATTGIWGSVYGFFFNILV-FIAQFWVALAPLGNDGRC 532

Query: 531 DYKNFITGYIGIPVFVISYFGYKFVKK--TKIWKPEEVDLYTFKAAIDEEEEQGKIADAE 588
             ++F   Y+  P+++  +FGY    +  T +   +++DL   +   D E  + +  D E
Sbjct: 533 SVESFFESYLAAPIWLTFFFGYMIYNRDFTLLNPLDKIDLDFHRRIYDPELIRQE--DQE 590

Query: 589 RRERLKN 595
             E+ KN
Sbjct: 591 NEEKTKN 597

>Kwal_33.15407 s33 (1092383..1094146) [1764 bp, 587 aa] {ON} YGR191W
           (HIP1) - histidine permease [contig 290] FULL
          Length = 587

 Score =  240 bits (613), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 164/539 (30%), Positives = 264/539 (48%), Gaps = 27/539 (5%)

Query: 66  LEDSEKQDDYMDDGKDEHTRLRKDLKARHISMIAXXXXXXXXXXXXXXXXXYTAGPMSMF 125
           LE+ E      D    E +R  KDL  RH+  +A                  T GP S+ 
Sbjct: 53  LENVESTSGTSDA---EDSRYNKDLSVRHLLTLAVGGAIGTGLFVNSGSALTTGGPGSLV 109

Query: 126 IAYAFVGVLVFFTMAALGEMASYIPL-DGFTSYASRYCDPALGFAVGYAYLCKYLILPPN 184
           I +  +   +F  + ALGE++S  P+  GF  Y SR+ +P+ GFAV   YL ++ +L P 
Sbjct: 110 IDWVIISTCLFTIVNALGELSSTFPVVGGFNVYISRFVEPSFGFAVNLNYLAQWAVLLPL 169

Query: 185 QLTAAALVIQYWLDREQVNPGVWITIFLVIIVAMNFIGVKFFGEFEFWLSTFKVIVMIGL 244
           +L AA+L I+YW     +N   W+ IF  II   N + VK FGE EF LS  K++ +IG 
Sbjct: 170 ELVAASLTIRYW--NSTINSDAWVAIFYTIIFLANLLDVKSFGETEFVLSMVKILAIIGF 227

Query: 245 IILLFVIMLGGGPTHDRLGFRFYDHPGAFKPYSKSIDGSKGKXXXXXXXXXXXXXXXXGI 304
            IL  V+  GGGP    +G +++ +PGAF       + S  +                G 
Sbjct: 228 TILGIVLTCGGGPEGGYIGGKYWSNPGAFVG-----NTSSQRFHGLCSVFVTAAFSYSGT 282

Query: 305 ELTGIVAAEAANPRKSIPKAIKLTMYRIIVFYLVTIFLLGMCVAYDDPLLXXXXXXXXXX 364
           EL  + AAE+ NPR ++PKA K T + I V Y+V + L+G  V  DDP L          
Sbjct: 283 ELIAVSAAESVNPRITLPKACKRTFWLITVCYIVVLTLVGCLVPSDDPRLLHGSSSVDVA 342

Query: 365 XXXPYVVAIINSGIKALPHIFNACVLMFVFSACNSDLYVASRTLYGLAIDNKAPKIFAVT 424
              P V+AI N GIK LP + NA +L+ V S  NS +Y  SR +  +A     PK F+  
Sbjct: 343 AS-PLVIAIENGGIKGLPSLMNAIILIAVLSVANSAVYACSRCMASMARIGNLPKTFSYV 401

Query: 425 NRWGVPYYSLLMSSCFCLLAYMSVSSGSAKIFNYFVNVVSIFGLLSWISILITYLCFFRA 484
           +R G P Y++L +  F LL++++ S+    +F +   +  +  L  W +I ++++ F   
Sbjct: 402 DRKGRPLYAILATLIFGLLSFIAASNKQETVFTWLSALSGLSTLFCWFAINVSHIRFRYT 461

Query: 485 VKAQNVDRSRFAYRAPFQPYGSYFTLAFCILIAFIKNFTVFLNHHF-------DYKNFIT 537
           +K +        + +    +GSY+    C++I F+     F    F         ++F  
Sbjct: 462 MKQRGRSLDELPFVSMTGVWGSYYG---CVII-FVVLVVCFWTALFPSTEGVASAESFFE 517

Query: 538 GYIGIPVFVISYFGYK-FVKKTKIWKP-EEVDLYTFKAAIDEE--EEQGKIADAERRER 592
            Y+  P+ ++ Y G+K + K  ++  P  E+D+ + + A+D E  +++ ++ +   RE+
Sbjct: 518 TYLSFPILLVCYIGHKLYTKSWRLLTPTTEIDIDSGRRAVDIEVLKDEKRMEEQAMREK 576

>KLTH0C05170g Chr3 (449510..451306) [1797 bp, 598 aa] {ON} similar
           to uniprot|P38084 Saccharomyces cerevisiae YBR068C BAP2
           High-affinity leucine permease functions as a
           branched-chain amino acid permease involved in the
           uptake of leucine isoleucine and valine contains 12
           predicted transmembrane domains and to YDR046C
           uniprot|P41815 Saccharomyces cerevisiae YDR046C BAP3
           Amino acid permease involved in the uptake of cysteine,
           leucine, isoleucine and valine
          Length = 598

 Score =  240 bits (612), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 167/546 (30%), Positives = 268/546 (49%), Gaps = 30/546 (5%)

Query: 66  LEDSEKQDDYMDDGKDEHTRLRKDLKARHISMIAXXXXXXXXXXXXXXXXXYTAGPMSMF 125
           LE +  Q D  D       RLR+ ++ RH++M++                    GP  + 
Sbjct: 65  LETASVQTDLTDG------RLRRSIRPRHVAMMSVCTGIGTGLLVANGKSLRYGGPGGLI 118

Query: 126 IAYAFVGVLVFFTMAALGEMA-SYIPLDG-FTSYASRYCDPALGFAVGYAYLCKYLILPP 183
           I YA V V+ +  M A GEMA +Y  + G F +Y+S +     GFA  + Y  ++L + P
Sbjct: 119 IGYAAVSVVAYIMMQAAGEMAVAYPSMPGNFNAYSSVFISKPFGFASVWLYCLQWLTVFP 178

Query: 184 NQLTAAALVIQYWLDREQVNPGVWITIFLVIIVAMNFIGVKFFGEFEFWLSTFKVIVMIG 243
            +L  A+L I+YW D   VN  V+I IF V I+ ++F G + +GE EF     KV+++ G
Sbjct: 179 LELITASLTIKYWTD--SVNADVFIAIFYVFILFIHFFGSRGYGESEFIFGLCKVLMIAG 236

Query: 244 LIILLFVIMLGGGPTHDRLGFRFYDHPGAFKPYSKSIDGSKGKXXXXXXXXXXXXXXXXG 303
            +IL  VI  GG      +G R++  PGAF     ++     K                G
Sbjct: 237 FVILAIVINCGGAGNSGYIGARYWHDPGAF-----AVGDPASKFKGFCYVLVTGYFSYGG 291

Query: 304 IELTGIVAAEAANPRKSIPKAIKLTMYRIIVFYLVTIFLLGMCVAY-DDPLLXXXXXXXX 362
            EL  +   E ++PR++I  A K  +YRI+V Y++T+ L+G  V +  D L+        
Sbjct: 292 TELYAMTVNEQSSPRRAIHSATKQCIYRILVIYMLTMVLIGFLVPHTSDELMGSGGKSAT 351

Query: 363 XXXXXPYVVAIINSGIKALPHIFNACVLMFVFSACNSDLYVASRTLYGLAIDNKAPKIFA 422
                PYV+A+   G+K +PHI NA +L+ V S  NS +Y   R L  LA    APK  A
Sbjct: 352 HAS--PYVLAVSLHGVKVVPHIVNAVILIAVVSVGNSAMYSGPRVLNALAEQGYAPKFLA 409

Query: 423 VTNRWGVPYYSLLMSSCFCLLAYMSVSSGSAKIFNYFVNVVSIFGLLSWISILITYLCFF 482
             +R G P  +L+  S   LLA+++ S     +F +   +  +  L +W +IL++++ F 
Sbjct: 410 YIDRAGRPLMALIACSVIGLLAFVAASDHEEDVFTWLAAIAGLSELFTWSAILLSHIRFR 469

Query: 483 RAVKAQNVDRSRFAYRAPFQPYGSYFTLAFCILIAFIKNFTVFL-----NHHFDYKNFIT 537
           +A+K      S+  Y++    +GS + + F IL+ F+  F V L     N   D  +F  
Sbjct: 470 QAMKYHGYSLSQLGYKSITGLWGSIYGVCFNILV-FVAQFWVALAPIGNNGKTDVLSFFQ 528

Query: 538 GYIGIPVFVISYFGYK-FVKKTKIWKP-EEVDLYTFKAAIDEEE-EQGKIADAERRERLK 594
            Y+  P++ + + GY  +  +  I +P +++D+  F+   DEE  EQ K+   E +  L+
Sbjct: 529 SYLAFPLWFVFFLGYMVYSGEWMILRPLKDIDINHFRCVYDEERIEQEKL---EHKTMLQ 585

Query: 595 NSKTKG 600
           NS   G
Sbjct: 586 NSNWLG 591

>Ecym_4230 Chr4 complement(478376..480949) [2574 bp, 857 aa] {ON}
           similar to Ashbya gossypii AGL171W
          Length = 857

 Score =  244 bits (624), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 172/623 (27%), Positives = 294/623 (47%), Gaps = 75/623 (12%)

Query: 46  DKKDGLDINDMDNLSTVS-SRLEDSEKQDDYMDDGKDEHTRLRKDLKARHISMIAXXXXX 104
           +K D   I    N+ T S ++ + S  Q   M   + +   +++ L ARH+ MIA     
Sbjct: 246 EKWDPFLITTSSNVLTSSYNKFKSSTNQQISMSMKRSQKYHVQRKLTARHLQMIAIGASL 305

Query: 105 XXXXXXXXXXXXYTAGPMSMFIAYAFVGVLVFFTMAALGEMASYIPLD-GFTSYASRYCD 163
                         AGP+   I ++  G +   TM +  E+++ IP+  GF+  ASR+ +
Sbjct: 306 GVGLYLTSGKAFSVAGPLGTLIGFSICGSICLATMLSFTELSTLIPISSGFSGLASRFVE 365

Query: 164 PALGFAVGYAYLCKYLILPPNQLTAAALVIQY----WLDREQVNPGVWITIFLVIIVAMN 219
            A GFA+G++Y   + I  P+Q+ A+  +I Y    W    +    +++T+F + + A+N
Sbjct: 366 DAFGFALGWSYWISFTIALPSQIVASIFMISYYSPDWTTTVKSTL-IFVTVFWIYVTAVN 424

Query: 220 FIGVKFFGEFEFWLSTFKVIVMIGLIILLFVIMLGGGPTHDRLGFRFYDHP--------G 271
            + V+FFGE  +  + FK+++ I ++  +FV+ LGG  T  R+GFRF+D          G
Sbjct: 425 LLDVRFFGEIIYTSTLFKLLITIIMMFAMFVLNLGGRNT--RVGFRFWDSSKSPPGLTYG 482

Query: 272 AFKPYSKSID----------GSKGKXXXXXXXXXXXXXXXXGIELTGIVAAEAANPRKSI 321
            F+P    +D          G KG                 G+E+  + + EA NPR+++
Sbjct: 483 LFRPTFDLMDTGQGSLNGIHGIKGNVLSVVLVVLISTFSFSGVEMAFVASGEAINPRRTL 542

Query: 322 PKAIKLTMYRIIVFYLVTIFLLGMCVAYDDPLLXX------------------------- 356
           P A K T  +II  Y++ I   G+ +   D  L                           
Sbjct: 543 PAATKRTFAQIIPIYILAILFAGLNIYSGDSRLLRYFPPTHNPVNMSSEDIQWQIENTCT 602

Query: 357 -----XXXXXXXXXXXPYVVAIINSGIKALPHIFNACVLMFVFSACNSDLYVASRTLYGL 411
                           P+V+A+ + G+      FN  ++ F  SA  S L+ +SRTLY +
Sbjct: 603 GDKIYNLGASNNGNKSPWVIALQSFGLCTFASAFNGILIFFGVSAACSSLFASSRTLYSM 662

Query: 412 AIDNKAPKIFAVTNRWGVPYYSLLMSSCFCLLAYMSVSSGSAKIFNYFVNVVSIFGLLSW 471
           A   KAP+IF   N +GVP+ ++L SS F ++AY++V+    + F    N+ S    + W
Sbjct: 663 ATQEKAPRIFQTCNHYGVPWVAVLFSSAFGVIAYLAVNEACYRNFQTLSNLASATIAIIW 722

Query: 472 ISILITYLCFFRAVKAQ----NVDRSRFAYRAPFQPYGSYFTLAFCILIAFIKNFTVFLN 527
             + +++L F+ A+K +    + D   F Y++PFQPY S + L    L+ F   FT F++
Sbjct: 723 CGLNVSFLRFYFALKRRPDIISRDDPNFPYKSPFQPYLSLYGLIGSTLVVFFMGFTNFID 782

Query: 528 HHFDYKNFITGYIGIPVFVISYFGYKFVKKTKIWKPEEVDLYTFKAAID----EEEEQ-- 581
             +  ++F++ Y G+ +F+  Y  YK    +KI + +++D+ T +  +D    +E  Q  
Sbjct: 783 GFWSTRSFVSSYGGLILFIACYASYKTFGTSKIQRLDQLDMDTGRREMDRMIWDEHRQYS 842

Query: 582 GKIADAERRERLKNSKTKGWDWF 604
           G I      E+L+N  T  W WF
Sbjct: 843 GSIG-----EKLRNLVT--W-WF 857

>KLTH0G11726g Chr7 complement(986837..989311) [2475 bp, 824 aa] {ON}
           similar to uniprot|Q03770 Saccharomyces cerevisiae
           YDR160W SSY1 Component of the SPS plasma membrane amino
           acid sensor system (Ssy1p-Ptr3p-Ssy5p) which senses
           external amino acid concentration and transmits
           intracellular signals that result in regulation of
           expression of amino acid permease genes
          Length = 824

 Score =  244 bits (623), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 162/556 (29%), Positives = 265/556 (47%), Gaps = 59/556 (10%)

Query: 81  DEHTRLRKDLKARHISMIAXXXXXXXXXXXXXXXXXYTAGPMSMFIAYAFVGVLVFFTMA 140
           +E   +++ L  RHI MIA                   AGP    + ++  G +   TM 
Sbjct: 244 EEQYSVQRKLGIRHIQMIATGATMGVGLFLNSGKALSIAGPFGFVLGFSICGSVALATML 303

Query: 141 ALGEMASYIPLD-GFTSYASRYCDPALGFAVGYAYLCKYLILPPNQLTAAALVIQYWLD- 198
           +  E+A+ IP+  GF+  ASR+ + A GFA+G++Y   Y I   NQ+ A+  ++ Y+ + 
Sbjct: 304 SFTEIAALIPISSGFSGLASRFVEDAFGFALGWSYWLTYAITFANQIVASNFMLSYYENM 363

Query: 199 REQVNPGV-WITIFLVIIVAMNFIGVKFFGEFEFWLSTFKVIVMIGLIILLFVIMLGGGP 257
           R+Q    V ++T FL+I V  N + V+   E  +  + FK++V   +I  + V+  G G 
Sbjct: 364 RDQRGATVGFVTFFLIIAVLGNLLDVRILAELTYGFTFFKILVAAMMIFAMIVLNAGAGR 423

Query: 258 THD-RLGFRFYDHP--------GAFKPY----------SKSIDGSKGKXXXXXXXXXXXX 298
            H   +GFRF+D          G F+P            K I G+KG+            
Sbjct: 424 HHHPAVGFRFWDASKSPENLTYGLFRPTFDLRDIGSGSKKGISGAKGRFLSVLVVIVVSS 483

Query: 299 XXXXGIELTGIVAAEAANPRKSIPKAIKLTMYRIIVFYLVTIFLLGMCVAYDDPLLXXXX 358
               GIEL  +   EAANPRKS+P A K T   II  YL++IF++ + V   D  L    
Sbjct: 484 FSFSGIELGFVACGEAANPRKSLPSATKRTFTTIITLYLLSIFVVSLNVYSGDSRLLRYY 543

Query: 359 XXXXXX---------------------------------XXXPYVVAIINSGIKALPHIF 385
                                                     P+V+A+ + G+     +F
Sbjct: 544 TAATQSPTTVLLHAFNTNWQIDETCNKNVIFSSTDFSNGSQSPWVLALESFGLCTFSSVF 603

Query: 386 NACVLMFVFSACNSDLYVASRTLYGLAIDNKAPKIFAVTNRWGVPYYSLLMSSCFCLLAY 445
           NA +++F  ++  S LY +SRTLY +A   KAP +F + +R GVPY ++L S  F  LAY
Sbjct: 604 NAILVVFGVTSEFSSLYASSRTLYSMATQEKAPAVFKLCSRNGVPYVAVLFSGLFGALAY 663

Query: 446 MSVSSGSAKIFNYFVNVVSIFGLLSWISILITYLCFFRAVKAQ----NVDRSRFAYRAPF 501
           ++++S S +IF    N+      + W+ + +++L F+ A++ +    + D   F YR+PF
Sbjct: 664 LTINSRSLEIFQALANISGATISIIWLGLNVSFLRFYYALRKRTDIISRDDPSFPYRSPF 723

Query: 502 QPYGSYFTLAFCILIAFIKNFTVFLNHHFDYKNFITGYIGIPVFVISYFGYKFVKKTKIW 561
           QPY + + L    LI  +  F+ FL+  ++ K F + Y G+  F I Y GYK    +K+ 
Sbjct: 724 QPYVACYGLIGSFLIVVLMGFSNFLHGFWNTKMFFSSYGGLMFFTICYLGYKVFGTSKLQ 783

Query: 562 KPEEVDLYTFKAAIDE 577
           + +++DL + +  +D 
Sbjct: 784 RLDQLDLDSGRREMDR 799

>SAKL0D04664g Chr4 complement(365852..367633) [1782 bp, 593 aa] {ON}
           highly similar to uniprot|P19145 Saccharomyces
           cerevisiae YKR039W GAP1 General amino acid permease;
           localization to the plasma membrane is regulated by
           nitrogen source
          Length = 593

 Score =  239 bits (610), Expect = 4e-70,   Method: Compositional matrix adjust.
 Identities = 162/514 (31%), Positives = 273/514 (53%), Gaps = 19/514 (3%)

Query: 83  HTRLRKDLKARHISMIAXXXXXXXXXXXXXXXXXYTAGPMSMFIAYAFVGVLVFFTMAAL 142
           ++ L++ LK RH+ MIA                  TAGP  + I +A  G +++  + A+
Sbjct: 74  NSPLKRHLKNRHLQMIAIGGAIGTGLFVGSGKALRTAGPAGILIGWALTGTMIYCMVMAM 133

Query: 143 GEMASYIPLDG-FTSYASRYCDPALGFAVGYAYLCKYLILPPNQLTAAALVIQYWLDREQ 201
           GE+A   P+ G FT+YA+R+ D + G+A  + Y+ ++L++ P ++ AA++ + YW    +
Sbjct: 134 GELAVTFPVSGGFTTYATRFIDESFGYANNFNYMLQWLVVLPLEIVAASITVNYWGTDPK 193

Query: 202 VNPGVWITIFLVIIVAMNFIGVKFFGEFEFWLSTFKVIVMIGLIILLFVIMLGGGPTHDR 261
              G ++ +F V+IV++N  GVK +GE EF  S  KVI +IG IIL  +++ GGGP    
Sbjct: 194 YRDG-FVALFYVVIVSINMFGVKGYGEAEFVFSFIKVITVIGFIILGIILVCGGGPVGGY 252

Query: 262 LGFRFYDHPGAFKPYSKSIDGSKGKXXXXXXXXXXXXXXX-XGIELTGIVAAEAANPRKS 320
           +G   + +PGAF      +  + GK                 G EL G+ +AE ANPRKS
Sbjct: 253 IGGANWHNPGAF------VGNTAGKRFKGVCSVFVTAAFSFAGSELVGLASAETANPRKS 306

Query: 321 IPKAIKLTMYRIIVFYLVTIFLLGMCVAYDDPLLXXXXXXXXXXXXXPYVVAIINSGIKA 380
           +P+A K   +RI +FY++++ L+G+ V Y+D  L             P+V+AI N GIK 
Sbjct: 307 LPRAAKQVFWRITLFYIISLCLIGLLVPYNDTRLIGASSVDAAAS--PFVLAIKNHGIKG 364

Query: 381 LPHIFNACVLMFVFSACNSDLYVASRTLYGLAIDNKAPKIFAVTNRWGVPYYSLLMSSCF 440
           LP + N  +L+ V S  NS ++  SRTL  LA     PKIF   +R G P   +  +S F
Sbjct: 365 LPSVVNVVILIAVLSVGNSAVFGCSRTLTALAEQGFLPKIFGYIDRKGRPLVGIGFTSFF 424

Query: 441 CLLAYMSVSSGSAKIFNYFVNVVSIFGLLSWISILITYLCFFRAVKAQNVDRSRFAYRAP 500
            LL++++ S    ++F++ + +  +  L +W++I I +L F RA+ AQ       ++ +P
Sbjct: 425 GLLSFIAASPKEGEVFDWLLALSGLSSLFTWMAICICHLRFRRALSAQGRSTDELSFVSP 484

Query: 501 FQPYGSYFTLAFCILIAFIKNFTVF--LNHHFDYKNFITGYIGIPVFVISYFGYKFVKKT 558
              +GS +     +LI   + +     +    D K+F   Y+ +PV ++ Y G+K  K+ 
Sbjct: 485 AGVWGSIYGTVLIMLILAAQFWIALFPIGSPPDAKDFFESYLSLPVVLVMYIGHKCYKRN 544

Query: 559 KIWK----PEEVDLYTFKAAIDEEEEQGKIADAE 588
             WK     E +D+ T +  +D E  + ++A+ +
Sbjct: 545 --WKLFIRAENIDIDTGRREVDIEALKVELAEEK 576

>NDAI0G06030 Chr7 complement(1489584..1491383) [1800 bp, 599 aa]
           {ON} 
          Length = 599

 Score =  239 bits (610), Expect = 4e-70,   Method: Compositional matrix adjust.
 Identities = 164/533 (30%), Positives = 265/533 (49%), Gaps = 35/533 (6%)

Query: 78  DGKDEHTRLRKDLKARHISMIAXXXXXXXXXXXXXXXXXYTAGPMSMFIAYAFVGVLVFF 137
           DG      L++ LKARH+ MIA                  + GP+++ I ++  G  +  
Sbjct: 77  DGSFHTHNLKRTLKARHLIMIAIGGSIGTGLFIGSGQALASGGPLALIIGWSIAGTQIVG 136

Query: 138 TMAALGEMASYIPLDG-FTSYASRYCDPALGFAVGYAYLCKYLILPPNQLTAAALVIQYW 196
           T+  LGE+    P+ G F +Y++R+ DP++ F +   Y+ ++  + P ++ A+A+ IQYW
Sbjct: 137 TIHGLGEITVRFPVVGAFANYSTRFLDPSISFVISTIYVIQWFFVLPLEIIASAMTIQYW 196

Query: 197 LDREQVNPGVWITIFLVIIVAMNFIGVKFFGEFEFWLSTFKVIVMIGLIILLFVIMLGGG 256
              + ++P VW+ IF  +IV++N  G + FGE EF  S+ KVI +IG IIL  V++ GGG
Sbjct: 197 --NQSIDPVVWVAIFYCVIVSINLFGARGFGEAEFLFSSIKVITIIGFIILCIVLICGGG 254

Query: 257 PTHDRLGFRFYDHPGAFKPYSKSIDGSKGKXXXXXXXXXXXXXXXXGIELTGIVAAEAAN 316
           P HD +G R++  PG          G  G                 G E+  + + E  N
Sbjct: 255 PDHDFVGARYWHDPGCLS------HGFPG----VLSVLVVASYSLGGTEMVCLASGET-N 303

Query: 317 PRKSIPKAIKLTMYRIIVFYLVTIFLLGMCVAYDDPLLXXXXXXXXXXXXXPYVVAIINS 376
           PR+ +P AIK T +RI+ F+L+++ L+G  V Y +P L             P+V+AI   
Sbjct: 304 PRE-LPSAIKQTFWRILFFFLISLTLIGFLVPYTNPNLLGGSSVNNS----PFVIAIKLH 358

Query: 377 GIKALPHIFNACVLMFVFSACNSDLYVASRTLYGLAIDNKAPKIFAVTNRWGVPYYSLLM 436
            IKALP I NA +L+ + S  NS ++ +SRTL  +A     PK F   +R G P   +L 
Sbjct: 359 HIKALPSIVNAVILISIMSVGNSCIFASSRTLCSMAHQGLIPKFFGYIDRAGRPLTGILT 418

Query: 437 SSCFCLLAYMSVSSGSAKIFNYFVNVVSIFGLLSWISILITYLCFFRAVKAQNVDRSRFA 496
           +S F LLA++  SS   ++F++ + +  +   + W+SI I+++ F  A+KAQ        
Sbjct: 419 NSLFGLLAFLVKSSSMGEVFDWLMAIAGLATCIVWLSINISHIRFRLAMKAQGKSLDELE 478

Query: 497 YRAPFQPYGSYFTLAFCILIAFIKNFTVFL-------NHHFDYKNFITGYIGIPV----F 545
           + +    +GS ++     LI  I  F   L       +     K F   Y+   +    F
Sbjct: 479 FVSAVGMWGSAYSALINSLI-LIAQFYCALWPIGGWKDSSERAKTFFQSYLCALIMAFLF 537

Query: 546 VIS--YFGYKFVKKTKIWKPEEVDLYTFKAAIDEEEEQGKIADAERRERLKNS 596
           V    ++ YK  K   I   +++DL T +  ID +  + +I  AER   L+ S
Sbjct: 538 VCHKVFYRYKTGKWWAIMDLDKIDLETDRKNIDIDVLKQEI--AERNRHLQAS 588

>Smik_2.201 Chr2 complement(355785..357614) [1830 bp, 609 aa] {ON}
           YBR068C (REAL)
          Length = 609

 Score =  239 bits (610), Expect = 4e-70,   Method: Compositional matrix adjust.
 Identities = 158/545 (28%), Positives = 267/545 (48%), Gaps = 24/545 (4%)

Query: 63  SSRLEDSEKQDDYMDDGKDEHT---RLRKDLKARHISMIAXXXXXXXXXXXXXXXXXYTA 119
           +++++   +    ++DG    T   +L+K +K+RH+ M++                 +  
Sbjct: 65  TTKIKPINENTSDLEDGIQSFTSDSKLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLHYG 124

Query: 120 GPMSMFIAYAFVGVLVFFTMAALGEMASYIPL--DGFTSYASRYCDPALGFAVGYAYLCK 177
           GP ++ I Y  V  + +F + A GEMA   P     F +Y+S +     GFA  + Y  +
Sbjct: 125 GPAALVIGYVLVSFITYFMIQAAGEMAVTYPTLPANFNAYSSIFISKPFGFATVWLYCFQ 184

Query: 178 YLILPPNQLTAAALVIQYWLDREQVNPGVWITIFLVIIVAMNFIGVKFFGEFEFWLSTFK 237
           +  + P +L  A++ IQ+W D+  +NP ++I IF V ++ ++F GVK +GE EF  +  K
Sbjct: 185 WTTVLPLELITASMTIQFWNDK--INPDIYILIFYVFLLFVHFFGVKAYGETEFIFNCCK 242

Query: 238 VIVMIGLIILLFVIMLGGGPTHDRLGFRFYDHPGAFKPYSKSIDGSKGKXXXXXXXXXXX 297
           ++++ G I+L  VI  GG      +G  ++  PGAF       D S  +           
Sbjct: 243 ILMIAGFIVLSVVINCGGAGNDGYIGGAYWHKPGAFAG-----DTSIARFKNVCYILVTA 297

Query: 298 XXXXXGIELTGIVAAEAANPRKSIPKAIKLTMYRIIVFYLVTIFLLGMCVAYDDPLLXXX 357
                G+EL  +   E  NPRKS P A K ++YRI+V YL+T+ L+G  V Y+D  L   
Sbjct: 298 YFSFGGMELFVLSVQEQTNPRKSTPVAAKRSIYRIVVIYLLTMILIGFNVPYNDDQLLGA 357

Query: 358 XXXXXXXXXXPYVVAIINSGIKALPHIFNACVLMFVFSACNSDLYVASRTLYGLAIDNKA 417
                     PYV+A    G++ +PHI NA +L+ V S  NS LY   R +  LA    A
Sbjct: 358 GGSATHAS--PYVLAASIHGVRIVPHIINAVILISVVSVANSSLYAGPRLICSLAQQGYA 415

Query: 418 PKIFAVTNRWGVPYYSLLMSSCFCLLAYMSVSSGSAKIFNYFVNVVSIFGLLSWISILIT 477
           PK     +R G P  +L++     ++A+++ SS    +F +   +  +  L +W SI+++
Sbjct: 416 PKFLDYVDREGRPLRALIVCCVIGVIAFVAASSKEEIVFTWLAAIAGLSELFTWTSIMLS 475

Query: 478 YLCFFRAVKAQNVDRSRFAYRAPFQPYGSYFTLAFCILIAFIKNFTVFL-----NHHFDY 532
           +L F +A+K Q    +   Y+A    +GS +   F IL+ FI  F V L         + 
Sbjct: 476 HLRFRQAMKVQGRSLNELGYKATTGIWGSIYGSFFNILV-FIAQFWVALAPLGNGGKCNA 534

Query: 533 KNFITGYIGIPVFVISYFGYKFVKK--TKIWKPEEVDLYTFKAAIDEEEEQGKIADAERR 590
           + F   Y+  P+++I Y GY    +  T +   +++DL   +   D E  + +  D E +
Sbjct: 535 EAFFESYLAAPIWLIFYIGYMIYNRDFTLLNPLDKIDLDFHRRVYDPELMRQE--DEENK 592

Query: 591 ERLKN 595
           E++KN
Sbjct: 593 EKIKN 597

>ZYRO0F17446g Chr6 (1451431..1453332) [1902 bp, 633 aa] {ON} similar
           to uniprot|P48813 Saccharomyces cerevisiae YDR508C GNP1
           High-affinity glutamine permease also transports Leu Ser
           Thr Cys Met and Asn expression is fully dependent on
           Grr1p and modulated by the Ssy1p-Ptr3p-Ssy5p (SPS)
           sensor of extracellular amino acids
          Length = 633

 Score =  239 bits (610), Expect = 7e-70,   Method: Compositional matrix adjust.
 Identities = 166/553 (30%), Positives = 278/553 (50%), Gaps = 22/553 (3%)

Query: 53  INDMDN-LSTVSSRLEDSEKQDDYMDDGKDEHTRLRKDLKARHISMIAXXXXXXXXXXXX 111
           I D++N L+T  S    +       D+   +   L++D+  RH+  +A            
Sbjct: 83  IADLENDLTTAVSPQLSNYHGSIPSDEVVIKKEELKRDINQRHMVFMAIGSGVGTGLLVG 142

Query: 112 XXXXXYTAGPMSMFIAYAFVGVLVFFTMAALGEMA-SYIPL-DGFTSYASRYCDPALGFA 169
                 +AGP  + I YA +G  V+  + A GE+  +Y  L  GF +Y +    P+  F+
Sbjct: 143 NASTLNSAGPAGLLIGYALMGTCVYCVIQAAGELGVTYANLIGGFNAYPAILVAPSFAFS 202

Query: 170 VGYAYLCKYLILPPNQLTAAALVIQYWLDREQVNPGVWITIFLVIIVAMNFIGVKFFGEF 229
           VG+ Y  ++L + P +L  A+L I+YW  +  V+P V++ IF ++I+ +NF G K + E 
Sbjct: 203 VGWIYTLQWLCMTPLELVTASLTIKYWTTK--VDPDVFVVIFYLLILLINFFGSKGYAEA 260

Query: 230 EFWLSTFKVIVMIGLIILLFVIMLGGGPTHDRLGFRFYDHPGAFKPYSKSIDGSKGKXXX 289
           +F+ +  K+ ++ G  IL  V+  GG      LG +++ +PGAF+   K+ID  KG    
Sbjct: 261 DFFFNCMKLAMISGFFILGIVVACGGAGHDGYLGGKYWHNPGAFRG-EKAIDHFKG---- 315

Query: 290 XXXXXXXXXXXXXGIELTGIVAAEAANPRKSIPKAIKLTMYRIIVFYLVTIFLLGMCVAY 349
                        G E   + A+E ANPRKSIP A KL +YRII  YL +I +LG  V +
Sbjct: 316 VSSVFVTSAFAFGGSEFVALSASEQANPRKSIPSAAKLILYRIIWVYLTSITILGFLVPW 375

Query: 350 DDPLLXXXXXXXXXXXXXPYVVAIINSGIKALPHIFNACVLMFVFSACNSDLYVASRTLY 409
           D P L             PYVVAI   G+K +PH+ NA +LM V S  NS  + +SR L 
Sbjct: 376 DSPQLQPSSDGKKTS---PYVVAIAMHGVKVVPHLINAVILMAVLSVSNSAFFYSSRLLL 432

Query: 410 GLAIDNKAPKIFAVTNRWGVPYYSLLMSSCFCLLAYMSVSSGSAKIFNYFVNVVSIFGLL 469
            L+    APK F   +R G P  ++L+S+ F ++ + + S     +F++ + +  +  + 
Sbjct: 433 SLSQRGYAPKWFDYVDRKGRPVRAMLISALFGVICFCATSKKETDVFSWLLAISGLSTIF 492

Query: 470 SWISILITYLCFFRAVKAQNVDRSRFAYRAPFQPYGSYFTLAFCILIAFIKNFTVFL--- 526
           ++ SI ++++    A+K Q        +R+    YGS++     +L + +  F V L   
Sbjct: 493 TYFSICVSHIRMRSAMKVQGRSLGELGFRSQVGTYGSFYACLLLVL-SLMAEFWVALAPI 551

Query: 527 -NHHFDYKNFITGYIGIPVFVISYFGYKFVKKT-KIW-KPEEVDLYTFKAAIDEEEEQGK 583
                D ++F   Y+  P+ ++ YFGY   KK  +I+ + +++DL   +   DE+    K
Sbjct: 552 GEGKLDAESFFENYLAAPIGIVFYFGYMIWKKDFRIFIRSKDIDLDFKRQVFDEDLI--K 609

Query: 584 IADAERRERLKNS 596
             D E  E+++N+
Sbjct: 610 QEDEEYAEQMRNA 622

>AGR038C Chr7 complement(777529..779271) [1743 bp, 580 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR046C
           (BAP3) and YBR068C (BAP2); Tandem gene duplication in
           this genome
          Length = 580

 Score =  238 bits (607), Expect = 7e-70,   Method: Compositional matrix adjust.
 Identities = 164/545 (30%), Positives = 274/545 (50%), Gaps = 24/545 (4%)

Query: 63  SSRLEDSEKQDDYMDDGK---DEHTRLRKDLKARHISMIAXXXXXXXXXXXXXXXXXYTA 119
           S R ED+ +  D ++DG+    + T+L++ ++ RH+ M++                 +  
Sbjct: 38  SFRREDTSRSGD-LEDGEINSTDTTKLQQRMRTRHVVMMSLGTGIGTGLLVANAASLHYG 96

Query: 120 GPMSMFIAYAFVGVLVFFTMAALGEMA-SYIPLDG-FTSYASRYCDPALGFAVGYAYLCK 177
           GP  + I Y  V ++ +  M A GEMA +Y  L G F +Y+S +     GFA  + +  +
Sbjct: 97  GPAGLLIGYLLVSIVSYIMMHAAGEMAVAYPTLPGNFNAYSSIFISKPFGFATVWLFCLQ 156

Query: 178 YLILPPNQLTAAALVIQYWLDREQVNPGVWITIFLVIIVAMNFIGVKFFGEFEFWLSTFK 237
           +L + P +L  A +VI+YW  +  VN  V++ IF + I+ ++F G + +GE EF  +  K
Sbjct: 157 WLTVFPLELITATIVIKYW--KVSVNANVFVVIFYLFIICIHFFGARGYGETEFIFNMCK 214

Query: 238 VIVMIGLIILLFVIMLGGGPTHDRLGFRFYDHPGAFKPYSKSIDGSKGKXXXXXXXXXXX 297
           V++++G +I+  +I +G       +G R++ +PG+F      +D  KG            
Sbjct: 215 VLMIVGFVIVGILINVGAIGDTGYIGDRYWRNPGSFVS-GTPLDKLKGTAYVLVTAYFSF 273

Query: 298 XXXXXGIELTGIVAAEAANPRKSIPKAIKLTMYRIIVFYLVTIFLLGMCVAYDDPLLXXX 357
                G+EL  +   E  NP+ +IP A K  +YRI++ YL+T+ ++G  V +D   L   
Sbjct: 274 G----GMELYALSVNELPNPKTAIPSACKKGVYRILLVYLLTMIMIGFLVPHDSDRLMGS 329

Query: 358 XXXXXXXXXXPYVVAIINSGIKALPHIFNACVLMFVFSACNSDLYVASRTLYGLAIDNKA 417
                     PYV+AI   G+K LPHI NA +L+ V S  NS +Y A R L  LA    A
Sbjct: 330 GSNDVHPS--PYVLAIEMHGVKVLPHIVNAVILISVISVGNSAMYSAPRLLCALAQQGYA 387

Query: 418 PKIFAVTNRWGVPYYSLLMSSCFCLLAYMSVSSGSAKIFNYFVNVVSIFGLLSWISILIT 477
           PK     +R G P  SL++ + F L+A+ + S    KIF +   +  +  L +W SI ++
Sbjct: 388 PKQLDYIDREGRPLISLILCAIFGLIAFSAASDNQEKIFIWLAAIAGLSELFTWTSICLS 447

Query: 478 YLCFFRAVKAQNVDRSRFAYRAPFQPYGSYFTLAFCILIAFIKNFTVFL----NHHFDYK 533
           +  F +A+K Q        YRA    +GS + + F +L+ FI  F V L        D  
Sbjct: 448 HFRFRQAMKLQGRSLETLGYRAITGQWGSLYAVFFNLLV-FIAQFWVALVPIAKKKVDVL 506

Query: 534 NFITGYIGIPVFVISYFGYK-FVKKTKIWKP-EEVDLYTFKAAIDEEEEQGKIADAERRE 591
           +F   Y+  P+++I + GY  + +   +  P +++DL T +   D E    K  + E +E
Sbjct: 507 SFFQNYMAFPLWLIMFLGYMVYSRNWTLLNPLDKMDLDTHRRVYDVEVL--KQEEYEFKE 564

Query: 592 RLKNS 596
           R++NS
Sbjct: 565 RMRNS 569

>TBLA0I02000 Chr9 complement(452716..454710) [1995 bp, 664 aa] {ON}
           Anc_3.284 YDR046C
          Length = 664

 Score =  239 bits (611), Expect = 9e-70,   Method: Compositional matrix adjust.
 Identities = 166/555 (29%), Positives = 261/555 (47%), Gaps = 22/555 (3%)

Query: 54  NDMDNLSTVSSRLEDSEKQDDYMDDGKDEHTR--LRKDLKARHISMIAXXXXXXXXXXXX 111
           N +D+       +E   + +   ++G  E  R  L+K +K+RH+ M++            
Sbjct: 109 NWIDSFKPPEECMESELELNSIDENGHREKPRAQLKKTMKSRHVVMMSLGTGIGTGLLVS 168

Query: 112 XXXXXYTAGPMSMFIAYAFVGVLVFFTMAALGEMA-SYIPLDG-FTSYASRYCDPALGFA 169
                  +GP  + I Y  V ++ +  + A GEM  +Y  L G F +Y S +    +GFA
Sbjct: 169 NASCLSLSGPAPLVIGYGLVSIITYLLIQAAGEMGVAYPTLPGNFNTYISTFLSRPIGFA 228

Query: 170 VGYAYLCKYLILPPNQLTAAALVIQYWLDREQVNPGVWITIFLVIIVAMNFIGVKFFGEF 229
             +    ++L + P +L AA++ I+YW     ++P V++ IF V +  ++F G   +GE 
Sbjct: 229 TIWLSSIQWLTVVPLELIAASMTIKYW--TTSISPDVFVVIFYVFLNFIHFFGTAAYGET 286

Query: 230 EFWLSTFKVIVMIGLIILLFVIMLGGGPTHDRLGFRFYDHPGAFKPYSKSIDGSKGKXXX 289
           EF  +  K++++IG IIL  VI  GG      +G +++  PGAF         S  +   
Sbjct: 287 EFIFNLCKILMIIGFIILSIVINCGGAGHDGYIGGKYWHTPGAFVG-----KNSASRFKD 341

Query: 290 XXXXXXXXXXXXXGIELTGIVAAEAANPRKSIPKAIKLTMYRIIVFYLVTIFLLGMCVAY 349
                        G EL  +   E  NPRKS P A K T+YRI++ YL+T+ LLG  V Y
Sbjct: 342 VCYILVTAFFSYGGTELFVLTINEQPNPRKSTPTAAKTTIYRILIVYLLTMILLGFNVPY 401

Query: 350 DDP-LLXXXXXXXXXXXXXPYVVAIINSGIKALPHIFNACVLMFVFSACNSDLYVASRTL 408
           D+  L              PYV+A    G+K +PH  NA VL+ + S  NS  Y A R +
Sbjct: 402 DNKNLFSATSSNGDSISISPYVLAASIHGVKVVPHFINAVVLIALISVANSATYAAPRMM 461

Query: 409 YGLAIDNKAPKIFAVTNRWGVPYYSLLMSSCFCLLAYMSVSSGSAKIFNYFVNVVSIFGL 468
             LA    APK  A  +R G P Y LL+ S   ++ + + S    ++F +   +  +  L
Sbjct: 462 ASLAQQGMAPKFLAYIDREGRPIYGLLICSLLGVIGFAAASDKEQEVFVWLAAIAGLATL 521

Query: 469 LSWISILITYLCFFRAVKAQNVDRSRFAYRAPFQPYGSYFTLAFCILIAFIKNFTVFLN- 527
             W    ++++ F  A+K Q  D +   Y+A    +GS     F +L+  I NF V L  
Sbjct: 522 FLWECFFLSHIRFRWAMKVQGKDINEVGYKAACGIWGSIIGACFNVLV-LIANFWVSLTP 580

Query: 528 ----HHFDYKNFITGYIGIPVFVISYFGYKFVKKT-KIWKP-EEVDLYTFKAAIDEEEEQ 581
                +   KNF    + +P+++    GY  +KK   IW P E +DL   +   D   EQ
Sbjct: 581 PGQGSNVSAKNFFEQMLALPIWIFFAVGYMVIKKDWVIWNPIESIDLDYCRKIYD--PEQ 638

Query: 582 GKIADAERRERLKNS 596
            K  D E RER++N+
Sbjct: 639 LKREDEENRERIRNA 653

>TPHA0A02450 Chr1 (522439..524190) [1752 bp, 583 aa] {ON} Anc_3.397
           YBR132C
          Length = 583

 Score =  238 bits (606), Expect = 9e-70,   Method: Compositional matrix adjust.
 Identities = 153/516 (29%), Positives = 258/516 (50%), Gaps = 18/516 (3%)

Query: 79  GKDEHTRLR------KDLKARHISMIAXXXXXXXXXXXXXXXXXYTAGPMSMFIAYAFVG 132
           G DE   ++      ++LK RH+  IA                 Y  GP ++ IA+A   
Sbjct: 54  GSDEELLIKEIYTTKRNLKNRHVQFIAISGVIGTAIFVAIGKALYKGGPGNLIIAFAVWC 113

Query: 133 VLVFFTMAALGEMASYIPLDG-FTSYASRYCDPALGFAVGYAYLCKYLILPPNQLTAAAL 191
           + +     +  EM S+ P+   F   A+   D +      + +     +  P ++ +   
Sbjct: 114 IPILCITMSTAEMVSFYPVHSPFLRLATMCGDDSFSIMASWNFWFLECVQIPFEIVSVNT 173

Query: 192 VIQYWLDREQVNPGVWITIFLVIIVAMNFIGVKFFGEFEFWLSTFKVIVMIGLIILLFVI 251
           +I YW  R+  +  + + + +V+ + ++ + VK++GE EFWL++FK+I+ +GL +  F+ 
Sbjct: 174 IIHYW--RDDYSAAIPLVVQVVLYILISVLAVKYYGELEFWLASFKIILALGLFLFTFIT 231

Query: 252 MLGGGPTHDRLGFRFYDHPGAFKPYSKSIDG----SKGKXXXXXXXXXXXXXXXXGIELT 307
           M+GG P HDR GFR+      FK Y    D     S G                 G E  
Sbjct: 232 MVGGNPKHDRYGFRYLSE-SPFKKYYPDGDTTAGPSAGHFQGFLICLIQAAFTIAGGEYI 290

Query: 308 GIVAAEAANPRKSIPKAIKLTMYRIIVFYLVTIFLLGMCVAYDDPLLXXXXXXXX-XXXX 366
            ++A E   PRK +PKA K   +R+   ++ + F +G+  + +DPLL             
Sbjct: 291 SMLAGEVCLPRKVMPKAFKQVFWRLTFIFIGSCFCVGIVCSSNDPLLTSAINESRPGAGS 350

Query: 367 XPYVVAIINSGIKALPHIFNACVLMFVFSACNSDLYVASRTLYGLAIDNKAPKIFAVTNR 426
            PYV+A+ N  I+ LP I N  ++   FSA N+  Y +SRTLYG+A+D  APKIF   N+
Sbjct: 351 SPYVIAMQNLQIRILPDIVNIALITAAFSAGNAYTYCSSRTLYGIALDGNAPKIFKKCNK 410

Query: 427 WGVPYYSLLMSSCFCLLAYMSVSSGSAKIFNYFVNVVSIFGLLSWISILITYLCFFRAVK 486
            GVP Y +L+S+ + LL+ + ++S SA + N+ +N+++   L+++  I ITYL F RA +
Sbjct: 411 EGVPIYCVLVSTLWALLSLLQLNSNSAVVLNWLINLITASQLINFSCICITYLLFRRAYR 470

Query: 487 AQNVDRSRFAYRAPFQPYGSYFTLAFCILIAFIKNFTVFLNHHFDYKNFITGYIGIPVFV 546
           AQ     R  + + +QPY +YF L   I +  ++ +TVF    +   +F+  Y+ I + +
Sbjct: 471 AQEDSLPRLPFTSWYQPYTTYFGLFCSISMMLVQGYTVFFKKLWAVDDFLFNYLMIFIDL 530

Query: 547 ISYFGYKFV---KKTKIWKPEEVDLYTFKAAIDEEE 579
             Y G KF+    K  +  P+++D  T    I++ E
Sbjct: 531 AIYLGVKFIWKRGKDPVKDPKKIDFETELKNIEQHE 566

>Ecym_1056 Chr1 (102260..104080) [1821 bp, 606 aa] {ON} similar to
           Ashbya gossypii AFR698C
          Length = 606

 Score =  238 bits (608), Expect = 9e-70,   Method: Compositional matrix adjust.
 Identities = 154/549 (28%), Positives = 271/549 (49%), Gaps = 25/549 (4%)

Query: 56  MDNLSTVSSRLEDSEKQDDYMDDGKDEHTRLRKDLKARHISMIAXXXXXXXXXXXXXXXX 115
           +++      R  D E   D      ++H +L++ ++ RH+ MI+                
Sbjct: 64  VNSFKKAPGRENDQESLQD-----NNKHEKLKQTIRPRHVVMISLGTGIGTGLLVGTGKA 118

Query: 116 XYTAGPMSMFIAYAFVGVLVFFTMAALGEMASYIPL--DGFTSYASRYCDPALGFAVGYA 173
            Y  GP  + + +  +G  V+  + A GEMA   P    GF +Y S   DP  GFA  + 
Sbjct: 119 LYNGGPGGLAVGFFVMGTCVYCVIQAAGEMAVNYPALSGGFNAYPSFLVDPGFGFATAWL 178

Query: 174 YLCKYLILPPNQLTAAALVIQYWLDREQVNPGVWITIFLVIIVAMNFIGVKFFGEFEFWL 233
           Y  ++L + P +L  A++ I+YW     +NP +++ +F ++I+ +NF G + + E EF+ 
Sbjct: 179 YCIQWLCVFPLELVTASITIKYW--TTAINPDIFVAVFYLLIIVINFFGARGYAEAEFFF 236

Query: 234 STFKVIVMIGLIILLFVIMLGGGPTHDRLGFRFYDHPGAFKPYSKSIDGSKGKXXXXXXX 293
           +T KV+++IG  I+  ++  G       +G +++  PG+F  ++ +ID  KG        
Sbjct: 237 NTCKVLMIIGFFIVGILVNTGAAGNDGYIGAKYWREPGSFGGHT-AIDHFKGVVSTLVNA 295

Query: 294 XXXXXXXXXGIELTGIVAAEAANPRKSIPKAIKLTMYRIIVFYLVTIFLLGMCVAYDDPL 353
                      E   + AAE ANPRKS+P A K  +Y++ V +L ++ L+G  V  +   
Sbjct: 296 AFSLGCS----EFVALTAAEQANPRKSVPSAAKKMLYKVFVVFLGSVTLIGFLVPKNSSE 351

Query: 354 LXXXXXXXXXXXXXPYVVAIINSGIKALPHIFNACVLMFVFSACNSDLYVASRTLYGLAI 413
           L             PYV+A+ + G++ +PH  NA +L+ V S  NS  Y +SR L  LA 
Sbjct: 352 LMGSTDSSVHVS--PYVIAVASHGVRVVPHFINAVILLSVLSVGNSAFYSSSRLLLSLAE 409

Query: 414 DNKAPKIFAVTNRWGVPYYSLLMSSCFCLLAYMSVSSGSAKIFNYFVNVVSIFGLLSWIS 473
              AP +F   +R G P  ++++S     L +++ S     +F + + +  +  L +W S
Sbjct: 410 QGYAPPVFKYIDRQGRPLMAMMVSITMGCLCFVAASPKEETVFIWLLAISGLSQLFTWTS 469

Query: 474 ILITYLCFFRAVKAQNVDRSRFAYRAPFQPYGSYFTLAFCILIAFIKNFTVFL----NHH 529
           I I+++ F +A+  Q        ++A    +GSY++ A  +++ FI  F   L    +  
Sbjct: 470 ICISHIRFRKALLVQGRGWDGLGFKAQTGVWGSYYS-AVIMILTFIAQFWTCLIPMGSSK 528

Query: 530 FDYKNFITGYIGIPVFVISYFGYKFVKKT-KIWKP-EEVDLYTFKAAIDEEEEQGKIADA 587
            + ++F  GY+  P+FV  YFGYK   K  +++ P E++DL   +   D +    K  DA
Sbjct: 529 PNAESFFEGYLAFPIFVALYFGYKIYNKNWQLFIPAEKIDLDLHRKIFDADVL--KQEDA 586

Query: 588 ERRERLKNS 596
           E R +L++S
Sbjct: 587 EYRAKLRDS 595

>CAGL0E01089g Chr5 complement(96819..99380) [2562 bp, 853 aa] {ON}
           similar to uniprot|Q03770 Saccharomyces cerevisiae
           YDR160w SSY1
          Length = 853

 Score =  243 bits (620), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 164/592 (27%), Positives = 277/592 (46%), Gaps = 66/592 (11%)

Query: 70  EKQDDYMDDGKDEHTRLRKDLKARHISMIAXXXXXXXXXXXXXXXXXYTAGPMSMFIAYA 129
           EK + Y+ D      +L+++LK RHI M+A                   AGP    + + 
Sbjct: 259 EKINKYLHDSTRRRNQLQRNLKVRHIQMLAISACLSAGIFMTSGKAFSIAGPFGCLLGFI 318

Query: 130 FVGVLVFFTMAALGEMASYIPLD-GFTSYASRYCDPALGFAVGYAYLCKYLILPPNQLTA 188
             G +V  TM +  E+A+ IP+  GF+  ASR+ + A GFA+G+ Y    ++  P Q+ +
Sbjct: 319 ITGTVVIATMMSFAELATLIPVSSGFSGLASRFVEDAFGFALGWTYWFSSMVALPAQVVS 378

Query: 189 AALVIQYWLDREQVNPGV--WITIFLVIIVAMNFIGVKFFGEFEFWLSTFKVIVMIGLII 246
           +     ++   +    G   ++T+F +  + +N   V+F GEF + +   KV++ I ++I
Sbjct: 379 STFYFSHYDHLKLTRGGTAGFVTLFSLFPLVLNLFDVRFLGEFVYIVGLSKVLITIMIVI 438

Query: 247 LLFVIMLGGG-PTHDRLGFRFYDHP----------GAFKPY----------SKSIDGSKG 285
           ++ V+  G G   H R+ FR++D            G F+P              I G++G
Sbjct: 439 VMLVLNAGHGFDVHGRVSFRYWDAEKSRNLKDITYGLFRPTFDLSDAGLGSINGIGGNRG 498

Query: 286 KXXXXXXXXXXXXXXXXGIELTGIVAAEAANPRKSIPKAIKLTMYRIIVFYLVTIFLLGM 345
           +                G+E+T + + EA NPRK+IP A+K T   I   Y   IF + +
Sbjct: 499 RFIAVVSVMLVSTFAFSGVEMTFVASGEAKNPRKTIPSAMKRTFIFIFTIYFFLIFSVSI 558

Query: 346 CVAYDDPLLXXXXXXXXXXX----------------------------------XXPYVV 371
            +   DP L                                               P+V+
Sbjct: 559 NIYTGDPRLLSYYTGALESRYHNIENKVSNEWQVSYRCEEVLHGVNPGDVQAGFSSPWVL 618

Query: 372 AIINSGIKALPHIFNACVLMFVFSACNSDLYVASRTLYGLAIDNKAPKIFAVTNRWGVPY 431
           A+ N G  +    FNA ++ F  SA  S LY +SRTLY ++I  KAP +F + +R GVPY
Sbjct: 619 ALENFGFCSFAAGFNAVLIFFTSSATASSLYASSRTLYAMSIQRKAPAVFRLCDRRGVPY 678

Query: 432 YSLLMSSCFCLLAYMSVSSGSAKIFNYFVNVVSIFGLLSWISILITYLCFFRAVKAQNVD 491
            ++  SS F ++AY++V   +   F+  +N+ S    + W+ + + +L F+ A+K +   
Sbjct: 679 VAIGFSSLFAIVAYLAVDDAAISNFDVLMNISSAATSIIWLGLNVAFLRFYYALKKRRDI 738

Query: 492 RSR----FAYRAPFQPYGSYFTLAFCILIAFIKNFTVFLNHHFDYKNFITGYIGIPVFVI 547
            SR    + YR+PFQPY S F L  C +      F  F++ +++ K+F + Y G+ +F +
Sbjct: 739 ISRDDVFYPYRSPFQPYLSMFGLLGCSIFVLFMGFINFIHGYWNTKSFFSSYGGLILFGV 798

Query: 548 SYFGYKFVKKTKIWKPEEVDLYTFKAAIDE----EEEQGKIADAERRERLKN 595
            Y GYK +  +KI + +++DL T +  ID     E  Q +   +ER ++L N
Sbjct: 799 CYLGYKLISTSKIQRLDQLDLDTGRREIDRILWTEHRQYRGPYSERLKKLYN 850

>NCAS0D01870 Chr4 complement(343416..345203) [1788 bp, 595 aa] {ON}
           Anc_5.158
          Length = 595

 Score =  238 bits (606), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 156/515 (30%), Positives = 253/515 (49%), Gaps = 14/515 (2%)

Query: 80  KDEHTRLRKDLKARHISMIAXXXXXXXXXXXXXXXXXYTAGPMSMFIAYAFVGVLVFFTM 139
           +D +  L KDL  RH+  +A                  + GP S+ I +  +   +F  +
Sbjct: 72  EDINKSLNKDLSIRHLLTLAVGGAIGVGLFVNSGAALASGGPASLVIDWVIISTCLFTVI 131

Query: 140 AALGEMASYIPL-DGFTSYASRYCDPALGFAVGYAYLCKYLILPPNQLTAAALVIQYWLD 198
            +LGE+A+  P+  GF  Y +R+ DP+  FAV   YL ++L+L P +L AA++ I+YW  
Sbjct: 132 NSLGELAAAFPVVGGFNVYITRFVDPSFAFAVNLNYLAQWLVLLPLELVAASITIKYW-- 189

Query: 199 REQVNPGVWITIFLVIIVAMNFIGVKFFGEFEFWLSTFKVIVMIGLIILLFVIMLGGGPT 258
              +N   W+ IF  +I   N + VK FGE EF LS  K++ +IG  IL  V+  GGGP 
Sbjct: 190 NSTINSDAWVAIFYTVITLANMLDVKSFGETEFVLSMVKILAIIGFTILGIVLSCGGGPK 249

Query: 259 HDRLGFRFYDHPGAFKPYSKSIDGSKGKXXXXXXXXXXXXXXXXGIELTGIVAAEAANPR 318
              LG +++ +PGAF  ++     S  K                GIE+T + AAE+ +PR
Sbjct: 250 GGYLGGKYWHNPGAFVGHT-----SGTKFKGLCSVFVTAAFSYSGIEMTAVSAAESKDPR 304

Query: 319 KSIPKAIKLTMYRIIVFYLVTIFLLGMCVAYDDPLLXXXXXXXXXXXXXPYVVAIINSGI 378
           K+IPKA K T + I   Y+  + L+G  V YDDP L             P V+AI N GI
Sbjct: 305 KTIPKAAKRTFWLITASYVTILTLVGCLVPYDDPRLMSGTSSVDAAAS-PLVIAIENGGI 363

Query: 379 KALPHIFNACVLMFVFSACNSDLYVASRTLYGLAIDNKAPKIFAVTNRWGVPYYSLLMSS 438
           K L  + NA +L+ + S  NS +Y  SR +  +A     PK     ++ G P  + L++ 
Sbjct: 364 KGLDSLMNAIILISIISVANSAVYACSRCMVSMAHIGNLPKKLGKVDKRGRPINATLVTL 423

Query: 439 CFCLLAYMSVSSGSAKIFNYFVNVVSIFGLLSWISILITYLCFFRAVKAQNVDRSRFAYR 498
            F LL++++ S    ++F +   +  +  +  W++I I+++ F +A+  QN       Y 
Sbjct: 424 FFGLLSFIAASDKQNEVFTWLSALSGLSTIFCWMAINISHIRFRQAMIKQNRSLDEMPYL 483

Query: 499 APFQPYGSYFTLAFCILIAFIKNFTVFL---NHHFDYKNFITGYIGIPVFVISYFGYKFV 555
           +    +GS + +    L+     +T          D ++F  GY+ +P+ ++ Y G+K  
Sbjct: 484 SQTGVWGSLYGVVVLFLVLVASFWTSLFPLGGDSADVQSFFEGYLSLPILIVCYIGHKLY 543

Query: 556 KKTKIW--KPEEVDLYTFKAAIDEEEEQGKIADAE 588
            K   W    EE+DL T + A+D    + ++   E
Sbjct: 544 FKNWSWVVTLEEMDLDTGRKALDPHLHRAEVIAEE 578

>SAKL0B08734g Chr2 complement(743379..745055) [1677 bp, 558 aa] {ON}
           similar to uniprot|P38090 Saccharomyces cerevisiae
           YBR132C AGP2 Plasma membrane carnitine transporter
           expression is down-regulated by osmotic stress also
           functions as a low-affinity amino acid permease
          Length = 558

 Score =  236 bits (603), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 154/517 (29%), Positives = 256/517 (49%), Gaps = 15/517 (2%)

Query: 77  DDGKDEHTRLRKDLKARHISMIAXXXXXXXXXXXXXXXXXYTAGPMSMFIAYAFVGVLVF 136
           D      T   + L+ RH+ +I                  Y  GP+ + + ++   + + 
Sbjct: 35  DRDSSIPTSTHRKLQNRHVQLIGISGVIGTALFVSIGRALYHGGPVFLLLGFSLWCIPIL 94

Query: 137 FTMAALGEMASYIPLDG-FTSYASRYCDPALGFAVGYAYLCKYLILPPNQLTAAALVIQY 195
               +  EM  Y+P    F   ASR  D +L     + +     +  P ++ A   +I Y
Sbjct: 95  CITVSTAEMVCYMPFSSPFLRIASRCVDNSLAIMASWNFWFLECVQIPFEIVAVNTMIHY 154

Query: 196 WLDREQVNPGVWITIFLVIIVAMNFIGVKFFGEFEFWLSTFKVIVMIGLIILLFVIMLGG 255
           W  R+  +  + + + +V+ +A++   V+++GE EFWL++FK+ + IGL    F+ MLGG
Sbjct: 155 W--RDDYSAAIPLVVQVVLYLAISVFAVRYYGEMEFWLASFKIFLAIGLFFFTFITMLGG 212

Query: 256 GPTHDRLGFR-FYDHPGAFKPY----SKSIDGSKGKXXXXXXXXXXXXXXXXGIELTGIV 310
            P HDR GFR F D P  FK Y     K++  S G                 G +   ++
Sbjct: 213 NPKHDRYGFRNFKDLP--FKEYFPNNDKTVGSSAGYFQGFLACLIQASFTIAGPDYVSMI 270

Query: 311 AAEAANPRKSIPKAIKLTMYRIIVFYLVTIFLLGMCVAYDDP-LLXXXXXXXXXXXXXPY 369
           A E   PRK +P A K    R+ V +L     +G+  + +DP L              PY
Sbjct: 271 AGETLLPRKVLPIAFKQVFVRLTVLFLGGCLCIGIVCSANDPNLTAAITEDRPGAGASPY 330

Query: 370 VVAIINSGIKALPHIFNACVLMFVFSACNSDLYVASRTLYGLAIDNKAPKIFAVTNRWGV 429
           V+A+ N GIK LP I NA ++   FSA N+  Y +SRTLYG+A+D  APK+F+  NR GV
Sbjct: 331 VIAMNNLGIKVLPDIVNAALITAAFSAGNAYTYCSSRTLYGMALDGYAPKVFSRCNRHGV 390

Query: 430 PYYSLLMSSCFCLLAYMSVSSGSAKIFNYFVNVVSIFGLLSWISILITYLCFFRAVKAQN 489
           P +++ +S  + LL+ + +   SA + N+ VN+++   L+++  + + YL F RA  AQ 
Sbjct: 391 PIFAVAVSLLWALLSLLQLGKNSAVVLNWLVNLITASQLINFGVLCVVYLFFRRAYMAQR 450

Query: 490 VDRSRFAYRAPFQPYGSYFTLAFCILIAFIKNFTVFLNHHFDYKNFITGYIGIPVFVISY 549
            +     +++ +QPY +   L    ++  ++ +TVF    ++Y++F+  Y+ I V +  Y
Sbjct: 451 DNLPELPFKSWWQPYPAIIGLVSVSVMTIVQGYTVFFKTLWNYESFLFSYLMIFVDIFIY 510

Query: 550 FGYKFV---KKTKIWKPEEVDLYTFKAAID-EEEEQG 582
            G+KFV    K  + +P++VDL T    I+  E E G
Sbjct: 511 LGHKFVINYGKDPVKRPQDVDLITGLYEIEIHELENG 547

>NDAI0C02950 Chr3 (676753..678582) [1830 bp, 609 aa] {ON} Anc_5.158
          Length = 609

 Score =  238 bits (606), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 155/511 (30%), Positives = 259/511 (50%), Gaps = 14/511 (2%)

Query: 80  KDEHTRLRKDLKARHISMIAXXXXXXXXXXXXXXXXXYTAGPMSMFIAYAFVGVLVFFTM 139
           +D +  L KDL  RH+  +A                  + GP S+ I +  +   +F  +
Sbjct: 86  EDINENLNKDLSIRHLITLAVGGSIGVGLFVNSGAALASGGPASLVIDWVIISTCLFTVI 145

Query: 140 AALGEMASYIPL-DGFTSYASRYCDPALGFAVGYAYLCKYLILPPNQLTAAALVIQYWLD 198
            ALGE+A+  P+  GF  Y +R+ DP++ FA+   YL ++L+L P +L AA++ I+YW D
Sbjct: 146 NALGELAAAYPVVGGFNVYITRFVDPSVAFAINLNYLAQWLVLLPLELVAASITIKYWND 205

Query: 199 REQVNPGVWITIFLVIIVAMNFIGVKFFGEFEFWLSTFKVIVMIGLIILLFVIMLGGGPT 258
              +N   W+ IF  +I   N + VK FGE EF LS  K++ +IG  IL  V+  GGGP 
Sbjct: 206 --TINSDAWVAIFYSVIALANMLDVKSFGETEFVLSMVKILAIIGFTILGIVLACGGGPQ 263

Query: 259 HDRLGFRFYDHPGAFKPYSKSIDGSKGKXXXXXXXXXXXXXXXXGIELTGIVAAEAANPR 318
              LG  ++  PG+F       D    +                GIELT + AAE+ +PR
Sbjct: 264 GGFLGGHYWHDPGSFVG-----DKPGTQFKGLCSVFVTAAFSYSGIELTAVSAAESKDPR 318

Query: 319 KSIPKAIKLTMYRIIVFYLVTIFLLGMCVAYDDPLLXXXXXXXXXXXXXPYVVAIINSGI 378
           K+IPKA K T + +   Y+  + ++G  V +DDP L             P V++I N+GI
Sbjct: 319 KTIPKATKRTFWLVTASYVTILTIIGCLVPFDDPRLLNGSSSVDAAAS-PLVISIKNAGI 377

Query: 379 KALPHIFNACVLMFVFSACNSDLYVASRTLYGLAIDNKAPKIFAVTNRWGVPYYSLLMSS 438
           K L  + NA +L+ + S  NS +Y  SR +  +A     PK+ +  ++ G P  ++L + 
Sbjct: 378 KGLDSLMNAIILISIVSVANSAVYACSRCMVSMAHIGNLPKVLSRVDKRGRPVNAILSTL 437

Query: 439 CFCLLAYMSVSSGSAKIFNYFVNVVSIFGLLSWISILITYLCFFRAVKAQNVDRSRFAYR 498
            F LL++++ S   A++F +   +  +  +  W++I  +++ F  A+K QN       Y 
Sbjct: 438 FFGLLSFIAASDKQAEVFTWLSALSGLSTIFCWMAINYSHIRFRAAMKVQNKTLDELPYL 497

Query: 499 APFQPYGSYF--TLAFCILIA-FIKNFTVFLNHHFDYKNFITGYIGIPVFVISYFGYK-F 554
           +     GS++   + F +L+A F  +     +   D  +F  GY+ +P+ +  Y G+K +
Sbjct: 498 SQCGVIGSWYGVIVLFLVLVASFWTSLFPLGSGTADVTSFFEGYLSLPILIACYVGHKLY 557

Query: 555 VKKTKIW-KPEEVDLYTFKAAIDEEEEQGKI 584
           V+  ++  K E++DL T +  ID  E + +I
Sbjct: 558 VRNLQVLVKLEDMDLETGRKHIDAHEHRAEI 588

>Suva_7.485 Chr7 (836820..838631) [1812 bp, 603 aa] {ON} YGR191W
           (REAL)
          Length = 603

 Score =  238 bits (606), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 161/537 (29%), Positives = 265/537 (49%), Gaps = 22/537 (4%)

Query: 48  KDGLDINDMDNLSTVSSRLEDSEKQDDYMDDGKDEHTRLRKDLKARHISMIAXXXXXXXX 107
           K    +N   N  T S R       DD +      +T L K+L  RH+  +A        
Sbjct: 52  KGSSGVNQTTNDITSSGRFH----SDDDVQQEDINNTNLSKELSVRHLLTLAVGGAIGTG 107

Query: 108 XXXXXXXXXYTAGPMSMFIAYAFVGVLVFFTMAALGEMASYIPL-DGFTSYASRYCDPAL 166
                     T GP S+ I +  +   +F  + +LGE+++  P+  GF  Y+ R+ +P+ 
Sbjct: 108 LFVNTGAALSTGGPASLVIDWVIISTCLFTVINSLGELSAAFPVVGGFNVYSMRFVEPSF 167

Query: 167 GFAVGYAYLCKYLILPPNQLTAAALVIQYWLDREQVNPGVWITIFLVIIVAMNFIGVKFF 226
            FAV   YL ++L+L P +L AA++ I+YW D+  +N   W+ IF   I   N + VK F
Sbjct: 168 AFAVNLNYLAQWLVLLPLELVAASITIKYWNDK--INSDAWVAIFYATIAMANMLDVKSF 225

Query: 227 GEFEFWLSTFKVIVMIGLIILLFVIMLGGGPTHDRLGFRFYDHPGAFKPYSKSIDGSKGK 286
           GE EF LS  K++ +IG  IL  V+  GGGP    +G ++++ PGAF  +      S  K
Sbjct: 226 GETEFVLSMIKILAIIGFTILGIVLSCGGGPHGGYIGGKYWNDPGAFVGHD-----SGTK 280

Query: 287 XXXXXXXXXXXXXXXXGIELTGIVAAEAANPRKSIPKAIKLTMYRIIVFYLVTIFLLGMC 346
                           GIE+T + AAE+ NPR++IPKA K T + I + Y+  + L+G  
Sbjct: 281 FKGLCSVFVTAAFSYSGIEMTAVSAAESKNPRETIPKAAKRTFWLITISYVTILTLIGCL 340

Query: 347 VAYDDPLLXXXXXXXXXXXXXPYVVAIINSGIKALPHIFNACVLMFVFSACNSDLYVASR 406
           V  +DP L             P V+AI N  IK LP + NA +L+ V S  NS +Y  SR
Sbjct: 341 VPSNDPRLLNGSSSVDAASS-PLVIAIENGRIKGLPSLMNAIILIAVVSVANSAVYACSR 399

Query: 407 TLYGLAIDNKAPKIFAVTNRWGVPYYSLLMSSCFCLLAYMSVSSGSAKIFNYFVNVVSIF 466
            +  +A     PK     ++ G P  +++++  F LL++++ S   A++F +   +  + 
Sbjct: 400 CMVAMAHIGNLPKFLRRVDKRGRPINAIVLTLFFGLLSFVAASDKQAEVFTWLSALSGLS 459

Query: 467 GLLSWISILITYLCFFRAVKAQNVDRSRFAYRAPFQPYGSY--FTLAFCILIA-FIKNFT 523
            +  W++I ++++ F +A+K Q        + +    +GS   F + F +LIA F  +  
Sbjct: 460 TIFCWMAINLSHIRFRQAMKFQERSLDELPFISQTGVWGSIYGFVVLFLVLIASFWTSMF 519

Query: 524 VFLNHHFDYKNFITGYIGIPVFVISYFGYKFVKKTKIW----KPEEVDLYTFKAAID 576
              +   + ++F  GY+  P+ ++ YFG+K    T+ W    K E++DL T +  +D
Sbjct: 520 PIGSSGANAESFFEGYLSFPILIVCYFGHKIY--TRDWRLLVKLEDMDLDTGRKQVD 574

>NCAS0A07110 Chr1 (1408106..1409884) [1779 bp, 592 aa] {ON}
           Anc_5.158
          Length = 592

 Score =  237 bits (605), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 153/501 (30%), Positives = 256/501 (51%), Gaps = 14/501 (2%)

Query: 82  EHTRLRKDLKARHISMIAXXXXXXXXXXXXXXXXXYTAGPMSMFIAYAFVGVLVFFTMAA 141
            +  L K+L  RH+  +A                  + GP S+ I +  +   +F  + A
Sbjct: 71  NNVNLNKNLSIRHLLTLAVGGSIGVGLFVNSGAALASGGPASLVIDWIIISTCLFTVINA 130

Query: 142 LGEMASYIPL-DGFTSYASRYCDPALGFAVGYAYLCKYLILPPNQLTAAALVIQYWLDRE 200
           LGEMA+  P+  GF  Y +R+ DP++GFAV   YL ++L+L P +L AA++ I+YW   E
Sbjct: 131 LGEMAAAFPVVGGFNVYITRFIDPSVGFAVNINYLAQWLVLLPLELVAASMTIKYW--NE 188

Query: 201 QVNPGVWITIFLVIIVAMNFIGVKFFGEFEFWLSTFKVIVMIGLIILLFVIMLGGGPTHD 260
            +N   W+ IF  +I   N + VK FGE EF LS  K++ +IG  IL  V+  GGGP   
Sbjct: 189 TINSDAWVAIFYCVIALANMLEVKSFGETEFVLSMIKILAIIGFTILGIVLACGGGPHGG 248

Query: 261 RLGFRFYDHPGAFKPYSKSIDGSKGKXXXXXXXXXXXXXXXXGIELTGIVAAEAANPRKS 320
            +G ++++HPG+F  ++     S  K                GIE+T + AAE+ +PR +
Sbjct: 249 FIGGKYWNHPGSFVGHN-----SGTKFKGLCSVFVTAAFSYSGIEMTAVSAAESKDPRTT 303

Query: 321 IPKAIKLTMYRIIVFYLVTIFLLGMCVAYDDPLLXXXXXXXXXXXXXPYVVAIINSGIKA 380
           IPKA K T + I   Y+  + L+G  V YDDP L             P V+AI N GIK 
Sbjct: 304 IPKAAKRTFWLITASYVTILTLIGCLVPYDDPRLLSGTSSVDAASS-PLVIAIENDGIKG 362

Query: 381 LPHIFNACVLMFVFSACNSDLYVASRTLYGLAIDNKAPKIFAVTNRWGVPYYSLLMSSCF 440
           LP + NA +L+ + S  NS +Y  SR +  +A     P+I    +  G P  +++ +  F
Sbjct: 363 LPSLMNAIILISIISVANSAVYACSRCMVAMAHIGNVPRILNRVDTKGRPMNAIIFTLFF 422

Query: 441 CLLAYMSVSSGSAKIFNYFVNVVSIFGLLSWISILITYLCFFRAVKAQNVDRSRFAYRAP 500
            LL++++ S   A +F +   +  +  +  W++I ++++ F +++  QN       + + 
Sbjct: 423 GLLSFVAASDRQADVFTWLSALSGLSTIFCWMAINLSHIRFRQSMAKQNRSLDELPFLSQ 482

Query: 501 FQPYGSYF--TLAFCILIA-FIKNFTVFLNHHFDYKNFITGYIGIPVFVISYFGYK-FVK 556
              +GS++   + F +L+A F  +         D ++F  GY+  P+ +  YFG+K +V+
Sbjct: 483 TGVWGSWYGTIVLFLVLVASFWTSLFPLGGTSADAESFFEGYLSFPILLACYFGHKLYVR 542

Query: 557 KTK-IWKPEEVDLYTFKAAID 576
           K + +    ++DL T +  +D
Sbjct: 543 KREFMVGLADMDLDTGRRQVD 563

>TPHA0M01200 Chr13 complement(244556..246379) [1824 bp, 607 aa] {ON}
           Anc_3.284 YDR046C
          Length = 607

 Score =  238 bits (606), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 164/557 (29%), Positives = 267/557 (47%), Gaps = 29/557 (5%)

Query: 49  DGLDINDMDNLSTVSSRLEDSEKQDDYMDDGKDEHTRLRKDLKARHISMIAXXXXXXXXX 108
           D     +  NL+  S+ LED               + ++K LKARH+ M++         
Sbjct: 60  DSFKRAEHGNLNEKSADLEDGTAS-------IQSKSYMKKSLKARHVIMMSLGTGIGTGL 112

Query: 109 XXXXXXXXYTAGPMSMFIAYAFVGVLVFFTMAALGEMA-SYIPLDG-FTSYASRYCDPAL 166
                      GP S+ I Y  V  +V+F + A GEMA +Y  L G F +Y S +   + 
Sbjct: 113 LVANAKSLAYGGPASLIIGYVIVSFIVYFMIQAAGEMAVTYPTLPGNFNTYQSIFISKSW 172

Query: 167 GFAVGYAYLCKYLILPPNQLTAAALVIQYWLDREQVNPGVWITIFLVIIVAMNFIGVKFF 226
           GFA  + +  +++ + P +L  ++L IQYW D   +N  +++ IF V ++ ++FIGVK +
Sbjct: 173 GFATVWLFCIQWITVLPLELITSSLTIQYWTD---LNGDIFVVIFYVFLLLIHFIGVKAY 229

Query: 227 GEFEFWLSTFKVIVMIGLIILLFVIMLGGGPTHDRLGFRFYDHPGAFKPYSKSIDGSKGK 286
           GE EF  +  K++++ G II   V+  GG      +G +++  PG+F        G   +
Sbjct: 230 GETEFIFNLCKILMISGFIIFSIVVNCGGAGNDGYIGGKYWHTPGSFAE-----GGPTSR 284

Query: 287 XXXXXXXXXXXXXXXXGIELTGIVAAEAANPRKSIPKAIKLTMYRIIVFYLVTIFLLGMC 346
                           G EL  +   E A PRK+ P A K ++YRI+V YL+T+ L+G  
Sbjct: 285 FKGICYVLVAGYFSYGGTELYVLSVNEQAEPRKATPAAAKKSIYRILVIYLLTMILIGFN 344

Query: 347 VAYDDPLLXXXXXXXXXXXXXPYVVAIINSGIKALPHIFNACVLMFVFSACNSDLYVASR 406
           V ++   L             PYV+A    G+K +PHI NA +L+ V S  NS LY + R
Sbjct: 345 VPHNSDQLMGAGGSSTHAS--PYVLAASIHGVKVVPHIINAVILISVVSVANSSLYASPR 402

Query: 407 TLYGLAIDNKAPKIFAVTNRWGVPYYSLLMSSCFCLLAYMSVSSGSAKIFNYFVNVVSIF 466
            L  LA    APK     +R G P  +LL+ + F  +A+++ S    ++F +   +  + 
Sbjct: 403 LLASLAEQGYAPKALTYIDREGRPLVALLLCAVFGCIAFVASSDKEEQVFTWLAAIAGLS 462

Query: 467 GLLSWISILITYLCFFRAVKAQNVDRSRFAYRAPFQPYGSYFTLAFCILIAFIKNFTVFL 526
            + +W  I+ +++ F  A+K QN D     Y+A    YGS+F   F +L+  I  F V L
Sbjct: 463 EVFTWTGIMFSHVRFRLAMKVQNKDIDEVGYKATAGIYGSWFGSIFGVLV-LIAQFWVAL 521

Query: 527 N-----HHFDYKNFITGYIGIPVFVISYFGYKFVKK--TKIWKPEEVDLYTFKAAIDEEE 579
           +          ++F   Y+ +P++V  Y  Y    K  T +    ++DL   +   D + 
Sbjct: 522 SPPGSGGAVSAESFFENYLAMPIWVFFYIVYSVYNKEWTILTDLSKIDLDAHRRIYDPDL 581

Query: 580 EQGKIADAERRERLKNS 596
            + +  DAE +E+LKNS
Sbjct: 582 IRQE--DAENKEKLKNS 596

>KNAG0H01150 Chr8 (193585..195438) [1854 bp, 617 aa] {ON} 
          Length = 617

 Score =  238 bits (607), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 162/552 (29%), Positives = 268/552 (48%), Gaps = 31/552 (5%)

Query: 65  RLEDSEKQDDYMDDGKDEH------------TRLRKDLKARHISMIAXXXXXXXXXXXXX 112
           R  DS K+ D    G D++            + L+K +K+RH+ M+              
Sbjct: 68  RFMDSFKRADGQRAGFDDNDLESGTRSFISESHLKKSMKSRHVVMMTLGTGIGTGLLVAN 127

Query: 113 XXXXYTAGPMSMFIAYAFVGVLVFFTMAALGEMA-SYIPLDG-FTSYASRYCDPALGFAV 170
               + +GP  + +AY  V  + +F + A GEMA +Y  L G F SY S +     GFA 
Sbjct: 128 ASGLHASGPAPLVLAYGLVSFVTYFMIQAAGEMAVTYPTLPGNFNSYMSLFVSKPFGFAT 187

Query: 171 GYAYLCKYLILPPNQLTAAALVIQYWLDREQVNPGVWITIFLVIIVAMNFIGVKFFGEFE 230
            + +L ++L + P +L  ++L I+YW D+  +N  V++ IF V ++ ++F GV+ +GE E
Sbjct: 188 VWLFLLQWLTVLPLELITSSLTIKYWNDK--INSDVFVVIFYVFLLFIHFFGVQAYGETE 245

Query: 231 FWLSTFKVIVMIGLIILLFVIMLGGGPTHDRLGFRFYDHPGAFKPYSKSIDGSKGKXXXX 290
           F  ++ K++++ G II   V+  GG      +G +++  PGAF  ++     + G+    
Sbjct: 246 FIFNSCKILMIAGFIIFSIVVNCGGAGHDGYIGGKYWHDPGAFTSHT-----NIGRFKGI 300

Query: 291 XXXXXXXXXXXXGIELTGIVAAEAANPRKSIPKAIKLTMYRIIVFYLVTIFLLGMCVAYD 350
                       G EL  +   E  NPRKS P+A K ++YRI+V YL+T+ L+G  V +D
Sbjct: 301 CFILVTAYFSYGGTELYVLSVNEQENPRKSTPQAAKQSIYRIVVIYLLTMILIGFNVPHD 360

Query: 351 DPLLXXXXXXXXXXXXXPYVVAIINSGIKALPHIFNACVLMFVFSACNSDLYVASRTLYG 410
           +  L             PYV+A    G++ +PH  NA +L+ V S  NS LY + R L  
Sbjct: 361 NDQLMGSHGSATHAS--PYVLAASIHGVRIVPHFINAVILISVISVANSSLYASPRLLCS 418

Query: 411 LAIDNKAPKIFAVTNRWGVPYYSLLMSSCFCLLAYMSVSSGSAKIFNYFVNVVSIFGLLS 470
           LA    APK     +R G P  +L   S F ++ + + S+   ++F +   +  +  L +
Sbjct: 419 LAQQGYAPKFLTYIDRQGRPLTALATCSLFGVIGFAAASNQEEQVFTWLAAIAGLSELFT 478

Query: 471 WISILITYLCFFRAVKAQNVDRSRFAYRAPFQPYGSYFTLAFCILIAFIKNFTVFL---N 527
           W  I+++++ F +A+K Q  D +   Y+A    +GS + + F IL+ F   F V L    
Sbjct: 479 WSGIMLSHVRFRQAMKVQGRDLNELGYKAVSGVWGSVYGVFFNILV-FFAQFWVALAPPG 537

Query: 528 HHFDYKNFITGYIGIPVFVISYFGYKFVKK--TKIWKPEEVDLYTFKAAIDEEEEQGKIA 585
                 +F   Y+  P+F   YFGY    K  T +   E +DL   +   D E  + +  
Sbjct: 538 SKPTALSFFESYLAFPIFFTFYFGYMLWNKDFTFLIPLESIDLDFHRRVYDPEFIRQE-- 595

Query: 586 DAERRERLKNSK 597
             E++ +LKNS 
Sbjct: 596 REEKKIKLKNSS 607

>NDAI0A00640 Chr1 complement(118100..120025) [1926 bp, 641 aa] {ON}
           Anc_1.50
          Length = 641

 Score =  238 bits (607), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 163/565 (28%), Positives = 279/565 (49%), Gaps = 32/565 (5%)

Query: 55  DMDNLSTVSSRLEDSEKQDDYMD-DGKDEHTRLRKDLKARHISMIAXXXXXXXXXXXXXX 113
           + D   T    LE SE      +  GK E   L+  +K RH+ MI+              
Sbjct: 93  EHDLTKTFEGTLEPSEDGTQPAEVAGKSEE--LKHSIKPRHVIMISLGTGIGTGMLVGNG 150

Query: 114 XXXYTAGPMSMFIAYAFVGVLVFFTMAALGEMASYIP--LDGFTSYASRYCDPALGFAVG 171
                +GP  + I YA +G  ++  + A GEMA      + GF SY S   +PALGF+V 
Sbjct: 151 TSLANSGPAGLVIGYAIMGSCIYCIIQATGEMAVLYSKLIGGFNSYPSFLIEPALGFSVA 210

Query: 172 YAYLCKYLILPPNQLTAAALVIQYWLDREQVNPGVWITIFLVIIVAMNFIG-VKFFGEFE 230
           + Y  ++L + P +L  A++ I+YW  +  V+P V++ IF V+I+ +N +G    + E E
Sbjct: 211 WVYCIQWLCVCPLELVTASMTIKYWTTK--VDPDVFVVIFYVLIILINVLGGAAGYAEAE 268

Query: 231 FWLSTFKVIVMIGLIILLFVIMLGGGPTHDRLGFRFYDHPGAFKPYSKSIDGSKGKXXXX 290
           F+ ++ K+++++G  IL  +++ GG      +G R++  PGAF+    +ID  KG     
Sbjct: 269 FFFNSCKILMLLGFFILGIILICGGAGDDGYIGGRYWHDPGAFRG-EHAIDRFKGVVSTL 327

Query: 291 XXXXXXXXXXXXGIELTGIVAAEAANPRKSIPKAIKLTMYRIIVFYLVTIFLLGMCVAYD 350
                         E+ G+ A+E +NPRK+IP A K  +YRI+  YL ++ ++G  V ++
Sbjct: 328 VNAAFAFGLS----EMIGVTASEQSNPRKAIPSAAKKMIYRIVCIYLGSVVIVGFLVPWN 383

Query: 351 -DPLLXXXXXXXXXXXXXPYVVAIINSGIKALPHIFNACVLMFVFSACNSDLYVASRTLY 409
            D LL             PYV+A+   G++ +PH  NA +L+ V S  NS  Y +SR L 
Sbjct: 384 SDQLLGSSGGGVKAS---PYVLAVSTHGVRVVPHFINAVILLSVLSVANSAFYSSSRLLL 440

Query: 410 GLAIDNKAPKIFAVTNRWGVPYYSLLMSSCFCLLAYMSVSSGSAKIFNYFVNVVSIFGLL 469
           GLA    APKIF   +R G P   + +++   ++++ + S    ++F + + +  +  L 
Sbjct: 441 GLAEQGYAPKIFKYVDREGRPTMGMCVAALVNVISFCATSPKEDQVFVWLLAISGLSQLF 500

Query: 470 SWISILITYLCFFRAVKAQNVDRSRFAYRAPFQPYGSYFTLAFCILIAFIKNFTVFL--- 526
           +W +I ++++ F RA+  Q        +++    +GS++     +LI  I  F V +   
Sbjct: 501 TWSAICLSHIRFRRAMAVQGRSLGEIGFKSQCGVWGSWYAFIMMMLI-LIAQFWVAIAPI 559

Query: 527 -NHHFDYKNFITGYIGIPVFVISYFGYKFVKKTKIW----KPEEVDLYTFKAAIDEEEEQ 581
                D + F   Y+  P+ +  YFGYK    TK W    + +++DL   +   DEE   
Sbjct: 560 GEGRLDVQAFFENYLAAPILIALYFGYKIY--TKDWRLFIRAKDIDLDINRDVFDEELI- 616

Query: 582 GKIADAERRERLKNSKTKGWDWFYE 606
            +  + E +E+++N+    W   YE
Sbjct: 617 -RQEEEEYKEKMRNAPI--WQKIYE 638

>NDAI0F04390 Chr6 (1073373..1075376) [2004 bp, 667 aa] {ON} Anc_1.50
          Length = 667

 Score =  238 bits (607), Expect = 4e-69,   Method: Compositional matrix adjust.
 Identities = 167/527 (31%), Positives = 271/527 (51%), Gaps = 25/527 (4%)

Query: 80  KDEHTRLRKDLKARHISMIAXXXXXXXXXXXXXXXXXYTAGPMSMFIAYAFVGVLVFFTM 139
           +++   L+K +K RH+ MI+                   AGP  + + +  +G  ++  +
Sbjct: 143 ENKSDELKKTIKPRHVLMISLGTGIGTGLLVGLGSSLVAAGPAGLLLGFGIMGTCLYCII 202

Query: 140 AALGEMA-SYIPL-DGFTSYASRYCDPALGFAVGYAYLCKYLILPPNQLTAAALVIQYWL 197
            A+GEMA +Y  L  GF +Y S   DPA GF+V + Y  ++L + P +L  A++ I+YW 
Sbjct: 203 QAVGEMAVAYSDLVGGFNAYPSFLVDPAFGFSVAWVYALQWLCVCPLELVTASMTIKYWT 262

Query: 198 DREQVNPGVWITIFLVIIVAMNFIG-VKFFGEFEFWLSTFKVIVMIGLIILLFVIMLGGG 256
            +  V+P V++ IF V+I+A+N +G    + E EF  ++ K+++MIG  IL  +I+ GG 
Sbjct: 263 TK--VDPDVFVIIFYVLILAINIVGGAAGYAEAEFIFNSCKILMMIGFFILGIIIICGGA 320

Query: 257 PTHDRLGFRFYDHPGAFKPYSKSIDGSKGKXXXXXXXXXXXXXXXXGIELTGIVAAEAAN 316
                +G +++  PGAF+    +ID  KG                   E  G+ A+E +N
Sbjct: 321 GNDGYIGGKYWHEPGAFRG-EHAIDRFKGVMATLVNAAFAFGMS----EFIGVTASEQSN 375

Query: 317 PRKSIPKAIKLTMYRIIVFYLVTIFLLGMCVAYD-DPLLXXXXXXXXXXXXXPYVVAIIN 375
           PRK+IP A K  +YRI+  +L +I ++G  V YD D LL             PYV+A+  
Sbjct: 376 PRKAIPSAAKKMLYRIVCMFLASITIVGFLVPYDSDQLLGSSGGGVKAS---PYVLAVST 432

Query: 376 SGIKALPHIFNACVLMFVFSACNSDLYVASRTLYGLAIDNKAPKIFAVTNRWGVPYYSLL 435
            G+K +PH  NA +L+ V S  NS  Y +SR L  LA    APKIF   +R G P   + 
Sbjct: 433 HGVKVVPHFINAVILISVLSVANSAFYSSSRMLLSLAEQGYAPKIFCYIDREGRPLVGMA 492

Query: 436 MSSCFCLLAYMSVSSGSAKIFNYFVNVVSIFGLLSWISILITYLCFFRAVKAQNVDRSRF 495
           M+S F ++A+ + S    ++F + + +  +  L +WI+I ++++ F RA+  Q       
Sbjct: 493 MASLFGVIAFCATSPKEDEVFVWLLAISGLSQLFTWIAICVSHVRFRRAMHVQGKSIGEL 552

Query: 496 AYRAPFQPYGSYFT--LAFCILIA-FIKNFTVFLNHHFDYKNFITGYIGIPVFVISYFGY 552
            +R+    +GS +   +  CILIA F            D KNF   Y+ +P+ +  YFGY
Sbjct: 553 GFRSQVGAWGSSYAAIMMVCILIAQFWVAIAPIGEGKLDAKNFFENYLAMPILLALYFGY 612

Query: 553 KFVKKTKIW----KPEEVDLYTFKAAIDEEEEQGKIADAERRERLKN 595
           K    TK W    + +++DL + +   DEE  +    + E RE+L+N
Sbjct: 613 KIY--TKNWTIFIRAKDIDLVSHRNIFDEEIIK--QEEEEYREKLRN 655

>Kpol_1052.14 s1052 (39793..41601) [1809 bp, 602 aa] {ON}
           (39793..41601) [1809 nt, 603 aa]
          Length = 602

 Score =  236 bits (603), Expect = 4e-69,   Method: Compositional matrix adjust.
 Identities = 165/546 (30%), Positives = 275/546 (50%), Gaps = 27/546 (4%)

Query: 47  KKDGLDINDMDNLSTVSSRLEDSEKQDDY--MDDGKDEHTRLRKDLKARHISMIAXXXXX 104
           K +G+   D    S +++  E    +DD   +++ +    +L + +K+RH+ MI+     
Sbjct: 51  KYEGIKNGDTQVTSGITNSFESESLRDDSKPLENEEKTENQLNRSIKSRHLLMISLGTGI 110

Query: 105 XXXXXXXXXXXXYTAGPMSMFIAYAFVGVLVFFTMAALGEMA-SYIPLDG-FTSYASRYC 162
                         +GP  + I Y    ++V+F + A GE+   Y  L G +  Y S   
Sbjct: 111 GTGLLVGNGQVLAKSGPAGLVIGYGVASIMVYFIVQAAGELGICYSGLTGNYIRYPSILV 170

Query: 163 DPALGFAVGYAYLCKYLILPPNQLTAAALVIQYWLDREQVNPGVWITIFLVIIVAMNFIG 222
           DPALGFA+   Y  ++L + P QL  AA+ I YW +   +NP +++ I LVI+V  N  G
Sbjct: 171 DPALGFAISIIYTLQWLTVMPLQLVTAAMTIGYWTN---INPNIFVAIVLVIVVLTNCFG 227

Query: 223 VKFFGEFEFWLSTFKVIVMIGLIILLFVIMLGGGPTHDRLGFRFYDHPGAFKPYSKSIDG 282
            K + E EF  + FKV++M+G ++L  +I  G   T   +G  ++ +PGAF       +G
Sbjct: 228 AKGYVEAEFLCNIFKVLMMVGFVLLAILINTGAIGTDGYIGTIYWKNPGAFA------NG 281

Query: 283 SKGKXXXXXXXXXXXXXXXXGIELTGIVAAEAANPRKSIPKAIKLTMYRIIVFYLVTIFL 342
            KG                 GIE+  + AAE  NP K+IP A K T+YRI+  Y++T  L
Sbjct: 282 FKG----VCSVFCYAAFSYGGIEVLALTAAEQENPIKAIPSACKKTVYRILFLYMLTTIL 337

Query: 343 LGMCVAYDDPLLXXXXXXXXXXXXXPYVVAIINSGIKALPHIFNACVLMFVFSACNSDLY 402
           +G  V YD P L             P+V+AI + G+K +PH+ NA +L+ + S  NS  Y
Sbjct: 338 IGFLVPYDSPQLMGSTSGGGSHSS-PFVIAIASHGVKVVPHLINAVILISIVSVANSAFY 396

Query: 403 VASRTLYGLAIDNKAPKIFAVTNRWGVPYYSLLMSSCFCLLAYMSVSSGSAKIFNYFVNV 462
            ++R L  L+   K PKIF   ++ G P+Y +L +S F  + +++ S    ++F + + +
Sbjct: 397 SSTRLLLSLSEQGKIPKIFNYVDKEGRPWYCILFASLFGSIGFVASSPYKEEVFTWLLAI 456

Query: 463 VSIFGLLSWISILITYLCFFRAVKAQNVDRSRFAYRAPFQPYGSYFTLAFCILIAFIKNF 522
             +  +  W+SI ++++ F RA+  Q        Y+AP   +GS+  L+   L + I  F
Sbjct: 457 SGLSQIFLWMSICLSHIRFRRAMIKQGKSLDEIGYKAPTGCWGSWIALSIA-LFSLISQF 515

Query: 523 TVFL-----NHHFDYKNFITGYIGIPVFVISYFGYK-FVKKTKIWKP-EEVDLYTFKAAI 575
            V +     +   D   F   Y+  P+ +I+Y GYK + K  +++ P +++DL ++   I
Sbjct: 516 WVAIAPIGKDGKLDVLVFFQNYLAAPIVLIAYLGYKTYYKDWRLYIPSDKIDL-SYGREI 574

Query: 576 DEEEEQ 581
              EEQ
Sbjct: 575 YVPEEQ 580

>ADL272W Chr4 (227414..229108) [1695 bp, 564 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YDR508C (GNP1)
          Length = 564

 Score =  235 bits (600), Expect = 5e-69,   Method: Compositional matrix adjust.
 Identities = 160/544 (29%), Positives = 262/544 (48%), Gaps = 33/544 (6%)

Query: 67  EDSEKQDDYMDDGKDEHTRLRKDLKARHISMIAXXXXXXXXXXXXXXXXXYTAGPMSMFI 126
           ED    +    +G  E   LR+ +K RH+ MI+                  TAG     I
Sbjct: 7   EDCSDAEKLSSEG-SEPASLRQSIKPRHVFMISMATGIGTGLLVGNGKSIATAGVGGTLI 65

Query: 127 AYAFVGVLVFFTMAALGEMASYIP--LDGFTSYASRYCDPALGFAVGYAYLCKYLILPPN 184
            Y  +GV+V   M ++GE+    P    GF SY  ++ DP+LGF V + +  +++++ P 
Sbjct: 66  GYLIIGVMVVCCMQSVGELVVAFPSLAGGFNSYGKKFIDPSLGFCVSWLFCLQWMVVLPL 125

Query: 185 QLTAAALVIQYWLDREQVNPGVWITIFLVIIVAMNFIGVKFFGEFEFWLSTFKVIVMIGL 244
           +L  A++ I+YW     ++P ++++ F ++I  +NF G   + E EF  +  KV+V+   
Sbjct: 126 ELVTASMTIKYW--NSNLSPSLFVSAFYILICIVNFFGSGGYAEAEFIFNCVKVMVLASF 183

Query: 245 IILLFVIMLGGGPTHDRLGFRFYDHPGAFKPYSKSIDGSKGKXXXXXXXXXXXXXXXXGI 304
           I+L  VI+ GG      +GF++   PGAF         + G                 G+
Sbjct: 184 IVLGIVIITGGLGNSGPIGFQYLKTPGAFNTNYNVFKATAGTLVNAAFSCG-------GV 236

Query: 305 ELTGIVAAEAA--NPRKSIPKAIKLTMYRIIVFYLVTIFLLGMCVAYDDPLLXXXXXXXX 362
           E   + AAE    N  KSI +A +    R+ VFYL++I ++G+ V YD P+L        
Sbjct: 237 EFLALSAAEQNRDNMPKSIRRACRQVSIRMFVFYLLSISVVGLLVPYDSPMLMGSGSDTT 296

Query: 363 XXXXXPYVVAIINSGIKALPHIFNACVLMFVFSACNSDLYVASRTLYGLAIDNKAPKIFA 422
                PYV AI   G++ +PHI NA +L+ V S  NS +Y +SRTL+ LA  N AP+ FA
Sbjct: 297 HTS--PYVAAIALHGVRIVPHIINAVILIAVVSVANSAMYSSSRTLHSLAEQNFAPRYFA 354

Query: 423 VTNRWGVPYYSLLMSSCFCLLAYMSVSSGSAKIFNYFVNVVSIFGLLSWISILITYLCFF 482
           + N+ G P   L++S+   L+++++       +F + +++  +  + +W +I I ++ F 
Sbjct: 355 LLNKHGQPMRCLVVSAIVGLISFIAEYRDQEAVFVWLLSISGLSTIFTWTTICIAHIRFR 414

Query: 483 RAVKAQNVDRSRFAYRAPFQPYGSYFTLAFCILIAFIKNFTVFL-----NHHFDYKNFIT 537
            A+K Q        YR+     GSY   A  +++  ++ F V L     N   D   F  
Sbjct: 415 NALKLQGQSLDTLGYRSNTGVIGSYIATAINVVVIIVQ-FWVSLFPLENNGKPDAVKFFQ 473

Query: 538 GYIGIPVFVISYFGYKFVKKTKIWKP----EEVDLYTFK---AAIDEEEEQG--KIADAE 588
            Y+ +PV V+ Y G+K    T  W P      VD+ T +   A  D+   +G  K+A A 
Sbjct: 474 NYMAVPVAVLLYLGHKL--YTNDWTPWIRTHCVDINTDRDVYAPSDDLSTKGVVKLAPAV 531

Query: 589 RRER 592
           +  R
Sbjct: 532 QSAR 535

>KLLA0D16830g Chr4 (1426856..1429354) [2499 bp, 832 aa] {ON} similar
           to uniprot|Q03770 Saccharomyces cerevisiae YDR160W SSY1
           Component of the SPS plasma membrane amino acid sensor
           system (Ssy1p-Ptr3p-Ssy5p) which senses external amino
           acid concentration and transmits intracellular signals
           that result in regulation of expression of amino acid
           permease genes
          Length = 832

 Score =  241 bits (614), Expect = 6e-69,   Method: Compositional matrix adjust.
 Identities = 162/601 (26%), Positives = 283/601 (47%), Gaps = 63/601 (10%)

Query: 58  NLSTVSSRLEDSEKQDDYM---DDGKDEHTRLRKDLKARHISMIAXXXXXXXXXXXXXXX 114
           ++S  S+    S KQ  ++   +  K  H  +++ L+ARHI MIA               
Sbjct: 226 SVSKCSNNNSGSRKQSKFIKKYNALKGSHHSVQRKLEARHIQMIASGSSLGVGLFLTSGK 285

Query: 115 XXYTAGPMSMFIAYAFVGVLVFFTMAALGEMASYIPL-DGFTSYASRYCDPALGFAVGYA 173
               AGP    + Y   G +V  +  +  E+ + IPL  GF+  ASR+ + A GFA+G+ 
Sbjct: 286 AFTIAGPFGALLGYVLCGSIVMASTLSFTELCALIPLTSGFSGLASRFVEDAFGFALGWL 345

Query: 174 YLCKYLILPPNQLTAAALVIQYW--LDREQVNPGVWITIFLVIIVAMNFIGVKFFGEFEF 231
           Y   ++I  P+Q+ A+ +++ Y+  L+        ++T+FLV  + +N   V+ FG F +
Sbjct: 346 YWFSFIIAVPSQVVASTMLLNYYQSLNLSSGKIAGFVTLFLVFAIFINLCDVRIFGNFVY 405

Query: 232 WLSTFKVIVMIGLIILLFVIMLGGGP-THDRLGFRFYDHP--------GAFKPY------ 276
           +++  K+I  I +I ++ V+  GG    HDR+GFRF+D          G F+P       
Sbjct: 406 FVTIIKIIFTIVMIFVMIVLNSGGAALGHDRVGFRFWDAGKSAPGLFYGLFRPTFNLKDE 465

Query: 277 ----SKSIDGSKGKXXXXXXXXXXXXXXXXGIELTGIVAAEAANPRKSIPKAIKLTMYRI 332
                  I G+KG+                GIE+T + + E  NP+K++P A+K T+Y +
Sbjct: 466 GSEIISGISGAKGRLLAIFLSMLIAAFTYSGIEMTFVASCEVRNPKKALPSAMKKTLYIM 525

Query: 333 IVFYLVTIFLLGMCVAYDDPLLXXXXXXXXXXXX-------------------------- 366
           ++ Y ++IF++G+ +   DP L                                      
Sbjct: 526 LLIYTISIFVVGLNIYSGDPRLPRFYTYSQDSSNYNIMHNIGMNWQVSTHCQSTLLSSGS 585

Query: 367 -------XPYVVAIINSGIKALPHIFNACVLMFVFSACNSDLYVASRTLYGLAIDNKAPK 419
                    +V+A+ + G      + N  ++ +  ++  S LY AS TLY +AI  KAP+
Sbjct: 586 LLSDGNRSAWVIALRSFGRCTFASVLNGILIFYGATSGCSSLYGASHTLYSMAIQGKAPR 645

Query: 420 IFAVTNRWGVPYYSLLMSSCFCLLAYMSVSSGSAKIFNYFVNVVSIFGLLSWISILITYL 479
           I      +GVP+ ++L+S  F +++YM+V   S   F    N+ S    + W  + +++L
Sbjct: 646 ICKACTSYGVPWIAVLVSGIFGVISYMAVDQSSLNNFQILANISSATICIIWAGMNVSFL 705

Query: 480 CFFRAVKAQ----NVDRSRFAYRAPFQPYGSYFTLAFCILIAFIKNFTVFLNHHFDYKNF 535
            FF A+K +    + D   F YR+PFQPY SY+ L   +++ F   FT F +  ++ K F
Sbjct: 706 RFFYALKIRPDIMSRDDPMFPYRSPFQPYLSYYGLFGSLVMIFFAGFTSFFHGFWNIKIF 765

Query: 536 ITGYIGIPVFVISYFGYKFVKKTKIWKPEEVDLYTFKAAIDEE-EEQGKIADAERRERLK 594
            + Y G+  F++ Y GYK    +K+ + +++D+   +  +D     Q        +ERL 
Sbjct: 766 FSCYGGLVFFIVLYIGYKLFGTSKLQRLDQIDMDIGRIELDRTIWNQQTEYQGNWKERLS 825

Query: 595 N 595
           +
Sbjct: 826 S 826

>NCAS0A08920 Chr1 (1765699..1767498) [1800 bp, 599 aa] {ON}
           Anc_1.368
          Length = 599

 Score =  235 bits (600), Expect = 9e-69,   Method: Compositional matrix adjust.
 Identities = 154/528 (29%), Positives = 259/528 (49%), Gaps = 31/528 (5%)

Query: 78  DGKDEHTRLRKDLKARHISMIAXXXXXXXXXXXXXXXXXYTAGPMSMFIAYAFVGVLVFF 137
           DG  +   L++ LKARH+ MIA                  T GP+++ I +A  G  +  
Sbjct: 77  DGSFDTNNLKRSLKARHLIMIAIGGSIGTGLFVGSGQAIATGGPLAVVIGWAIAGSQIIG 136

Query: 138 TMAALGEMASYIPLDG-FTSYASRYCDPALGFAVGYAYLCKYLILPPNQLTAAALVIQYW 196
           T+  LGE+    P+ G F +Y++R+ DP+L F +   Y+ ++  + P ++ ++A+ +QYW
Sbjct: 137 TIHGLGEITVRFPVVGAFANYSTRFLDPSLSFVISTIYVIQWFFVLPLEIISSAMTVQYW 196

Query: 197 LDREQVNPGVWITIFLVIIVAMNFIGVKFFGEFEFWLSTFKVIVMIGLIILLFVIMLGGG 256
              + ++P VW+ IF   IV++N  G + FGE EF  S+ KV+ + G IIL  V++ GGG
Sbjct: 197 --NQSIDPVVWVAIFYCAIVSINLFGARGFGEAEFVFSSVKVLTICGFIILCIVLICGGG 254

Query: 257 PTHDRLGFRFYDHPGAFKPYSKSIDGSKGKXXXXXXXXXXXXXXXXGIELTGIVAAEAAN 316
           P HD +G +++  PG          G  G                 G E+  + + E  +
Sbjct: 255 PDHDFVGAKYWHDPGCLA------HGFPG----VLSVLVVASYSLGGTEMVCLASGET-D 303

Query: 317 PRKSIPKAIKLTMYRIIVFYLVTIFLLGMCVAYDDPLLXXXXXXXXXXXXXPYVVAIINS 376
           P K +P AIK T +RI+ F+LV++ L+G  V Y +  L             P+V+AI   
Sbjct: 304 P-KELPSAIKQTFWRILFFFLVSLTLIGFLVPYTNENLLGGSSVNNS----PFVIAIKLH 358

Query: 377 GIKALPHIFNACVLMFVFSACNSDLYVASRTLYGLAIDNKAPKIFAVTNRWGVPYYSLLM 436
            IK LP I NA +L+ + S  NS ++ +SRTL  +A     P+ F   +R G P   ++ 
Sbjct: 359 QIKVLPSIVNAVILISILSVGNSCIFASSRTLCSMAHQGLIPRFFGYIDRAGRPLTGIIT 418

Query: 437 SSCFCLLAYMSVSSGSAKIFNYFVNVVSIFGLLSWISILITYLCFFRAVKAQNVDRSRFA 496
           +S F LLA++  SS  +++F++ + +  +   + W+SI I+++ F  A+KAQ        
Sbjct: 419 NSLFGLLAFLVKSSSMSEVFDWLMAIAGLATCIVWLSINISHIRFRLAMKAQGRSLDELE 478

Query: 497 YRAPFQPYGSYFTLAFCILIAFIKNFTVFL------NHHFDYKNFITGYIGIPVFVISYF 550
           + +    +GS ++     LI   + +          N     K F   Y+   + ++ + 
Sbjct: 479 FVSAVGIWGSAYSAVINSLILVAQFYCALWPIGGWENSSIRAKKFFQSYLCALIMIVLFV 538

Query: 551 GYKFV---KKTKIWKP---EEVDLYTFKAAIDEEEEQGKIADAERRER 592
           G+K     K  K W      ++DL T +  ID E  + +IA+  R  R
Sbjct: 539 GHKIFYRYKTGKWWSMLPLNKIDLETDRKNIDIEILKQEIAERNRHLR 586

>YDR046C Chr4 complement(548762..550576) [1815 bp, 604 aa] {ON}
           BAP3Amino acid permease involved in the uptake of
           cysteine, leucine, isoleucine and valine
          Length = 604

 Score =  235 bits (599), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 163/564 (28%), Positives = 280/564 (49%), Gaps = 29/564 (5%)

Query: 46  DKKDGLDINDMDNLSTV-SSRLEDSEKQDDYMDDGKDE---HTRLRKDLKARHISMIAXX 101
           + ++GL    +D+     S RLE    +D+ ++DG      +  L+K +K+RH+ M++  
Sbjct: 46  ESRNGLVHRFVDSFRRAESQRLE----EDNDLEDGTKSMKSNNHLKKSMKSRHVVMMSLG 101

Query: 102 XXXXXXXXXXXXXXXYTAGPMSMFIAYAFVGVLVFFTMAALGEMA-SYIPLDG-FTSYAS 159
                            AGP S+ I Y  V  + +F + A GEM  +Y  L G F +Y S
Sbjct: 102 TGIGTGLLVANAKGLSLAGPGSLVIGYVMVSFVTYFMVQAAGEMGVTYPTLPGNFNAYNS 161

Query: 160 RYCDPALGFAVGYAYLCKYLILPPNQLTAAALVIQYWLDREQVNPGVWITIFLVIIVAMN 219
            +   + GFA  + +  ++L + P +L  +++ ++YW D   +N  V+I IF V ++ ++
Sbjct: 162 IFISKSFGFATTWLFCIQWLTVLPLELITSSMTVKYWND--TINADVFIVIFYVFLLFIH 219

Query: 220 FIGVKFFGEFEFWLSTFKVIVMIGLIILLFVIMLGGGPTHDRLGFRFYDHPGAFKPYSKS 279
           F GVK +GE EF  ++ K++++ G IIL  VI  GG      +G +++  PG+F   S +
Sbjct: 220 FFGVKAYGETEFIFNSCKILMVAGFIILSVVINCGGAGVDGYIGGKYWRDPGSFAEGSGA 279

Query: 280 IDGSKGKXXXXXXXXXXXXXXXXGIELTGIVAAEAANPRKSIPKAIKLTMYRIIVFYLVT 339
                 +                GIEL  +   E +NPRKS P A K ++YRI++ YL+T
Sbjct: 280 T-----RFKGICYILVSAYFSFGGIELFVLSINEQSNPRKSTPVAAKRSVYRILIIYLLT 334

Query: 340 IFLLGMCVAYDDPLLXXXXXXXXXXXXXPYVVAIINSGIKALPHIFNACVLMFVFSACNS 399
           + L+G  V +++  L             PYV+A     ++ +PHI NA +L+ V S  NS
Sbjct: 335 MILIGFNVPHNNDQLMGSGGSATHAS--PYVLAASIHKVRVIPHIINAVILISVISVANS 392

Query: 400 DLYVASRTLYGLAIDNKAPKIFAVTNRWGVPYYSLLMSSCFCLLAYMSVSSGSAKIFNYF 459
            LY A R +  LA    APK     +R G P  +L++ S   ++ +++ S    + F + 
Sbjct: 393 ALYAAPRLMCSLAQQGYAPKFLNYIDREGRPLRALVVCSLVGVVGFVACSPQEEQAFTWL 452

Query: 460 VNVVSIFGLLSWISILITYLCFFRAVKAQNVDRSRFAYRAPFQPYGSYFTLAFCILIAFI 519
             +  +  L +W  I+++++ F +A+K Q        Y+A    +GSY+ + F +L+ F+
Sbjct: 453 AAIAGLSELFTWSGIMLSHIRFRKAMKVQGRSLDEVGYKANTGIWGSYYGVFFNMLV-FM 511

Query: 520 KNFTVFLN-----HHFDYKNFITGYIGIPVFVISYFGYKFVKK--TKIWKPEEVDLYTFK 572
             F V L+        D + F   Y+  P+++  Y GY   K+  T +   +++DL   +
Sbjct: 512 AQFWVALSPIGNGGKCDAQAFFESYLAAPLWIFMYVGYMVYKRDFTFLNPLDKIDLDFHR 571

Query: 573 AAIDEEEEQGKIADAERRERLKNS 596
              D E  + +  D E +ERLKNS
Sbjct: 572 RVYDPEIMRQE--DEENKERLKNS 593

>Kwal_27.10538 s27 (380769..382577) [1809 bp, 602 aa] {ON} YBR068C
           (BAP2) - probable amino acid permease for leucine,
           valine, and isoleucine [contig 35] FULL
          Length = 602

 Score =  234 bits (598), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 169/600 (28%), Positives = 278/600 (46%), Gaps = 25/600 (4%)

Query: 12  SENHSMVSLGASDSRGXXXXXXXXXXXXXXXXXXDKKDGLDINDMDNLSTVSSRLEDSEK 71
           SE HSM  +  SD                     +  D  + N          R E    
Sbjct: 4   SEIHSMSEIKDSDDSAQPVLSSVKSESGSIGQEWNAWDNENRNAWGRFVNSFKRAEKHST 63

Query: 72  QDDYMDDGKDEHT-----RLRKDLKARHISMIAXXXXXXXXXXXXXXXXXYTAGPMSMFI 126
             +   +    H+      L++ +K RH++M++                    GP  + I
Sbjct: 64  PSNGDLEHATTHSVASSSPLKRSIKPRHVAMMSICTGIGTGLLVANGKSLRFGGPAGLII 123

Query: 127 AYAFVGVLVFFTMAALGEMA-SYIPLDG-FTSYASRYCDPALGFAVGYAYLCKYLILPPN 184
            YA V V+ +  M A GEMA +Y  L G F +Y+S+      GFA  + Y  ++L + P 
Sbjct: 124 GYAAVSVVAYIMMQAAGEMAVAYPSLPGNFNAYSSQLISRPFGFATVWLYCIQWLTVLPL 183

Query: 185 QLTAAALVIQYWLDREQVNPGVWITIFLVIIVAMNFIGVKFFGEFEFWLSTFKVIVMIGL 244
           +L  A+L I+YW D   +N  V+I IF V I+ ++F G + +GE EF     KV+++IG 
Sbjct: 184 ELITASLTIKYWND--SINADVFIAIFYVFILFIHFFGSRGYGESEFIFGICKVLMIIGF 241

Query: 245 IILLFVIMLGGGPTHDRLGFRFYDHPGAFKPYSKSIDGSKGKXXXXXXXXXXXXXXXXGI 304
           +IL  VI  GG      +G +++  PGAF     ++     K                G 
Sbjct: 242 VILSIVINCGGAGDRKYIGAKYWYDPGAF-----AVGSGATKFKGVAYVLVTGYFSYGGT 296

Query: 305 ELTGIVAAEAANPRKSIPKAIKLTMYRIIVFYLVTIFLLGMCVAYDDPLLXXXXXXXXXX 364
           EL  +   E +NPR++I    K  +YRI++ Y++T+ L+G  V +    L          
Sbjct: 297 ELYAMTVNEQSNPRRAIQSITKQCIYRILLIYMLTMILIGFLVPHTSSELMGSSGKSATH 356

Query: 365 XXXPYVVAIINSGIKALPHIFNACVLMFVFSACNSDLYVASRTLYGLAIDNKAPKIFAVT 424
              PYV+A+   G+K +PHI NA +L+ V S  NS +Y   R L  LA    AP+  A  
Sbjct: 357 AS-PYVLAVSLHGVKIVPHIINAVILIAVISVGNSAMYSGPRILNTLAEQGYAPRFLAYV 415

Query: 425 NRWGVPYYSLLMSSCFCLLAYMSVSSGSAKIFNYFVNVVSIFGLLSWISILITYLCFFRA 484
           +R G P  +L+  S F LLA+++ S     +F +   +  +  L +W +I+++++ F +A
Sbjct: 416 DRAGRPLVALIACSVFGLLAFVAASDCEEDVFTWLAAIAGLSELFTWSAIMLSHVRFRQA 475

Query: 485 VKAQNVDRSRFAYRAPFQPYGSYFTLAFCILIAFIKNFTVFL-----NHHFDYKNFITGY 539
           ++  N   S   Y+A     GS   L+F IL+ FI  F V +     +   D  +F   Y
Sbjct: 476 MRYNNRPLSELGYKANTGVLGSVLGLSFNILV-FIAQFWVSIAPFGKDGKLDVLSFFQSY 534

Query: 540 IGIPVFVISYFGYKFV-KKTKIWKP-EEVDLYTFKAAIDEEEEQGKIADAERRERLKNSK 597
           +  P++V+ +FGY  V +  +I KP +++DL  +++  D++    +  D E +  ++NS 
Sbjct: 535 LAFPLWVVLFFGYMIVFRNWEIIKPLKDIDLDHYRSIYDQDRLYQE--DLEHKILIQNSS 592

>Kpol_534.22 s534 (50849..52627) [1779 bp, 592 aa] {ON}
           (50849..52627) [1779 nt, 593 aa]
          Length = 592

 Score =  234 bits (597), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 171/582 (29%), Positives = 283/582 (48%), Gaps = 54/582 (9%)

Query: 47  KKDGLDIND----MDNLSTVSS---------RLEDSEKQDDYMDDGKDEHTRLRKDLKAR 93
           + D  +I+D     D LST+S          R+ DS K  +   DG      L+K LK+R
Sbjct: 29  ESDNKNIDDNFIPHDTLSTISRKEKKPPIYRRIIDSFKPPE---DGSFHTGNLKKSLKSR 85

Query: 94  HISMIAXXXXXXXXXXXXXXXXXYTAGPMSMFIAYAFVGVLVFFTMAALGEMASYIPLDG 153
           H+ MIA                  T GP+++ I +A  G  +  T+  LGE+    P+ G
Sbjct: 86  HLIMIAIGGSIGTGLFIGSGQALATGGPLAVIIGWAVAGSQIVGTIHGLGEITVRFPVVG 145

Query: 154 -FTSYASRYCDPALGFAVGYAYLCKYLILPPNQLTAAALVIQYWLDREQVNPGVWITIFL 212
            F SY +R+ DP++ F V   Y+ ++  + P ++ A+A+ +QYW D   ++P V++ IF 
Sbjct: 146 AFASYTTRFLDPSISFVVSTIYVLQWFFVLPLEIIASAITVQYWND--SIDPVVFVAIFY 203

Query: 213 VIIVAMNFIGVKFFGEFEFWLSTFKVIVMIGLIILLFVIMLGGGPTHDRLGFRFYDHPGA 272
            +IV++N  G + FGE EF  ST K+I + G IIL  V++ GGGP H+ +G +++ +PG+
Sbjct: 204 CVIVSINLFGARGFGEAEFIFSTVKIITICGFIILCIVLIAGGGPDHEYIGAKYWHNPGS 263

Query: 273 FKPYSKSIDGSKGKXXXXXXXXXXXXXXXXGIELTGIVAAEAANPRKSIPKAIKLTMYRI 332
                    G KG                 G E+T + + E  +P K +P AIK   +RI
Sbjct: 264 LA------HGFKG----VLSVLVVASYSLGGTEMTCLASGET-DP-KELPSAIKQVFWRI 311

Query: 333 IVFYLVTIFLLGMCVAYDDPLLXXXXXXXXXXXXXPYVVAIINSGIKALPHIFNACVLMF 392
           + F+LV++ L+G  V Y +P L             P+V+AI    IK LP I NA +L+ 
Sbjct: 312 LFFFLVSLTLVGFLVPYTNPNLLGGSSVDNS----PFVIAIKIHNIKVLPSIVNAVILVS 367

Query: 393 VFSACNSDLYVASRTLYGLAIDNKAPKIFAVTNRWGVPYYSLLMSSCFCLLAYMSVSSGS 452
           + S  NS ++ +SRTL  +A  +  P  F   +R G P   ++++S F LLA++  SS  
Sbjct: 368 ILSVGNSCIFASSRTLCSMAHQHLIPWWFGYIDRAGRPLTGIIINSLFGLLAFLVKSSSV 427

Query: 453 AKIFNYFVNVVSIFGLLSWISILITYLCFFRAVKAQNVDRSRFAYRAPFQPYGSYFTLAF 512
            ++F++ + +  +   + W+SI I ++ F  A+KAQN       + +    +GS ++   
Sbjct: 428 TEVFDWLMAIAGLATCIVWLSINICHVRFRLAMKAQNRTLDELEFVSAVGIWGSVYSGIV 487

Query: 513 CILIAFIKNFTVFL-------NHHFDYKNFITGYIGIPVFVISYFGYKF---VKKTKIWK 562
             LI  +  F + L       +     K F   Y+   + ++ + G+K    V     W+
Sbjct: 488 NALI-LVAQFYIALWPIGGWTDSGTRAKKFFQNYLCALILIVLFIGHKIYYRVTTGHWWE 546

Query: 563 ---PEEVDLYTFKAAIDEEEEQGKIADAERRERLKNSKTKGW 601
               +++DL T +  +D E     I   E  E+     +K W
Sbjct: 547 YIALKDIDLDTDRKNVDIE-----IIKQEIHEKKMYLASKPW 583

>SAKL0H15092g Chr8 complement(1306212..1308764) [2553 bp, 850 aa]
           {ON} similar to uniprot|Q03770 Saccharomyces cerevisiae
           YDR160W SSY1 Component of the SPS plasma membrane amino
           acid sensor system (Ssy1p-Ptr3p-Ssy5p) which senses
           external amino acid concentration and transmits
           intracellular signals that result in regulation of
           expression of amino acid permease genes
          Length = 850

 Score =  239 bits (610), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 157/574 (27%), Positives = 276/574 (48%), Gaps = 58/574 (10%)

Query: 79  GKDEHTRLRKDLKARHISMIAXXXXXXXXXXXXXXXXXYTAGPMSMFIAYAFVGVLVFFT 138
           G ++   +++ L  RH+ MIA                   AGP    + +     +V  T
Sbjct: 271 GHNDVYHVQRKLHVRHLQMIAIGASLGVGLFLTSGKAFTVAGPFGTLLGFLLCASIVLAT 330

Query: 139 MAALGEMASYIPLD-GFTSYASRYCDPALGFAVGYAYLCKYLILPPNQLTAAALVIQYW- 196
           M +  E+++ IP+  GF+  ASR+ + A GFA+G++Y   ++I  PNQ+ A+  ++ Y+ 
Sbjct: 331 MLSFTEISTLIPISSGFSGLASRFVEDAFGFALGWSYWFSFVIALPNQIVASTFMLSYYE 390

Query: 197 -LDREQVNPGVWITIFLVIIVAMNFIGVKFFGEFEFWLSTFKVIVMIGLIILLFVIMLGG 255
            L+    +   ++T+FL+  + +N + V+  GE  +  + FK+++ + ++I +  +  G 
Sbjct: 391 HLNVPSGSTAGFVTLFLLFAIFINLLDVRILGEILYGSTFFKILITVMMMIAMIALNAGA 450

Query: 256 GP-THDRLGFRFYDHP--------GAFKPY-------SKSIDG---SKGKXXXXXXXXXX 296
           G   H R+GFR++D          G F+P        S S+DG   SKG+          
Sbjct: 451 GAHRHSRVGFRYWDSSKSPEGLTYGLFRPTFDLGDKGSGSLDGIGGSKGRFLAVLVVMLI 510

Query: 297 XXXXXXGIELTGIVAAEAANPRKSIPKAIKLTMYRIIVFYLVTIFLLGMCVAYDDPLLXX 356
                 G+EL  + + EA NPRK++P A K T   II+ YL +IFL+G+ +   DP L  
Sbjct: 511 SSFAFSGVELAFVASGEAVNPRKTLPSATKRTFIIIIILYLFSIFLVGLNIYSGDPRLLR 570

Query: 357 XXXX------------------------------XXXXXXXPYVVAIINSGIKALPHIFN 386
                                                    P+V+A+ + G+     + N
Sbjct: 571 YYASPGKDVTIDDYGTKWQIETSCNKNLVVNLDGAINGSQSPWVLALQSFGLCTFSSVLN 630

Query: 387 ACVLMFVFSACNSDLYVASRTLYGLAIDNKAPKIFAVTNRWGVPYYSLLMSSCFCLLAYM 446
             ++ F  SA  S LY +SRTLY ++I  KAP++F   ++ G+PY S+L    F + +Y+
Sbjct: 631 GILIFFGPSAGCSSLYASSRTLYSMSIQGKAPELFRRCSKKGIPYVSVLFCGAFGVTSYL 690

Query: 447 SVSSGSAKIFNYFVNVVSIFGLLSWISILITYLCFFRAVKAQ----NVDRSRFAYRAPFQ 502
           SVS  S + F    N+ S    + W+ + I++L F+ A+K +    + D   F YR+PFQ
Sbjct: 691 SVSKESVENFQALANISSASICIIWMGLNISFLRFYYALKKRPDIISRDDPSFPYRSPFQ 750

Query: 503 PYGSYFTLAFCILIAFIKNFTVFLNHHFDYKNFITGYIGIPVFVISYFGYKFVKKTKIWK 562
           PY +++ L    ++     FT FL   ++ K F + Y G+  F + Y GYK    +KI +
Sbjct: 751 PYLAFYGLLGSTILVLFMGFTTFLPGLWNTKVFFSAYGGLMFFTVCYLGYKTFGTSKIQR 810

Query: 563 PEEVDLYTFKAAIDEE--EEQGKIADAERRERLK 594
            +++D+ + +  ID    +E  + +D  +   ++
Sbjct: 811 LDQLDMDSGRREIDRMIWDEHHEYSDTFKERAIR 844

>Kpol_1065.13 s1065 (28709..30499) [1791 bp, 596 aa] {ON}
           (28709..30499) [1791 nt, 597 aa]
          Length = 596

 Score =  234 bits (597), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 159/545 (29%), Positives = 270/545 (49%), Gaps = 27/545 (4%)

Query: 64  SRLEDSEKQDDYMDDGK---DEHTRLRKDLKARHISMIAXXXXXXXXXXXXXXXXXYTAG 120
           S+L ++  +D  ++DG       T+ +K L +RH+ M++                 Y  G
Sbjct: 54  SQLHNARSED--VEDGIASIRSDTQFKKSLSSRHVIMMSLGTGIGTGLLVANAKGLYYGG 111

Query: 121 PMSMFIAYAFVGVLVFFTMAALGEMA-SYIPLDG-FTSYASRYCDPALGFAVGYAYLCKY 178
           P S+ I Y  V  + +F + A GEMA +Y  L G F +Y S +   + GFA  + +  ++
Sbjct: 112 PGSLIIGYVLVSFVTYFMIQAAGEMAVAYPTLPGNFNAYQSIFISKSWGFATVWLFCIQW 171

Query: 179 LILPPNQLTAAALVIQYWLDREQVNPGVWITIFLVIIVAMNFIG-VKFFGEFEFWLSTFK 237
           L + P +L  ++L I+YW D+  +N  +++ IF V +VA++ +G ++ +GE EF  ++ K
Sbjct: 172 LTVLPLELITSSLTIKYWNDK--INADIFVMIFYVFLVAIHLVGGIRAYGETEFLFNSCK 229

Query: 238 VIVMIGLIILLFVIMLGGGPTHDRLGFRFYDHPGAFKPYSKSIDGSKGKXXXXXXXXXXX 297
           ++++IG IIL  VI  GG      +G +++  PG+F         +  +           
Sbjct: 230 ILMVIGFIILSIVINAGGAGNDGYIGGKYWHEPGSFAE-----GDATSRFKGICLVLVSG 284

Query: 298 XXXXXGIELTGIVAAEAANPRKSIPKAIKLTMYRIIVFYLVTIFLLGMCVAYDDPLLXXX 357
                G EL  +   E A PRK+ P A K ++YRI++ YL+T+ L+G  V +++  L   
Sbjct: 285 YFSYGGTELYVLSVNEQAEPRKATPAAAKKSIYRILIIYLLTMILIGFNVPHNNDQLMGA 344

Query: 358 XXXXXXXXXXPYVVAIINSGIKALPHIFNACVLMFVFSACNSDLYVASRTLYGLAIDNKA 417
                     PYV+A    G+K +PH  NA +L+ V S  NS L+   R L  LA    A
Sbjct: 345 GGSATHAS--PYVLAATIHGVKIVPHFINAVILISVISVANSSLFAGPRLLSSLATQGYA 402

Query: 418 PKIFAVTNRWGVPYYSLLMSSCFCLLAYMSVSSGSAKIFNYFVNVVSIFGLLSWISILIT 477
           PKI +  +R G P  +L +S    L+A++S +S   ++F +   +  +  + +W  I+ +
Sbjct: 403 PKILSYVDREGRPLVALGISFLIGLIAFVSCTSHEEEVFTWLAAIAGLSEIFTWSGIMFS 462

Query: 478 YLCFFRAVKAQNVDRSRFAYRAPFQPYGSYFTLAFCILIAFIKNFTVFL-----NHHFDY 532
           ++ F  A+K Q  D +   Y+A    +GS +   F +L+  I  F V L         D 
Sbjct: 463 HVRFRAAMKVQGKDINELGYKANTGVWGSAYGAFFGVLV-LIAQFWVALAPIGNGGKCDA 521

Query: 533 KNFITGYIGIPVFVISYFGYKFVKK--TKIWKPEEVDLYTFKAAIDEEEEQGKIADAERR 590
           + F   Y+  P++V  YFGY    K  T +   +++DL +++   D E    K  D E +
Sbjct: 522 EAFFESYLAFPIWVACYFGYMIYNKDFTLLSPLDKIDLDSYRRIYDPELI--KQEDEENK 579

Query: 591 ERLKN 595
           E LK+
Sbjct: 580 ENLKS 584

>TBLA0C01210 Chr3 complement(260786..262588) [1803 bp, 600 aa] {ON} 
          Length = 600

 Score =  234 bits (597), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 160/539 (29%), Positives = 268/539 (49%), Gaps = 38/539 (7%)

Query: 77  DDGKDEHTRLRKDLKARHISMIAXXXXXXXXXXXXXXXXXYTAGPMSMFIAYAFVGVLVF 136
           +DG  + + L+K LKARH+ MIA                  T GP+++ I +A  G  + 
Sbjct: 77  EDGSFDTSNLKKTLKARHLIMIAIGGSIGTGLFIGSGQALATGGPLAVIIGWAIAGSQII 136

Query: 137 FTMAALGEMASYIPLDG-FTSYASRYCDPALGFAVGYAYLCKYLILPPNQLTAAALVIQY 195
            T+  LGE+    P+ G F +Y++R+ DP++ F V   Y+ ++  + P ++ ++A+ +QY
Sbjct: 137 GTIHGLGEITVRFPVVGAFANYSTRFLDPSISFVVSTIYVIQWFFVLPLEIISSAMTVQY 196

Query: 196 WLDREQVNPGVWITIFLVIIVAMNFIGVKFFGEFEFWLSTFKVIVMIGLIILLFVIMLGG 255
           W   E ++P VW+ IF V IV++N  GV+ FGE EF  ST KVI + G I+L  +++ GG
Sbjct: 197 W--NESIDPVVWVAIFYVTIVSINLFGVRGFGEAEFIFSTIKVITISGFILLCIILIAGG 254

Query: 256 GPTHDRLGFRFYDHPGAFKPYSKSIDGSKGKXXXXXXXXXXXXXXXXGIELTGIVAAEAA 315
           GP H  +G R++ +PG         +G  G                 G E+T + + E  
Sbjct: 255 GPDHVYVGSRYWHNPGCLA------NGFPG----VLSVMVVASYSLGGTEMTCLASGET- 303

Query: 316 NPRKSIPKAIKLTMYRIIVFYLVTIFLLGMCVAYDDPLLXXXXXXXXXXXXXPYVVAIIN 375
           +P K +P AIK   +RI+ F+LV++ L+G  V Y +  L             P+V+AI  
Sbjct: 304 DP-KELPSAIKQVFWRILFFFLVSLTLVGFLVPYTNENLLGGSSVDNS----PFVIAIKI 358

Query: 376 SGIKALPHIFNACVLMFVFSACNSDLYVASRTLYGLAIDNKAPKIFAVTNRWGVPYYSLL 435
             IK LP I NA +L+ + S  NS ++ +SRTL  +A  +  P  F   +R G P   ++
Sbjct: 359 HHIKVLPSIVNAVILISILSVGNSCIFASSRTLCSMAHQHLLPWWFGYIDRAGRPLVGII 418

Query: 436 MSSCFCLLAYMSVSSGSAKIFNYFVNVVSIFGLLSWISILITYLCFFRAVKAQNVDRSRF 495
            +S F LLA++  S   +++F++ + +  +   + W+SI ++++ F  A+KAQ    +  
Sbjct: 419 TNSLFGLLAFLVKSGSMSEVFDWLMAIAGLATCIVWLSINVSHIRFRLAMKAQGRSLNEL 478

Query: 496 AYRAPFQPYGSYFTLAFCILIAFIKNFTVFL-------NHHFDYKNFITGYIGIPVFVIS 548
            + +    +GS ++     LI  +  F + L       N     K F   Y+   + V  
Sbjct: 479 EFVSAVGIWGSVYSAIINCLI-LVAQFYISLWPIGGWKNSEDRAKKFFQSYLCALIMVCI 537

Query: 549 YFGYK---FVKKTKIW--KP-EEVDLYTFKAAIDEEEEQGKIADAERRERLKNSKTKGW 601
           + G+K   + +  KIW   P  E+DL   +  ID +     +   E  ER    K++ W
Sbjct: 538 WIGHKIYYWRQTGKIWAFTPLAEIDLDEGRKNIDLD-----VLKQEIHERKMYLKSRPW 591

>Ecym_2716 Chr2 (1386630..1388408) [1779 bp, 592 aa] {ON} similar to
           Ashbya gossypii AEL030W
          Length = 592

 Score =  233 bits (595), Expect = 4e-68,   Method: Compositional matrix adjust.
 Identities = 160/540 (29%), Positives = 271/540 (50%), Gaps = 42/540 (7%)

Query: 78  DGKDEHTRLRKDLKARHISMIAXXXXXXXXXXXXXXXXXYTAGPMSMFIAYAFVGVLVFF 137
           DG  + + +++ LK+RH+ MIA                  T GP+++ I +   G  +  
Sbjct: 70  DGSFDPSNMKRALKSRHLIMIAIGSSIGTGLFVGSGKALATGGPLALIIGWTLAGTQMIG 129

Query: 138 TMAALGEMASYIPLDG-FTSYASRYCDPALGFAVGYAYLCKYLILPPNQLTAAALVIQYW 196
           T+  LGE+   +P+ G F  Y++R+ DP++ F +   Y+ ++  + P ++ A+ + +++W
Sbjct: 130 TIHGLGELTVRLPVVGAFADYSTRFLDPSVSFVISSIYVMQWFFVLPLEIIASCITMRFW 189

Query: 197 LDREQVNPGVWITIFLVIIVAMNFIGVKFFGEFEFWLSTFKVIVMIGLIILLFVIMLGGG 256
              + V+P +W+ +F  +IV++N +GV+ FGE EF  S+ KVI + G IIL  V++LGGG
Sbjct: 190 --TQSVDPIIWVALFYTMIVSINLLGVRGFGEAEFIFSSVKVITICGFIILCIVLILGGG 247

Query: 257 PTHDRLGFRFYDHPGAFKPYSKSIDGSKGKXXXXXXXXXXXXXXXXGIELTGIVAAEAAN 316
           PTH  +G R++  PG         +G KG                 G E+T + + E  +
Sbjct: 248 PTHQYVGSRYWHDPGPLA------NGFKG----VAAVMVTASYSLGGSEMTCLASGET-D 296

Query: 317 PRKSIPKAIKLTMYRIIVFYLVTIFLLGMCVAYDDPLLXXXXXXXXXXXXXPYVVAIINS 376
           P K +P AIK   +RI+ F+LV++ L+G  V Y +  L             P+V+A+   
Sbjct: 297 P-KELPHAIKQIFWRILFFFLVSLTLVGFLVPYTNENLLGGSSAENS----PFVLALYLH 351

Query: 377 GIKALPHIFNACVLMFVFSACNSDLYVASRTLYGLAIDNKAPKIFAVTNRWGVPYYSLLM 436
            +K +PHI N  +L+ + S  NS ++ +SRTL  +A     P IF   +R G P   +L 
Sbjct: 352 HVKVVPHIVNGVILVSILSVGNSCIFASSRTLCSMAHQGLIPHIFGYVDRGGRPLVGILA 411

Query: 437 SSCFCLLAYMSVSSGSAKIFNYFVNVVSIFGLLSWISILITYLCFFRAVKAQNVDRSRFA 496
           +S F LLA++   S  + +F++ + +  +   + W+SI ++++ F  A+KAQN       
Sbjct: 412 NSIFGLLAFLVKFSSISNVFSWLMAIAGLATCVVWLSINVSHVRFRLAMKAQNKSLDELQ 471

Query: 497 YRAPFQPYGSYFT--LAFCILIAFIKNFTVFL-----------NHHFDYKNFITGYIGIP 543
           + +    +GS +   L F  L+A    F + L                +KN++   I I 
Sbjct: 472 FVSSVGVWGSVYAGVLNFLTLVA---QFYIALWPVEGWKDSKSRAEAFFKNYLCALILIA 528

Query: 544 VFVI--SYFGYKFVKKTKIWKPEEVDLYTFKAAIDEEEEQGKIADAERRERLKNSKTKGW 601
           +F     YF     K   I K  EVDL T +  ID E  + ++  AER++ L+N   K W
Sbjct: 529 MFAAHKCYFRITTGKWWGIKKLSEVDLDTGRVNIDIEIIKEEV--AERKKFLRN---KAW 583

>AGR319W Chr7 (1328425..1330305) [1881 bp, 626 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR191W (HIP1)
          Length = 626

 Score =  234 bits (597), Expect = 6e-68,   Method: Compositional matrix adjust.
 Identities = 157/539 (29%), Positives = 268/539 (49%), Gaps = 18/539 (3%)

Query: 65  RLEDSEKQDDYMDDGKDEHTRLRKDLKARHISMIAXXXXXXXXXXXXXXXXXYTAGPMSM 124
           R ++    +  + D     ++L K+L  RH+  +A                  T GP S+
Sbjct: 88  RYKEMTDVERAVCDAARNSSQLSKNLSIRHLLTLAVGGAIGTGLFVNSGASLNTGGPGSI 147

Query: 125 FIAYAFVGVLVFFTMAALGEMASYIPL-DGFTSYASRYCDPALGFAVGYAYLCKYLILPP 183
            IA+  +   +F  + +LGE+AS  P+  GF  Y +R+ +P+ GFAV  +YL ++ +L P
Sbjct: 148 LIAWTLISTCLFTIVNSLGELASAFPVVGGFNVYITRFVEPSFGFAVNISYLAQWAVLLP 207

Query: 184 NQLTAAALVIQYWLDREQVNPGVWITIFLVIIVAMNFIGVKFFGEFEFWLSTFKVIVMIG 243
            +L AA++ I+YW    ++N   W+ IF V I   N + VK FGE EF LS  K++ + G
Sbjct: 208 LELAAASITIKYW--NNKINSDAWVAIFYVCIALANMLDVKSFGETEFVLSMVKILAIFG 265

Query: 244 LIILLFVIMLGGGPTHDRLGFRFYDHPGAFKPYSKSIDGSKGKXXXXXXXXXXXXXXXXG 303
             IL  V++ GGGP    +G +++  PGAF       D    +                G
Sbjct: 266 FAILGTVLICGGGPVGGFIGAKYWHDPGAFVG-----DTPGAQFKGLCSVFVTAAFSYSG 320

Query: 304 IELTGIVAAEAANPRKSIPKAIKLTMYRIIVFYLVTIFLLGMCVAYDDPLLXXXXXXXXX 363
            EL G+ AAE+ NPR +IP+A K + + I   YL+ + + G  V  +DP L         
Sbjct: 321 TELVGVSAAESINPRYTIPRASKRSFWLITSSYLLVLTIAGCLVPSNDPRLLNGMSSVDV 380

Query: 364 XXXXPYVVAIINSGIKALPHIFNACVLMFVFSACNSDLYVASRTLYGLAIDNKAPKIFAV 423
               P V+AI N GI+ +P + NA +L+ + S  NS +Y  SR +  +A     PK+F  
Sbjct: 381 AAS-PLVIAIENGGIRGVPSLMNAIILIAIISVANSSVYACSRCMVSMAQVGNLPKVFNY 439

Query: 424 TNRWGVPYYSLLMSSCFCLLAYMSVSSGSAKIFNYFVNVVSIFGLLSWISILITYLCFFR 483
            +R G P  ++L +  F LL++++ S     IF +   +  +  L  W +I I+++ F R
Sbjct: 440 IDRKGRPLVAILATLVFGLLSFVAASDKQEAIFTWLSALSGLSTLFCWFAINISHIRFRR 499

Query: 484 AVKAQNVDRSRFAYRAPFQPYGSYF---TLAFCILIAFIKNFTVFLNHHFDYKNFITGYI 540
           A+ AQ        Y +     GS++    L F ++++F  +     +     ++F  GY+
Sbjct: 500 AMCAQQRSLDELPYLSLTGVLGSWYGAAVLLFVLVLSFWTSLFPPGSSGPSAESFFEGYL 559

Query: 541 GIPVFVISYFGYKFVKKT-KIWKPE-EVDLYTFKAAIDEEEEQGKIADAERRERLKNSK 597
             P+F+I Y  +K  K+  +++ P  ++D+ + + A+D EE    + + + RE+ + +K
Sbjct: 560 SFPIFLICYISHKLYKRDWRLFIPAGQIDVDSGRRALDIEE----LKEQKLREQAETAK 614

>KLLA0A06930g Chr1 complement(625498..627261) [1764 bp, 587 aa] {ON}
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039W GAP1 General amino acid permease localization to
           the plasma membrane is regulated by nitrogen source
          Length = 587

 Score =  233 bits (594), Expect = 6e-68,   Method: Compositional matrix adjust.
 Identities = 158/510 (30%), Positives = 261/510 (51%), Gaps = 22/510 (4%)

Query: 86  LRKDLKARHISMIAXXXXXXXXXXXXXXXXXYTAGPMSMFIAYAFVGVLVFFTMAALGEM 145
           L++ LK+RH+ MI                   TAGP  + I +A  G +++  + A+GE+
Sbjct: 76  LKRTLKSRHLQMIGIGGAIGTGLFVGSGKSLATAGPAGILIGWALTGTMIYCMVMAMGEL 135

Query: 146 ASYIPL-DGFTSYASRYCDPALGFAVGYAYLCKYLILPPNQLTAAALVIQYWLDREQVNP 204
           A   P+  G+T+YASR+ D + GFA    Y   +LI  P ++ AA++ + YW    +   
Sbjct: 136 AVTFPVAGGYTTYASRFVDESFGFAFNTVYAMGWLITLPLEIVAASITVNYWGTPAKYRD 195

Query: 205 GVWITIFLVIIVAMNFIGVKFFGEFEFWLSTFKVIVMIGLIILLFVIMLGGGPTHDRLGF 264
             ++ +F V+IV +N  GVK +GE EF  S  KVI +IG IIL  +++ GGGP    +G 
Sbjct: 196 A-FVALFYVVIVGINLFGVKGYGEAEFIFSFIKVIAVIGFIILGVILVCGGGPQGGYIGG 254

Query: 265 RFYDHPGAFKPYSKSIDGSKGKXXXXXXXXXXXXXXXXGIELTGIVAAEAANPRKSIPKA 324
           R + +PGAF       +G KG                 G EL G+ AAE ANPRKSIP A
Sbjct: 255 RLWHNPGAFA------NGFKG----VCSVFVTAAFSFAGSELVGLAAAETANPRKSIPSA 304

Query: 325 IKLTMYRIIVFYLVTIFLLGMCVAYDDPLLXXXXXXXXXXXXXPYVVAIINSGIKALPHI 384
            K   +RI +FY++ + ++G+ V Y    L             P+V++I N+GIK LP +
Sbjct: 305 AKQVFWRITLFYILALLMVGLLVPYTSDRLIGQSSVDAAAS--PFVISIQNAGIKGLPSV 362

Query: 385 FNACVLMFVFSACNSDLYVASRTLYGLAIDNKAPKIFAVTNRWGVPYYSLLMSSCFCLLA 444
            N  +L+ V S  N  ++  SR++  LA     PKIF   +R G P   ++++  F LL+
Sbjct: 363 INVVILIAVLSVGNCAVFGCSRSMAALANQGSLPKIFGYIDRTGRPLVGIVVTCVFGLLS 422

Query: 445 YMSVSSGSAKIFNYFVNVVSIFGLLSWISILITYLCFFRAVKAQNVDRSRFAYRAPFQPY 504
           +++ S    ++F++ + +  +  L +W  IL+ ++   RA+ AQN   +  ++ AP   +
Sbjct: 423 FIAASPKEGEVFDWLLALSGLSSLFTWGGILLCHIRVRRALAAQNRTTAELSFTAPTDVW 482

Query: 505 GSYFTLAFCILIAFIKNFTVF--LNHHFDYKNFITGYIGIPVFVISYFGYKFVKKTKIW- 561
           GS ++L   ILI   + +     +        F   Y+  P++++ Y G+K  KK   W 
Sbjct: 483 GSVYSLILIILILIAQFWIALFPIGGKPSAAAFFEAYLSFPIYIVFYIGHKIWKKN--WK 540

Query: 562 ---KPEEVDLYTFKAAIDEEEEQGKIADAE 588
              K  ++D+ + +   D E  + +IA+ +
Sbjct: 541 LFIKASDIDIDSGRRETDIEALKQEIAEEK 570

>KLTH0F11286g Chr6 (959314..961062) [1749 bp, 582 aa] {ON} similar
           to uniprot|P38090 Saccharomyces cerevisiae YBR132C AGP2
           Plasma membrane carnitine transporter expression is
           down-regulated by osmotic stress also functions as a
           low-affinity amino acid permease
          Length = 582

 Score =  233 bits (593), Expect = 6e-68,   Method: Compositional matrix adjust.
 Identities = 148/538 (27%), Positives = 261/538 (48%), Gaps = 16/538 (2%)

Query: 52  DINDMDNLSTVSSRLEDSEKQDDYMDDGKDEHTRLRKDLKARHISMIAXXXXXXXXXXXX 111
            +  +D   T++  L    + D  M+D     +  R+ L+ RH+ +I             
Sbjct: 37  SVVSIDAKQTITGYLTAEAESD--MED-----SVTRRTLRERHVLLIGISGVIGTALFVS 89

Query: 112 XXXXXYTAGPMSMFIAYAFVGVLVFFTMAALGEMASYIPLDG-FTSYASRYCDPALGFAV 170
                +  G + + +  A   + +     +  EM  Y+PLD  F   ASR  D +L    
Sbjct: 90  IGKGLFRGGSVFLLLGMALWCIPMLCITVSTAEMVCYLPLDSPFLCLASRCVDDSLAIMA 149

Query: 171 GYAYLCKYLILPPNQLTAAALVIQYWLDREQVNPGVWITIFLVIIVAMNFIGVKFFGEFE 230
           G+ +     +  P ++ A   ++ YW  R+  +  + + + +++  A++ + V+F+GE E
Sbjct: 150 GWNFWFLECVQIPFEIVAVNTILHYW--RDDYSAAIPLVVQVILYFAISVLAVRFYGEME 207

Query: 231 FWLSTFKVIVMIGLIILLFVIMLGGGPTHDRLGFR-FYDHP-GAFKPYSKSIDGSKGKXX 288
           FWL++FK+I+  GL +   V MLGG P  DR GFR F D P   + P  K    S G   
Sbjct: 208 FWLASFKIILAAGLFVFTLVAMLGGNPKKDRFGFRNFADAPFKQYFPSGKPGSPSAGYFQ 267

Query: 289 XXXXXXXXXXXXXXGIELTGIVAAEAANPRKSIPKAIKLTMYRIIVFYLVTIFLLG-MCV 347
                         G +   ++A E   PRK +P A K    R+ + +L +   +G +C 
Sbjct: 268 GFLACLIQASFTIAGPDYVAMIAGETRLPRKILPVAFKQVFNRLTILFLGSSLCVGILCS 327

Query: 348 AYDDPLLXXXXXXXXXXXXXPYVVAIINSGIKALPHIFNACVLMFVFSACNSDLYVASRT 407
           A D  L+             PYV+A+ N GIK LP + NA ++   FSA N+  + +SRT
Sbjct: 328 ANDPSLMAAISEARPGAGASPYVLAMKNLGIKTLPDVVNAALVTAAFSAGNAYTFCSSRT 387

Query: 408 LYGLAIDNKAPKIFAVTNRWGVPYYSLLMSSCFCLLAYMSVSSGSAKIFNYFVNVVSIFG 467
           L+G+A+   AP +F   NR GVP Y++ +S  + LL+ + ++  SA + N+ +N+++   
Sbjct: 388 LHGMALVGNAPAVFKRCNRHGVPIYAVAVSLTWALLSLLQLNKNSAVVLNWLINMITASQ 447

Query: 468 LLSWISILITYLCFFRAVKAQNVDRSRFAYRAPFQPYGSYFTLAFCILIAFIKNFTVFLN 527
           L+++  + +TYL F RA  AQ        +++  QPY +   L   +++  ++ + VF +
Sbjct: 448 LINFAVLCVTYLYFRRAYHAQCGALPELPFKSWGQPYTALVGLVAVLIMVLVQGYAVFCS 507

Query: 528 HHFDYKNFITGYIGIPVFVISYFGYKF-VKKTKIW--KPEEVDLYTFKAAIDEEEEQG 582
             +D + F+  Y+ I + +  Y  +KF V++ + W   P+ VDL T   A++  E + 
Sbjct: 508 SLWDVQEFLFCYLMIFIDIAIYVVHKFVVQRGRCWPRAPKAVDLVTGLLAVERHEREA 565

>Kpol_2002.44 s2002 complement(89144..90370,90372..91028) [1884 bp,
           627 aa] {ON} complement(89144..90370,90372..91028) [1884
           nt, 628 aa]
          Length = 627

 Score =  233 bits (595), Expect = 9e-68,   Method: Compositional matrix adjust.
 Identities = 173/584 (29%), Positives = 282/584 (48%), Gaps = 56/584 (9%)

Query: 52  DINDMDNLSTVSS----------RLEDSEKQDDYM---DDGKDEHT-------------R 85
           D+ND    S+++           R  DS K+ ++M   DD  +E T              
Sbjct: 50  DLNDKYGSSSINESPAKKKSNLRRFVDSFKRAEHMIPADDKINEMTTAEPEAEMASVEDN 109

Query: 86  LRKDLKARHISMIAXXXXXXXXXXXXXXXXXYTAGPMSMFIAYAFVGVLVFFTMAALGEM 145
           L++ +K RH+ MI+                   AGP  +   YA +G  V+  + + GEM
Sbjct: 110 LKQTIKPRHVIMISLGTGIGTGLLVGNGSALVKAGPAGLVTGYAIMGTCVYCIIQSAGEM 169

Query: 146 AS-YIPLDG-FTSYASRYCDPALGFAVGYAYLCKYLILPPNQLTAAALVIQYWLD----- 198
           A  Y  L+G F +Y +   +P  GF     ++C  L +    +   +  I Y  D     
Sbjct: 170 AVVYSKLNGGFNAYPTMLVEP--GF-----WVCCRLGVLFTMVDCLSFGIGYCFDDYKYW 222

Query: 199 REQVNPGVWITIFLVIIVAMNFIGVKFFGEFEFWLSTFKVIVMIGLIILLFVIMLGGGPT 258
             +V+P V++ IF V+I+ +N  G + + E EF+ +  KV++M G  IL  +I +GG   
Sbjct: 223 TTRVDPDVFVVIFYVLIIVINVFGARGYAEAEFFFNCCKVLMMAGFFILGIIINVGGAGN 282

Query: 259 HDRLGFRFYDHPGAFKPYSKSIDGSKGKXXXXXXXXXXXXXXXXGIELTGIVAAEAANPR 318
              LG  ++ +PGAF+   K ID  KG                 G E   + AAE +NPR
Sbjct: 283 DGYLGNIYWRNPGAFRG-DKGIDHFKG----VVATLVTAAFAFGGTEFIALTAAEQSNPR 337

Query: 319 KSIPKAIKLTMYRIIVFYLVTIFLLGMCVAYDDPLLXXXXXXXXXXXXXPYVVAIINSGI 378
           K+IP A K  +YRI++ YL +I L+G  V +  P L             PYV+A+ + G+
Sbjct: 338 KAIPSAAKKVLYRIVLVYLTSIILIGFLVPFTSPELLGSGSAATAAS--PYVIAVASHGV 395

Query: 379 KALPHIFNACVLMFVFSACNSDLYVASRTLYGLAIDNKAPKIFAVTNRWGVPYYSLLMSS 438
           + +PH  NA +L+ V S  NS  Y +SR L  L+    APK F   +R G P  ++++S+
Sbjct: 396 RVVPHFINAVILLSVLSVGNSAFYSSSRLLLSLSKQGYAPKWFDYVDREGRPSRAMIVSA 455

Query: 439 CFCLLAYMSVSSGSAKIFNYFVNVVSIFGLLSWISILITYLCFFRAVKAQNVDRSRFAYR 498
            F ++A+ + S    ++F + + +  +  + +WISI ++++ F  A+KAQ        ++
Sbjct: 456 LFGVIAFCATSPKETEVFTWLLAISGLSQIFTWISICLSHIRFRAAMKAQGRSMGEVGFK 515

Query: 499 APFQPYGSYFTLAFCILIAFIKNFTVFL----NHHFDYKNFITGYIGIPVFVISYFGYKF 554
           A    +GSY+++ F +++  I  F V +          +NF   Y+ +P+ +  YFGYK 
Sbjct: 516 AQTGIWGSYYSI-FLMILTLIGQFWVAIAPIGTAELSARNFFENYLAMPILIGFYFGYKI 574

Query: 555 VKK--TKIWKPEEVDLYTFKAAIDEEEEQGKIADAERRERLKNS 596
            KK  T   K E++DL + +   DEE    K  D E +E+LKN 
Sbjct: 575 WKKDWTLYIKAEDIDLISHRQIFDEELL--KQEDYELKEKLKNG 616

>Kwal_33.14276 s33 complement(596760..598550) [1791 bp, 596 aa] {ON}
           YKR039W (GAP1) - general amino acid permease [contig
           104] FULL
          Length = 596

 Score =  233 bits (593), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 149/517 (28%), Positives = 257/517 (49%), Gaps = 23/517 (4%)

Query: 86  LRKDLKARHISMIAXXXXXXXXXXXXXXXXXYTAGPMSMFIAYAFVGVLVFFTMAALGEM 145
           L++ LK RH+ MIA                    GP ++ +A+   G +V+  + A+GE+
Sbjct: 84  LKRHLKNRHLQMIAIGGSIGTGLFVGSGKALRIGGPAAVILAWILTGSMVYSVVQAIGEL 143

Query: 146 ASYIPLDG-FTSYASRYCDPALGFAVGYAYLCKYLILPPNQLTAAALVIQYWLDREQVNP 204
              +P+ G + SY SR+ DP+ GFA+ Y YL   L+  P ++ AA++ + YW    +   
Sbjct: 144 CVALPVSGSYLSYVSRFIDPSFGFAIAYNYLVGNLVTMPLEIVAASITVDYWNVDHKYAD 203

Query: 205 GVWITIFLVIIVAMNFIGVKFFGEFEFWLSTFKVIVMIGLIILLFVIMLGGGPTHDR-LG 263
           G ++ +F V ++ +NF+GVK +GE EF  S  KV+ ++G IIL  V++ GGG  +   +G
Sbjct: 204 G-FVALFYVTVLLINFLGVKGYGEAEFVFSIIKVLAIVGFIILGIVLVCGGGSNNTGYIG 262

Query: 264 FRFYDHPGAFKPYSKSIDGSKGKXXXXXXXXXXXXXXXXGIELTGIVAAEAANPRKSIPK 323
            +++ +PG F        G KG                 G E+  + AAE+ NPR+ +PK
Sbjct: 263 TKYWHNPGGFA------HGFKG----FAAIFVTSAFSFSGSEMFALGAAESKNPRRDLPK 312

Query: 324 AIKLTMYRIIVFYLVTIFLLGMCVAYDDPLLXXXXXXXXXXXXXPYVVAIINSGIKALPH 383
           A K   +RI +FYL+++ L+G  V Y +  L             P+V+AI  +GI  LP 
Sbjct: 313 AAKQVFWRITLFYLISLTLIGCLVPYTNKHLFASSSVDASAS--PFVIAIKEAGISGLPS 370

Query: 384 IFNACVLMFVFSACNSDLYVASRTLYGLAIDNKAPKIFAVTNRWGVPYYSLLMSSCFCLL 443
           + N  +L+ V S  N+ ++ +SR    LA     PK FA  +R G P   L++S  F LL
Sbjct: 371 VINVVILVAVLSVGNTCVFASSRATLSLAHYGYLPKKFAYVDRKGRPLAGLILSMVFGLL 430

Query: 444 AYMSVSSGSAKIFNYFVNVVSIFGLLSWISILITYLCFFRAVKAQNVDRSRFAYRAPFQP 503
           +++S S     +F + + V  +    +W SI + +L F + ++AQ       A++A    
Sbjct: 431 SFLSSSKHKGVVFEWMLAVSGLCSFFTWGSICVCHLRFRQGLRAQGRSTDELAFKAQTGI 490

Query: 504 YGSYFTLAFCILIAFIKNFTVF--LNHHFDYKNFITGYIGIPVFVISYFGYKFVKKTKIW 561
           +GS + +    ++   + +     L+      +F   Y+ +PV ++ Y G+K   +   W
Sbjct: 491 WGSIYGITLISVVLCFQFWVALFPLSKSPSAYHFFEQYLSLPVVIVFYMGHKVYSRN--W 548

Query: 562 K----PEEVDLYTFKAAIDEEEEQGKIADAERRERLK 594
           +     +E+DL T +  +D E  + +I +     R +
Sbjct: 549 RLVIPAKELDLDTGRREVDLELLKQEIKEENESIRSR 585

>CAGL0B03773g Chr2 (373956..375773) [1818 bp, 605 aa] {ON} highly
           similar to uniprot|P06775 Saccharomyces cerevisiae
           YGR191w HIP1 Histidine permease
          Length = 605

 Score =  233 bits (593), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 156/517 (30%), Positives = 266/517 (51%), Gaps = 16/517 (3%)

Query: 66  LEDSEKQDDYMDDGKDEHTRLRKDLKARHISMIAXXXXXXXXXXXXXXXXXYTAGPMSMF 125
           ++ + +   Y++D    +T L KDL  RH+  +A                  T GP S+ 
Sbjct: 70  VKATPEAASYVED--INNTNLNKDLSVRHLLTLAVGGAIGTGLFVNSGASLTTGGPASLV 127

Query: 126 IAYAFVGVLVFFTMAALGEMASYIPL-DGFTSYASRYCDPALGFAVGYAYLCKYLILPPN 184
           I +  V   +F  + +LGE+A+  P+  GF  Y +R+ +P+  FA+   YL ++L+L P 
Sbjct: 128 IGWVIVSTCLFTVINSLGELAAAFPVVGGFNVYITRFIEPSFAFAINLNYLAQWLVLLPL 187

Query: 185 QLTAAALVIQYWLDREQVNPGVWITIFLVIIVAMNFIGVKFFGEFEFWLSTFKVIVMIGL 244
           +L AA++ I+YW D+  +N   W+ IF   I   N + VK FGE EF LS  K++ +IG 
Sbjct: 188 ELVAASITIRYWNDK--INSDAWVAIFYTAIALANMLDVKSFGETEFILSMVKILAIIGF 245

Query: 245 IILLFVIMLGGGPTHDRLGFRFYDHPGAFKPYSKSIDGSKGKXXXXXXXXXXXXXXXXGI 304
            IL  V+  GGGP    +G +++ +PGAF  +S    GS+ K                GI
Sbjct: 246 GILGIVLTCGGGPHGGYIGGKYWHNPGAFVGHSA---GSQFKGLCSVFVTAAFSYS--GI 300

Query: 305 ELTGIVAAEAANPRKSIPKAIKLTMYRIIVFYLVTIFLLGMCVAYDDPLLXXXXXXXXXX 364
           E+T + AAE+ NP+++IPKA K T + I V Y+  + L+G  V Y+DP L          
Sbjct: 301 EMTAVSAAESRNPKETIPKAAKRTFWLITVSYVGILTLIGCLVPYNDPRLLNGSSSVDAA 360

Query: 365 XXXPYVVAIINSGIKALPHIFNACVLMFVFSACNSDLYVASRTLYGLAIDNKAPKIFAVT 424
              P V+AI N GIK LP + NA +L+ + S  NS +Y  SR +  +A     PK  +  
Sbjct: 361 AS-PLVIAIENGGIKGLPSLMNAIILIAIVSVANSAVYACSRCMVSMAHIGNLPKFLSKV 419

Query: 425 NRWGVPYYSLLMSSCFCLLAYMSVSSGSAKIFNYFVNVVSIFGLLSWISILITYLCFFRA 484
           ++ G P  ++L++  F LL++++ S    ++F +   +  +  +  W++I ++ + F  A
Sbjct: 420 DKRGRPLNAILLTLFFGLLSFIAASDKQEEVFTWLSALSGLSTIFCWMAINLSLIRFRDA 479

Query: 485 VKAQNVDRSRFAYRAPFQPYGSYF--TLAFCILIA-FIKNFTVFLNHHFDYKNFITGYIG 541
           +KAQ        + +    +G+++   + F +L+A F  +     +     K+F  GY+ 
Sbjct: 480 MKAQGRSLDEMPFLSQSGTWGAWYGVIVLFLVLVASFWTSLFPVGSSTASAKSFFEGYLS 539

Query: 542 IPVFVISYFGYKFVKKT-KIWKP-EEVDLYTFKAAID 576
           +P+ +  Y G+K  K+  ++  P  E+DL + +  +D
Sbjct: 540 LPILIACYVGHKLWKRDWRLLVPLMEMDLDSGRRVLD 576

>Smik_4.284 Chr4 complement(515341..517155) [1815 bp, 604 aa] {ON}
           YBR068C (REAL)
          Length = 604

 Score =  233 bits (593), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 162/564 (28%), Positives = 280/564 (49%), Gaps = 29/564 (5%)

Query: 46  DKKDGLDINDMDNLSTVSSR-LEDSEKQDDYMDDGK---DEHTRLRKDLKARHISMIAXX 101
           + ++GL    +D+     S+ LED    D+ ++DG      + RL+K +K+RH+ M++  
Sbjct: 46  ESRNGLVHRFVDSFKRAESQHLED----DNDLEDGTRSMKSNNRLKKSMKSRHVVMMSLG 101

Query: 102 XXXXXXXXXXXXXXXYTAGPMSMFIAYAFVGVLVFFTMAALGEMA-SYIPLDG-FTSYAS 159
                            AGP S+ I Y  V  + +F + A GEM  +Y  L G F +Y S
Sbjct: 102 TGIGTGLLVANAKGLKLAGPGSLVIGYVMVSFVTYFMVQAAGEMGVTYPTLPGNFNAYNS 161

Query: 160 RYCDPALGFAVGYAYLCKYLILPPNQLTAAALVIQYWLDREQVNPGVWITIFLVIIVAMN 219
            +   + GFA  + +  ++L + P +L  +++ I+YW D+  +N  V+I IF V ++ ++
Sbjct: 162 IFISKSFGFATTWIFCIQWLTVLPLELITSSMTIKYWNDK--INSDVFIVIFYVFLLFIH 219

Query: 220 FIGVKFFGEFEFWLSTFKVIVMIGLIILLFVIMLGGGPTHDRLGFRFYDHPGAFKPYSKS 279
           F GVK +GE EF  S+ K++++ G IIL  VI  GG      +G +++  PG+F   + +
Sbjct: 220 FFGVKAYGETEFIFSSCKILMIAGFIILSVVINCGGAGVDGYIGGKYWRDPGSFAEGNGA 279

Query: 280 IDGSKGKXXXXXXXXXXXXXXXXGIELTGIVAAEAANPRKSIPKAIKLTMYRIIVFYLVT 339
                 +                GIEL  +   E +NPRKS P A K ++YRI++ YL+T
Sbjct: 280 T-----RFKGICFILVTAYFSFGGIELFVLSINEQSNPRKSTPVAAKRSVYRILIIYLLT 334

Query: 340 IFLLGMCVAYDDPLLXXXXXXXXXXXXXPYVVAIINSGIKALPHIFNACVLMFVFSACNS 399
           + L+G  V +++  L             PYV+A     ++ +PHI NA +L+ V S  NS
Sbjct: 335 MILIGFNVPHNNDQLMGSGSAATHAS--PYVLAASIHKVRVVPHIINAVILISVISVANS 392

Query: 400 DLYVASRTLYGLAIDNKAPKIFAVTNRWGVPYYSLLMSSCFCLLAYMSVSSGSAKIFNYF 459
            LY A R +  LA    APK     +R G P  +L +     ++ +++ S    + F + 
Sbjct: 393 ALYAAPRLMCSLAQQGYAPKFLDYIDREGRPLRALFVCCLVGVIGFVACSPQEEQAFTWL 452

Query: 460 VNVVSIFGLLSWISILITYLCFFRAVKAQNVDRSRFAYRAPFQPYGSYFTLAFCILIAFI 519
             +  +  L +W  I+++++ F +A+K Q        Y+A    +GSY+ + F IL+ F+
Sbjct: 453 AAIAGLSELFTWSGIMLSHIRFRKAMKVQGRSLDEVGYKANTGIWGSYYGVFFNILV-FM 511

Query: 520 KNFTVFLN-----HHFDYKNFITGYIGIPVFVISYFGYKFVKK--TKIWKPEEVDLYTFK 572
             F V L+        + + F   Y+  P+++  Y GY   ++  T +   +++DL   +
Sbjct: 512 AQFWVALSPIGNGGKCNAQAFFESYLAAPLWLCMYLGYMLYERDFTFLNPLDKIDLDYHR 571

Query: 573 AAIDEEEEQGKIADAERRERLKNS 596
              D E  + +  + E +ERLKNS
Sbjct: 572 RVYDPEIIRQE--NEENKERLKNS 593

>TDEL0C06510 Chr3 (1196039..1197967) [1929 bp, 642 aa] {ON} Anc_1.50
           YDR508C
          Length = 642

 Score =  233 bits (595), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 165/557 (29%), Positives = 278/557 (49%), Gaps = 27/557 (4%)

Query: 54  NDMDN-LSTVSS--RLEDSEKQDDYMD----DGKDEHTRLRKDLKARHISMIAXXXXXXX 106
            D++N L+T  S   L D +K  D       +GK +   L+K +K RH+ MI+       
Sbjct: 86  EDLENELTTCVSPATLSDYKKSGDSGSVDELEGKTKEEHLKKSIKPRHVVMISLGTGIGT 145

Query: 107 XXXXXXXXXXYTAGPMSMFIAYAFVGVLVFFTMAALGEMA-SYIPL-DGFTSYASRYCDP 164
                       AGP  + I YA +G  ++  + A GEMA +Y  L  GF +Y S    P
Sbjct: 146 GLLVGNAKALNDAGPAGLAIGYAIMGSCIYCIIQAAGEMAVTYSNLVGGFNAYPSFLVSP 205

Query: 165 ALGFAVGYAYLCKYLILPPNQLTAAALVIQYWLDREQVNPGVWITIFLVIIVAMNFIGVK 224
            LGFAV + Y  ++  + P +L  A++ I+YW  +  VNP V++ IF  +I+ +N  G +
Sbjct: 206 KLGFAVAWVYWLQWACVCPLELVTASMTIKYWTTK--VNPDVFVVIFYFLIIVINVFGAR 263

Query: 225 FFGEFEFWLSTFKVIVMIGLIILLFVIMLGGGPTHDRLGFRFYDHPGAFKPYSKSIDGSK 284
            + E EF+ +  KV+++ G  IL  +I  GG      +G +++  PGAF+   K+ID  K
Sbjct: 264 GYAEAEFFFNCCKVLMITGFFILGIIINCGGAGNDGYIGGKYWHDPGAFRG-DKAIDRFK 322

Query: 285 GKXXXXXXXXXXXXXXXXGIELTGIVAAEAANPRKSIPKAIKLTMYRIIVFYLVTIFLLG 344
           G                 G E   + A+E +NPRK+IP A K  +YRII+ +L +I ++G
Sbjct: 323 G----VAATLVTAAFAFGGSEFIALTASEQSNPRKAIPAAAKKILYRIIIIFLGSIIMVG 378

Query: 345 MCVAYDDPLLXXXXXXXXXXXXXPYVVAIINSGIKALPHIFNACVLMFVFSACNSDLYVA 404
             V ++   L             PYV+AI + G++ +PH  NA +L+ V S  NS  Y +
Sbjct: 379 FLVPWNSDQLMGSDSSKTKAS--PYVIAISSHGVRVVPHFVNAVILLSVLSVGNSAFYSS 436

Query: 405 SRTLYGLAIDNKAPKIFAVTNRWGVPYYSLLMSSCFCLLAYMSVSSGSAKIFNYFVNVVS 464
           SR L  L+    APK F   +R G P  ++++ + F ++A+ + SS    +F + + +  
Sbjct: 437 SRILISLSQQGYAPKFFNYIDREGRPARAMVIGALFAVIAFCAASSKEEDVFTWLLAISG 496

Query: 465 IFGLLSWISILITYLCFFRAVKAQNVDRSRFAYRAPFQPYGSYFTLAFCILIAFIKNFTV 524
           +  + +W +I ++++ F RA+  Q        +++    +GSY+      L+  I  F V
Sbjct: 497 LSQIFTWAAICLSHIRFRRAMHVQGRSLGEIGFKSELGVWGSYYAAGMMFLV-LIAQFWV 555

Query: 525 FLN----HHFDYKNFITGYIGIPVFVISYFGYKFVKK--TKIWKPEEVDLYTFKAAIDEE 578
            L     +  D ++F   Y+ + + +  Y GY F KK  T   + +++DL   +   DE+
Sbjct: 556 GLAPIGMNKLDAQSFFESYLAMLMLIAFYVGYMFWKKDWTLFIRAKDIDLDHHRQIFDED 615

Query: 579 EEQGKIADAERRERLKN 595
             + +  D E +E+L+N
Sbjct: 616 VLRQE--DEETKEKLRN 630

>KNAG0B01270 Chr2 (240862..242640) [1779 bp, 592 aa] {ON} Anc_3.397
           YBR132C
          Length = 592

 Score =  232 bits (591), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 151/548 (27%), Positives = 259/548 (47%), Gaps = 30/548 (5%)

Query: 47  KKDGLDINDMDNLSTVSSRLEDSEKQDDYMDDGKDE---HTRLRKDLKARHISMIAXXXX 103
            + G D+ D D         ED        DD +     + R  + L  RH+  IA    
Sbjct: 47  NRHGRDMRDGD---------EDEYDVVSVDDDSRTNLLPNIRTHRKLLNRHVQFIAISGV 97

Query: 104 XXXXXXXXXXXXXYTAGPMSMFIAYAFVGVLVFFTMAALGEMASYIPLDG-FTSYASRYC 162
                        Y  G   + IA+A   V +     +  EM S+ P+   F   A +  
Sbjct: 98  IGTALFVAIGKGLYYGGAGFLLIAFAMWCVPILAITVSTAEMVSFFPVSSPFLRLAKKCV 157

Query: 163 DPALGFAVGYAYLCKYLILPPNQLTAAALVIQYWLDREQVNPGVWITIFLVIIVAMNFIG 222
           D +L     + +     +  P ++ +   VI YW  R+  NP + + +  V+ + ++   
Sbjct: 158 DESLAVMASWNFWFLECVQIPYEIVSVNTVIHYW--RDDYNPAIPLVVQSVMYILISVCA 215

Query: 223 VKFFGEFEFWLSTFKVIVMIGLIILLFVIMLGGGPTHDRLGFRFYD-------HPGAFKP 275
           VK++GE EFWL++FK+++ +GL     V M+GG P HD  GFR +        +P     
Sbjct: 216 VKYYGEMEFWLASFKIVLAVGLFFFTLVTMVGGNPKHDVYGFRNFRIDSFKKYYPDGNDA 275

Query: 276 YSKSIDGSKGKXXXXXXXXXXXXXXXXGIELTGIVAAEAANPRKSIPKAIKLTMYRIIVF 335
           +S+S+   +G                 G E   ++A E   PRK +PKA +    R+ V 
Sbjct: 276 HSRSVGYFQG----FLVCLIRAAATIAGGEYIAMLAGEVKEPRKVLPKAFRQVFVRLTVL 331

Query: 336 YLVTIFLLGMCVAYDDPLLXXXXXXXX-XXXXXPYVVAIINSGIKALPHIFNACVLMFVF 394
           +L +   +G+  + +DP L              PYV+A+ N GI+ LP I N  ++   F
Sbjct: 332 FLGSCLCVGIVCSSNDPALTAAISESRPGAGSSPYVIAMNNLGIRVLPDIVNIALITAAF 391

Query: 395 SACNSDLYVASRTLYGLAIDNKAPKIFAVTNRWGVPYYSLLMSSCFCLLAYMSVSSGSAK 454
           SA N+  Y +SRTLYG+A+D  APKIF   N+ GVP +++ +S C+ L++ + ++S SA 
Sbjct: 392 SAGNAYTYCSSRTLYGMALDGYAPKIFKKCNKQGVPMFAVAVSLCWALISLLQLNSNSAV 451

Query: 455 IFNYFVNVVSIFGLLSWISILITYLCFFRAVKAQNVDRSRFAYRAPFQPYGSYFTLAFCI 514
           + N+ +N++    L++++++ I YL F RA   Q  +     +++ +QP+ + F ++  +
Sbjct: 452 VLNWLINIIVSSQLINFVALCIIYLHFRRAYLLQQDNLPGLPFKSWWQPWTAIFGMSCSV 511

Query: 515 LIAFIKNFTVFLNHHFDYKNFITGYIGIPVFVISYFGYKFV---KKTKIWKPEEVDLYTF 571
            +  I+ +TVF    +  ++F+  Y+ + + V  Y  YKFV    K K+  P  +D    
Sbjct: 512 AMILIQGYTVFFPKLWKARDFLFYYLMVFIDVGIYLFYKFVWTHGKDKVKDPTLIDFSED 571

Query: 572 KAAIDEEE 579
              I+E E
Sbjct: 572 LREIEEHE 579

>SAKL0C13992g Chr3 complement(1242080..1243738) [1659 bp, 552 aa]
           {ON} similar to uniprot|P43548 Saccharomyces cerevisiae
           YFL055W AGP3 Low-affinity amino acid permease may act to
           supply the cell with amino acids as nitrogen source in
           nitrogen-poor conditions transcription is induced under
           conditions of sulfur limitation
          Length = 552

 Score =  230 bits (587), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 163/552 (29%), Positives = 260/552 (47%), Gaps = 27/552 (4%)

Query: 52  DINDMDNLSTVSSRLEDSEKQDDYMDDGKDEHTRLRKDLKARHISMIAXXXXXXXXXXXX 111
           D +  D+LS  S    D+     +  +  D +T +++ LK RHIS++A            
Sbjct: 12  DESRSDDLSKFSKEEPDTHNIKSF--EQFDPNTGVKRALKNRHISLLALGGIIGPGCLVG 69

Query: 112 XXXXXYTAGPMSMFIAYAFVGVLVFFTMAALGEMASYIPL-DGFTSYASRYCDPALGFAV 170
                   GP+S+ + +  +G++ F  M ++GEM +  P   GF++ + R+   AL    
Sbjct: 70  AGNALSKGGPLSLLLGFGIIGIVAFAVMESIGEMITLYPSGSGFSTLSRRFHSDALSAVS 129

Query: 171 GYAYLCKYLILPPNQLTAAALVIQYWLDREQVNPGVWITIFLVIIVAMNFIGVKFFGEFE 230
           GYAY+  +  +  N+    + ++Q+W    QV    +I IF V       +GV  FGEFE
Sbjct: 130 GYAYVVVFFAVLANEYNTLSSILQFW--GPQVPLYGYILIFSVAFQVFQMLGVGIFGEFE 187

Query: 231 FWLSTFKVIVMIGLIILLFVIMLGGGPTHDRLGFRFYDHPGAFKPYSKSIDGSKGKXXXX 290
           +WL+ FK+I +I   I   + + GG       GF ++++PGA        DG KG     
Sbjct: 188 YWLAWFKIIGLIAYYIFSIIYISGGIKNRPAFGFHYWNNPGALA------DGFKG----I 237

Query: 291 XXXXXXXXXXXXGIELTGIVAAEAANPRKSIPKAIKLTMYRIIVFYLVTIFLLGMCVAYD 350
                       G E   + A E+ NP K++P AIK T +RII+ YL      G  V Y+
Sbjct: 238 AVVFVFCSSFYSGTESVALAATESRNPGKAVPIAIKQTFWRIIIVYLGIAVFYGATVPYN 297

Query: 351 DPLLXXXXXXXXXXXXXPYVVAIINSGIKALPHIFNACVLMFVFSACNSDLYVASRTLYG 410
           D  L             P  +AI  +G +   H+ NA +L+   SA N  LY+ SRTL  
Sbjct: 298 DTSLGAHTKALKS----PIAIAITRAGWEGGVHLVNAFILITCVSAINGSLYIGSRTLIY 353

Query: 411 LAIDNKAPKIFAVTNRWGVPYYSLLMSSCFCLLAYMSVSSGSAKIFNYFVNVVSIFGLLS 470
           LA +  APK    T++ GVP  ++ + +   L++ M+VS G++  ++Y VN+  +   + 
Sbjct: 354 LAHEGLAPKFLKWTDKRGVPIPAITLFNALGLVSLMNVSVGASNAYSYIVNLSGVGVFIV 413

Query: 471 WISILITYLCFFRAVKAQNVDRSRFAYRAPFQPYGSYFTLAFCILIAFIKNFTVFLNHHF 530
           W  I +T+L F +A   Q    S   Y++   P+G  F+LA  I +  I+ +T F+   F
Sbjct: 414 WGIISLTHLRFRKAWDLQGRSASELPYKSLLFPWGPIFSLAANIFLGLIQGWTTFV--PF 471

Query: 531 DYKNFITGYIGIPVFVISYFGYKFVKKTKIWKPEEVDLYTFKAAIDEEEE---QGKIADA 587
             K+F+  YI +P  VI Y     +   KI   + VDL T        E+    G   D+
Sbjct: 472 SAKDFVDAYILLPAAVILYI---VISLVKIGGFKLVDLRTVDLEEGRREDLDSDGTDEDS 528

Query: 588 ERRERLKNSKTK 599
           E ++R   S  +
Sbjct: 529 EGKDRSVRSAKR 540

>TBLA0B07760 Chr2 complement(1834605..1836581) [1977 bp, 658 aa]
           {ON} Anc_5.158 YGR191W
          Length = 658

 Score =  233 bits (593), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 157/525 (29%), Positives = 258/525 (49%), Gaps = 20/525 (3%)

Query: 80  KDEHTRL----RKDLKARHISMIAXXXXXXXXXXXXXXXXXYTAGPMSMFIAYAFVGVLV 135
           KDE T L     KDL  RH+  +A                  T GP S+ I +  V   +
Sbjct: 131 KDEETLLATDMNKDLSVRHLLTLAVGGAIGTGLFVNSGSSLNTGGPASLVIGWVIVSTAL 190

Query: 136 FFTMAALGEMASYIPL-DGFTSYASRYCDPALGFAVGYAYLCKYLILPPNQLTAAALVIQ 194
           F  + +LGE+A+  P+  GF+ Y  ++ DP+  FAV   YL ++L+L P +L AA++ I+
Sbjct: 191 FTVINSLGELAAAFPVVGGFSVYMDKFVDPSFAFAVNLNYLLQWLVLLPLELVAASITIR 250

Query: 195 YWLDREQVNPGVWITIFLVIIVAMNFIGVKFFGEFEFWLSTFKVIVMIGLIILLFVIMLG 254
           YW     +N   W++IF V I   N + VK FGE EF LS  K++ +IG  IL  V+  G
Sbjct: 251 YW--NSSINSDAWVSIFYVAIGLANMLDVKSFGETEFVLSLVKILAIIGFFILGIVLDCG 308

Query: 255 GGPTHDRLGFRFYDHPGAFKPYSKSIDGSKGKXXXXXXXXXXXXXXXXGIELTGIVAAEA 314
           GGP+H+ +G +++  PGAF     +  GSK K                GIE+T + AAE+
Sbjct: 309 GGPSHEYIGGKYWHDPGAF---VGTTSGSKFKGLCSVFVTAAFSFS--GIEMTAVSAAES 363

Query: 315 ANPRKSIPKAIKLTMYRIIVFYLVTIFLLGMCVAYDDPLLXXXXXXXXXXXXXPYVVAII 374
            NPR++IPKA K T + I   Y+  + L+G  V Y+DP L             P V+AI 
Sbjct: 364 RNPRETIPKAAKRTFWLITGSYVSILTLVGCLVPYNDPRLMNGSSSVDAASS-PLVIAIE 422

Query: 375 NSGIKALPHIFNACVLMFVFSACNSDLYVASRTLYGLAIDNKAPKIFAVTNRWGVPYYSL 434
           N  I  LP + NA +L+ + S  NS +Y  SR +  ++     PK+FA  +R G P  ++
Sbjct: 423 NGHIHGLPSLMNAIILIAILSVANSSVYACSRCMVSMSKIETLPKVFAKVDRRGRPIPAI 482

Query: 435 LMSSCFCLLAYMSVSSGSAKIFNYFVNVVSIFGLLSWISILITYLCFFRAVKAQNVDRSR 494
                F LL++++ S   A++F +   +  +  +  W+ I + ++ F + +  Q +    
Sbjct: 483 CFVLFFGLLSFVAASDKQAEVFTWLSALSGLSTIFCWMGINLCHIRFRQGMHVQQISLDE 542

Query: 495 FAYRAPFQPYGSYFTLA--FCILIA-FIKNFTVFLNHHFDYKNFITGYIGIPVFVISYFG 551
             + +    +GS + +   F +L+A F  +     +   +  +F  GY+  P+ +  Y  
Sbjct: 543 LPFLSQTGIWGSIYGIVILFLVLVASFWTSLFPVGSSKANATSFFEGYLSFPILLGCYIA 602

Query: 552 YKFVKKTKIW--KPEEVDLYTFKAAIDEE--EEQGKIADAERRER 592
           +K   K   W     ++DL++ +  +D E   E+ ++      +R
Sbjct: 603 HKVYFKNWRWYIPASKMDLHSGRKQVDLEVVREELRLEKEHLAQR 647

>AEL030W Chr5 (577803..579551) [1749 bp, 582 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOL020W (TAT2) Newly
           annotated start codon according to experimentaly
           determined 5' end of mRNA using 5' RACE.
          Length = 582

 Score =  231 bits (588), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 152/527 (28%), Positives = 267/527 (50%), Gaps = 35/527 (6%)

Query: 78  DGKDEHTRLRKDLKARHISMIAXXXXXXXXXXXXXXXXXYTAGPMSMFIAYAFVGVLVFF 137
           DG  +   L++ LK+RH+ MIA                  T GP+++ I +   G  +  
Sbjct: 60  DGSFDPDNLKRTLKSRHLIMIAIGGSIGTGLFIGSGKALATGGPLAVLIGWTLAGTQMVG 119

Query: 138 TMAALGEMASYIPLDG-FTSYASRYCDPALGFAVGYAYLCKYLILPPNQLTAAALVIQYW 196
           T+  LGE+    P+ G F +Y++R+ DP++ F V   Y+ ++  + P ++ A+A+ +++W
Sbjct: 120 TIHGLGEVTVRFPVVGAFANYSTRFLDPSVSFVVSSIYVLQWFFVLPLEIIASAITMEFW 179

Query: 197 LDREQVNPGVWITIFLVIIVAMNFIGVKFFGEFEFWLSTFKVIVMIGLIILLFVIMLGGG 256
                V+P VW+ +F  +I+++N  GV++FG+ +F  S  K++ + G IIL  V++LGGG
Sbjct: 180 --TTSVDPVVWVAVFYTLIISINLFGVRWFGKPKFVFSVIKMVPICGFIILCLVLILGGG 237

Query: 257 PTHDRLGFRFYDHPGAFKPYSKSIDGSKGKXXXXXXXXXXXXXXXXGIELTGIVAAEAAN 316
           PTH+ +G R++  PGA        +G KG                 G E+T + + E  +
Sbjct: 238 PTHEFIGARYWHDPGALA------NGFKG----VAAVMVTASYSLGGSEMTCLASGET-D 286

Query: 317 PRKSIPKAIKLTMYRIIVFYLVTIFLLGMCVAY-DDPLLXXXXXXXXXXXXXPYVVAIIN 375
           P K IP AIK   +RII F+LV++ L+G  V Y +D LL             P+V+AI  
Sbjct: 287 P-KEIPHAIKQIFWRIIFFFLVSLTLVGFLVPYTNDQLLGGSNVNNS-----PFVIAIKM 340

Query: 376 SGIKALPHIFNACVLMFVFSACNSDLYVASRTLYGLAIDNKAPKIFAVTNRWGVPYYSLL 435
             I+ LPHI N  +L+ + S  NS ++ +SRTL  +A     P+IF   +R G P   +L
Sbjct: 341 HNIRVLPHIINGVILVSILSVGNSCIFASSRTLCSMAHQGLLPRIFGYVDRAGRPLTGIL 400

Query: 436 MSSCFCLLAYMSVSSGSAKIFNYFVNVVSIFGLLSWISILITYLCFFRAVKAQNVDRSRF 495
            +S F LLA++  SS +  +F + + V  +   + W+SI ++++ F  A+KAQ       
Sbjct: 401 TNSLFGLLAFLVKSSSTGTVFTWLMAVAGLATAVVWLSINVSHIRFRLAMKAQGKSLDEL 460

Query: 496 AYRAPFQPYGSYFTLAFCILIAFIKNFTVFLNHHFDYKN-------FITGYIGIPVFVIS 548
            + +    +GS ++    +++  +  F V L     +K+       F   Y+   + +  
Sbjct: 461 EFVSAVGMWGSVYSGVMNVVV-LVAQFYVSLWPIEGWKDPRGRTEAFFQNYLCALILLFM 519

Query: 549 YFGYKFVKKT------KIWKPEEVDLYTFKAAIDEEEEQGKIADAER 589
           +  +K   ++      KI    E+DL + +  ID E  + ++A  ++
Sbjct: 520 FVAHKIYYRSTTGQWWKILPLAEIDLESGRKNIDIEVVKHEVAARKK 566

>Skud_4.300 Chr4 complement(525086..526900) [1815 bp, 604 aa] {ON}
           YBR068C (REAL)
          Length = 604

 Score =  231 bits (589), Expect = 5e-67,   Method: Compositional matrix adjust.
 Identities = 160/563 (28%), Positives = 277/563 (49%), Gaps = 25/563 (4%)

Query: 46  DKKDGLDINDMDNLSTVSSR-LEDSEKQDDYMDDGKDEHTRLRKDLKARHISMIAXXXXX 104
           + ++GL    +D+     S+ LE++   +D     K  +  L+K +K+RH+ M++     
Sbjct: 46  ESRNGLVHRFVDSFRRAESQCLEENNDLEDGTRPMKS-NNHLKKSMKSRHVVMMSLGTGI 104

Query: 105 XXXXXXXXXXXXYTAGPMSMFIAYAFVGVLVFFTMAALGEMA-SYIPLDG-FTSYASRYC 162
                         AGP S+ I Y  V  + +F + A GEM  +Y  L G F +Y S + 
Sbjct: 105 GTGLLVANAKGLKLAGPGSLVIGYVLVSFITYFMVQAAGEMGVAYATLPGNFNAYNSIFI 164

Query: 163 DPALGFAVGYAYLCKYLILPPNQLTAAALVIQYWLDREQVNPGVWITIFLVIIVAMNFIG 222
             + GFA  + +  ++L + P +L  +++ I+YW D   +N  V+I IF V ++ ++F G
Sbjct: 165 SKSFGFATTWLFCIQWLTVLPLELITSSMTIKYWND--SINADVFIVIFYVFLLFIHFFG 222

Query: 223 VKFFGEFEFWLSTFKVIVMIGLIILLFVIMLGGGPTHDRLGFRFYDHPGAFKPYSKSIDG 282
           VK +GE EF  ++ K++++ G IIL  VI  GG      +G +++  PG+F       DG
Sbjct: 223 VKAYGETEFIFNSCKILMVAGFIILSVVINCGGAGVDGYIGGKYWRDPGSFA------DG 276

Query: 283 SKG-KXXXXXXXXXXXXXXXXGIELTGIVAAEAANPRKSIPKAIKLTMYRIIVFYLVTIF 341
           S   +                GIEL  +   E +N RKS P A K ++YRI++ YL+T+ 
Sbjct: 277 SNATRFKGICFILVTAYFSFGGIELFVLSINEQSNARKSTPLAAKRSVYRILIIYLLTMI 336

Query: 342 LLGMCVAYDDPLLXXXXXXXXXXXXXPYVVAIINSGIKALPHIFNACVLMFVFSACNSDL 401
           L+G  V +++  L             PYV+A     ++ +PHI NA +L+ V S  NS L
Sbjct: 337 LIGFNVPHNNDQLMGSGSAATHAS--PYVLAASIHKVRVIPHIINAVILISVISVANSAL 394

Query: 402 YVASRTLYGLAIDNKAPKIFAVTNRWGVPYYSLLMSSCFCLLAYMSVSSGSAKIFNYFVN 461
           Y A R +  LA    AP+     +R G P  +L + +   ++ +++ S    + F +   
Sbjct: 395 YAAPRLMCSLAQQGYAPRFLNYIDREGRPLRALAVCALVGVVGFVACSPQEEQAFTWLAA 454

Query: 462 VVSIFGLLSWISILITYLCFFRAVKAQNVDRSRFAYRAPFQPYGSYFTLAFCILIAFIKN 521
           +  +  + +W  I+++++ F +A+K Q        Y+A    +GSY+ + F IL+ F+  
Sbjct: 455 IAGLSEIFTWSGIMLSHIRFRKAMKVQGRSLGELGYKANTGIWGSYYGVFFNILV-FMAQ 513

Query: 522 FTVFLN-----HHFDYKNFITGYIGIPVFVISYFGYKFVKK--TKIWKPEEVDLYTFKAA 574
           F V L+        D + F  GY+  P+++  Y GY    K  T +   +++DL   +  
Sbjct: 514 FWVALSPIGNGGKCDVQAFFEGYLAAPLWIFMYLGYMLYNKDFTLLNPLDKIDLDFHRRV 573

Query: 575 IDEEEEQGKIADAERRERLKNSK 597
            D E  + +  D E +E+L+NS 
Sbjct: 574 YDPEIMRQE--DEENKEKLRNSS 594

>NCAS0A00420 Chr1 complement(62649..64688) [2040 bp, 679 aa] {ON}
           Anc_1.50
          Length = 679

 Score =  232 bits (591), Expect = 8e-67,   Method: Compositional matrix adjust.
 Identities = 165/546 (30%), Positives = 271/546 (49%), Gaps = 39/546 (7%)

Query: 64  SRLEDSEKQDDYMDDGKDEHTRLRKDLKARHISMIAXXXXXXXXXXXXXXXXXYTAGPMS 123
           +++ D+ K D+           L+K +K RH+ MI+                   AGP  
Sbjct: 147 AQINDNSKSDE-----------LKKTIKPRHVLMISLGTGIGTGLLVGLGSSLVQAGPAG 195

Query: 124 MFIAYAFVGVLVFFTMAALGEMA-SYIPL-DGFTSYASRYCDPALGFAVGYAYLCKYLIL 181
           + I +  +G  ++  + A+GE+A +Y  L  GF +Y S   D A  FAV + Y  ++L +
Sbjct: 196 LIIGFGIMGSCLYCIIQAVGELAVAYSDLVGGFNAYPSFLVDEAFCFAVAWLYAIQWLCV 255

Query: 182 PPNQLTAAALVIQYWLDREQVNPGVWITIFLVIIVAMNFIG-VKFFGEFEFWLSTFKVIV 240
            P +L  A++ I+YW  +  V+P +++ IF ++I+ +N +G    + E EF  ++ K+++
Sbjct: 256 CPLELVTASMTIKYWTTK--VDPDIFVIIFYILIIGINLLGGAAGYAEAEFIFNSCKIMM 313

Query: 241 MIGLIILLFVIMLGGGPTHDRLGFRFYDHPGAFKPYSKSIDGSKGKXXXXXXXXXXXXXX 300
           MIG  IL   ++ GG  T   +G +++  PGA +    SI   KG               
Sbjct: 314 MIGFFILGITVICGGAGTDGYIGAKYWHDPGALRG-DTSIQRFKGCMATLVNAAFAFGMS 372

Query: 301 XXGIELTGIVAAEAANPRKSIPKAIKLTMYRIIVFYLVTIFLLGMCVAYD-DPLLXXXXX 359
               E  G+ A+E +NPRK+IP A K  +YRI+  +L +I ++G  V Y+ D LL     
Sbjct: 373 ----EFIGVTASEQSNPRKAIPSAAKKMIYRILCMFLSSITIVGFLVPYNSDQLLGSTGS 428

Query: 360 XXXXXXXXPYVVAIINSGIKALPHIFNACVLMFVFSACNSDLYVASRTLYGLAIDNKAPK 419
                   PYV+AI   G++ +PH  NA +L+ V S  NS  Y +SR L  LA    APK
Sbjct: 429 GVKAS---PYVLAISTHGVRVVPHFINAVILISVLSVANSAYYSSSRMLLSLAEQGYAPK 485

Query: 420 IFAVTNRWGVPYYSLLMSSCFCLLAYMSVSSGSAKIFNYFVNVVSIFGLLSWISILITYL 479
           I++  +R G P   +  ++ F ++A+ + S    ++F + + +  +  L +W++I I+++
Sbjct: 486 IYSYIDREGRPLVGMATAAIFGVIAFCATSPKEDEVFVWLLAISGLSQLFTWMAICISHI 545

Query: 480 CFFRAVKAQNVDRSRFAYRAPFQPYGSYFT--LAFCILIAFIKNFTVFLNH----HFDYK 533
            F RA+  Q        +R+    YGS +   + F ILIA      V +N       D K
Sbjct: 546 RFRRAMHVQGRSIGELGFRSQVGWYGSAYAAIMMFMILIAQFWVALVPINADLTIKLDAK 605

Query: 534 NFITGYIGIPVFVISYFGYKFVKKTKIWK----PEEVDLYTFKAAIDEEEEQGKIADAER 589
           NF   Y+ +P+ +  YFGYK  KK   WK     + +DL + +   D  EE  K  + E 
Sbjct: 606 NFFENYLAMPILLAFYFGYKIWKKD--WKLFIRAKNIDLISHRNIFD--EELIKQEEDEY 661

Query: 590 RERLKN 595
           RERL+ 
Sbjct: 662 RERLRT 667

>KNAG0C00590 Chr3 complement(100801..102705) [1905 bp, 634 aa] {ON}
           Anc_1.50 YDR508C
          Length = 634

 Score =  231 bits (588), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 155/532 (29%), Positives = 268/532 (50%), Gaps = 23/532 (4%)

Query: 55  DMDNLSTVSSRLEDSEKQDDYMDDGKDEHTRLRKDLKARHISMIAXXXXXXXXXXXXXXX 114
           DM+ +   S  +E  +K     D+G D   +L+K ++ RH+ +I+               
Sbjct: 91  DMELVGVTSETIEQHKK-----DEG-DTGDKLKKTIQPRHVILISLGTGIGTGLLVGNGA 144

Query: 115 XXYTAGPMSMFIAYAFVGVLVFFTMAALGEMA-SYIPL-DGFTSYASRYCDPALGFAVGY 172
               AGP  + I Y  +G L++  + A GEMA +Y+ L  GF +Y +   DP   FA  +
Sbjct: 145 TLAQAGPAGLVIGYGIMGSLIYCIIQACGEMAVNYLTLVGGFNAYPTFLIDPGFSFATAW 204

Query: 173 AYLCKYLILPPNQLTAAALVIQYWLDREQVNPGVWITIFLVIIVAMNFIG-VKFFGEFEF 231
            Y  ++L + P +L  A++ I+YW  +  V+P V++ IF V I+ +N +G  + + E EF
Sbjct: 205 VYCLQWLCVCPLELVTASMTIKYWTTK--VDPDVFVIIFYVFILGINILGGARGYAEAEF 262

Query: 232 WLSTFKVIVMIGLIILLFVIMLGGGPTHDRLGFRFYDHPGAFKPYSKSIDGSKGKXXXXX 291
             ++ K+++MIG  IL  +I+ GG  T   +G R++  PGAF+   +++D  KG      
Sbjct: 263 IFNSCKILMMIGFFILGIIIICGGAGTDGYIGGRYWHDPGAFRG-ERAVDRFKGVVATLV 321

Query: 292 XXXXXXXXXXXGIELTGIVAAEAANPRKSIPKAIKLTMYRIIVFYLVTIFLLGMCVAYDD 351
                        E   + A+E +NPR++IP A K  +YR +  YL +I LLG  V Y+ 
Sbjct: 322 TAAFSFGQS----EFIAVTASEQSNPRRAIPSAAKKIIYRALCIYLASIILLGFLVPYNS 377

Query: 352 PLLXXXXXXXXXXXXXPYVVAIINSGIKALPHIFNACVLMFVFSACNSDLYVASRTLYGL 411
             L             PYV+A+ N G++ +PH  NA +++ V S  NS  Y + R L  L
Sbjct: 378 SQLLGAQSNGIKAS--PYVLAVANHGVRVVPHFINAVIIISVLSVSNSAFYSSPRMLLTL 435

Query: 412 AIDNKAPKIFAVTNRWGVPYYSLLMSSCFCLLAYMSVSSGSAKIFNYFVNVVSIFGLLSW 471
           +    APKIF+  +R G P   ++++S F ++A+ + S    ++F + + V  +  + +W
Sbjct: 436 SQQGFAPKIFSYVDRAGRPTMGIIVASLFAVIAFCATSPKEDQVFTWLLAVSGLSQIFTW 495

Query: 472 ISILITYLCFFRAVKAQNVDRSRFAYRAPFQPYG---SYFTLAFCILIAFIKNFTVFLNH 528
           +SI +++L F RA+  Q        + +    YG   S+F LA  ++  F        + 
Sbjct: 496 MSICLSHLRFRRAMTVQGRSLGECGFLSQVGIYGSAYSFFVLALILVGQFWVALKPVGSK 555

Query: 529 HFDYKNFITGYIGIPVFVISYFGYK-FVKKTKIW-KPEEVDLYTFKAAIDEE 578
             D  +F   Y+  P+++  Y GYK + K  +++ K +++DL   +   DE+
Sbjct: 556 KVDANSFFENYLAAPIWIALYIGYKCYTKDWRLYIKSQDIDLVAHRQIYDED 607

>CAGL0C00539g Chr3 (57175..57177,57724..59502) [1782 bp, 593 aa]
           {ON} highly similar to uniprot|P38090 Saccharomyces
           cerevisiae YBR132c AGP2 amino-acid permease
          Length = 593

 Score =  229 bits (585), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 153/531 (28%), Positives = 255/531 (48%), Gaps = 18/531 (3%)

Query: 61  TVSSRLEDSEKQDDYMDDGKDEHTRLRKDLKARHISMIAXXXXXXXXXXXXXXXXXYTAG 120
           T S   ++ E+  +       E T   + L  RH+  IA                 Y  G
Sbjct: 53  TRSISFDEDERSSNDSRTQLIESTSTHRKLLNRHVQFIAISGVIGTALFVAIGKPLYRGG 112

Query: 121 PMSMFIAYAFVGVLVFFTMAALGEMASYIPLDG-FTSYASRYCDPALGFAVGYAYLCKYL 179
           P ++ +A+A   + +     +  EM S++P+   F   A +  D +LG    + +     
Sbjct: 113 PANLLLAFALWCIPILCITVSTAEMVSFMPVSSPFLRLAKKCVDESLGVTASWNFWFLEC 172

Query: 180 ILPPNQLTAAALVIQYWLDREQVNPGVWITIFLVIIVAMNFIGVKFFGEFEFWLSTFKVI 239
           +  P ++ +   +I YW  R+  +P + + I +V+ V ++   VK++GE EFWL++FK+I
Sbjct: 173 VQIPYEIVSVNTIIHYW--RDDYSPAIPLVIQVVLYVLISVCAVKYYGEMEFWLASFKII 230

Query: 240 VMIGLIILLFVIMLGGGPTHDRLGFRFYDHPGAFKPY----SKSIDGSKGKXXXXXXXXX 295
           + +GL    F+ MLGG P HDR GFR+Y     FK Y    ++    S G          
Sbjct: 231 LAVGLFCFTFITMLGGNPKHDRYGFRYYGE-SPFKKYFPDGNEGAGKSAGYFQGFLTCLI 289

Query: 296 XXXXXXXGIELTGIVAAEAANPRKSIPKAIKLTMYRIIVFYLVTIFLLGM-CVAYDDPLL 354
                  G E   ++A E   PRK +PKA K    R+ V +L +   +G+ C   D  L 
Sbjct: 290 QAAFTIAGGEYISMLAGEVKLPRKVLPKAFKQVFVRLTVIFLGSCLCVGIVCSPNDSALT 349

Query: 355 XXXXXXXXXXXXXPYVVAIINSGIKALPHIFNACVLMFVFSACNSDLYVASRTLYGLAID 414
                        PYV+A+ N  I+ LP I N  ++   FSA N+  Y +SRTLYG+A+D
Sbjct: 350 AAINEARPGAGSSPYVIAMNNLQIRVLPDIVNIALITAAFSAGNAYTYCSSRTLYGMALD 409

Query: 415 NKAPKIFAVTNRWGVPYYSLLMSSCFCLLAYMSVSSGSAKIFNYFVNVVSIFGLLSWISI 474
             APKIF   N++GVP Y++ +S C+ LL+ + ++S SA + N+ +N+++   L++++ +
Sbjct: 410 GYAPKIFTKCNKYGVPIYAVGVSLCWALLSLLQLNSNSAVVLNWLINLITASQLINFVFL 469

Query: 475 LITYLCFFRAVKAQNVDRSRFAYRAPFQPYGSYFTLAFCILIAFIKNFTVFLNHHFDYKN 534
            + YL F RA   Q        +++ +QPY     L   +++  ++ +TVF    ++ ++
Sbjct: 470 CVIYLFFRRAYMTQKERLPELPFKSWWQPYTVIVGLVSVLIMILLQGYTVFFPKLWNGRD 529

Query: 535 FITGY------IGIPVFVISYFGYKFVKKTKIWKPEEVDLYTFKAAIDEEE 579
           FI  Y      IGI VF   +  YK   K  +  P  +D       I++ E
Sbjct: 530 FIFCYLMVFLDIGIYVFT-KFIWYK--GKDPVKSPNSIDFVPELKEIEQHE 577

>KLLA0C15873g Chr3 (1381699..1383405) [1707 bp, 568 aa] {ON} similar
           to uniprot|P38090 Saccharomyces cerevisiae YBR132C AGP2
           Plasma membrane carnitine transporter expression is
           down-regulated by osmotic stress also functions as a
           low-affinity amino acid permease
          Length = 568

 Score =  229 bits (583), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 144/525 (27%), Positives = 261/525 (49%), Gaps = 15/525 (2%)

Query: 66  LEDSEKQDDYMDDGKDE-HTRLRKDLKARHISMIAXXXXXXXXXXXXXXXXXYTAGPMSM 124
           +++SE+     DD     +    + L+ RH+ +I                  Y  GP+S+
Sbjct: 32  VQESEEIVISSDDNSSYFNNSTSRKLQNRHVQLIGISGVIGTALFVSIGKALYRGGPVSL 91

Query: 125 FIAYAFVGVLVFFTMAALGEMASYIPLDG-FTSYASRYCDPALGFAVGYAYLCKYLILPP 183
            + ++   + +     +  EM  Y+P+   F   A R C+ +L    G+ +     +  P
Sbjct: 92  ILGFSLWCIPILCITVSTAEMVCYLPISSPFLRMAKRCCNDSLAVTAGWNFWFLECVQIP 151

Query: 184 NQLTAAALVIQYWLDREQVNPGVWITIFLVIIVAMNFIGVKFFGEFEFWLSTFKVIVMIG 243
            ++ A   ++ YW  R+  +P + + + +++ + ++   V+ +GE E +L++FK+++ IG
Sbjct: 152 FEIVAVNTILHYW--RDDFSPAIPLCVQVLLYIGISLFAVRCYGETEAFLASFKILLAIG 209

Query: 244 LIILLFVIMLGGGPTHDRLGFRFYDHPGAFKPYSKSIDGSK--GKXXXXXXXXXXXXXXX 301
           L +  F+ MLGG P HDR GFR Y     FK Y  + +GS   G                
Sbjct: 210 LFLFTFITMLGGNPKHDRYGFR-YITDTKFKQYFPNNEGSSSMGYFQGFLACVIQASFTI 268

Query: 302 XGIELTGIVAAEAANPRKSIPKAIKLTMYRIIVFYLVTIFLLGMCVAYDDP-LLXXXXXX 360
            G +   ++A E   PRK +P A K    R+ V +L     +G+  + +DP L       
Sbjct: 269 AGPDYVAMIAGECKLPRKVLPVAFKQVFIRLTVLFLGGCLCVGIVCSSNDPNLTAVINNP 328

Query: 361 XXXXXXXPYVVAIINSGIKALPHIFNACVLMFVFSACNSDLYVASRTLYGLAIDNKAPKI 420
                  PYV+A+ N GIK LP + NA ++   FSA N+  Y +SRTLYGL++D  APK+
Sbjct: 329 RPGAGSSPYVIAMNNLGIKVLPDVVNAALVTAAFSAGNAYTYCSSRTLYGLSLDGYAPKL 388

Query: 421 FAVTNRWGVPYYSLLMSSCFCLLAYMSVSSGSAKIFNYFVNVVSIFGLLSWISILITYLC 480
           F    + GVP  ++L+S  +  ++ + + S SA + N+ +N+++   L+++  + + YL 
Sbjct: 389 FQYCTKSGVPINAVLVSLAWAFISLLQLGSNSAVVLNWLINLITASQLINFSILCVIYLS 448

Query: 481 FFRAVKAQNV--DRSRFAYRAPFQPYGSYFTLAFCILIAFIKNFTVFLNHHFDYKNFITG 538
           F RA   Q+   +     +++  QPY +Y  L    L+  ++ +TVFL+  ++ ++F+  
Sbjct: 449 FRRAYIKQHPSGELPELPFKSWGQPYTAYCGLFAVTLMIGVQGYTVFLHGSWEVQSFLFC 508

Query: 539 Y----IGIPVFVISYFGYKFVKKTKIWKPEEVDLYTFKAAIDEEE 579
           Y    I + +F++ +F YK  +   + KPE+ DL T    ++E E
Sbjct: 509 YLMVFIDLGIFLLCFFVYKRTRDPWV-KPEDADLLTGMDEVEEHE 552

>KAFR0K01360 Chr11 complement(279140..280888) [1749 bp, 582 aa] {ON}
           Anc_3.397 YBR132C
          Length = 582

 Score =  228 bits (581), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 154/550 (28%), Positives = 267/550 (48%), Gaps = 27/550 (4%)

Query: 46  DKKDGLDINDMDNLSTVSSRLEDSEKQDDYMDDGKDEHTRLRKDLKARHISMIAXXXXXX 105
           D  D +D N+  + S +SS       +D   +      T   + L  RH+  IA      
Sbjct: 31  DWSDQIDTNETLSTSDLSS------GKDSSTNLLGSRSTSTHRKLLNRHVQFIAISGVIG 84

Query: 106 XXXXXXXXXXXYTAGPMSMFIAYAFVGVLVFFTMAALGEMASYIPLDG-FTSYASRYCDP 164
                      Y  GP  + IA+A   + +     +  EM S+ P+D  F   + + CD 
Sbjct: 85  TALFVAIGKPLYRGGPAFLLIAFALWCIPILCITVSTAEMVSFFPVDSPFLRLSKKCCDE 144

Query: 165 ALGFAVGYAYLCKYLILPPNQLTAAALVIQYWLDREQVNPGVWITIFLVIIVAMNFIGVK 224
           +L     + +     +  P ++ +   VI YW  R+  +P + + I + +   ++   VK
Sbjct: 145 SLAVMASWNFWFLECVQIPFEIVSVNTVINYW--RDDYSPAIPLVIQVALYALISVCAVK 202

Query: 225 FFGEFEFWLSTFKVIVMIGLIILLFVIMLGGGPTHDRLGFRFYDHPGAFKPY----SKSI 280
           ++GE EFW+S+FK+++ +GL    F+ M+GG P H   GF+ Y     FK Y    +++I
Sbjct: 203 YYGEMEFWMSSFKILLALGLFCFTFITMVGGNPKHKAYGFQNY-RKNTFKKYFPDGNENI 261

Query: 281 DGSKGKXXXXXXXXXXXXXXXXGIELTGIVAAEAANPRKSIPKAIKLTMYRIIVFYLVTI 340
             + G                 G E   ++A E   PRK +P+A K   +R+ V +L + 
Sbjct: 262 GSAAGYFQGFLACLIQASFTIAGGEYISMLAGEVKLPRKVMPRAFKQVFWRLTVLFLGSC 321

Query: 341 FLLGMCVAYDDP-LLXXXXXXXXXXXXXPYVVAIINSGIKALPHIFNACVLMFVFSACNS 399
             +G+  + +DP L              PYV+A+ N GIK LP + NA ++   FSA N+
Sbjct: 322 LCVGIVCSANDPNLTAAISESRPGAGSSPYVIAMNNLGIKILPDVVNAALITAAFSAGNA 381

Query: 400 DLYVASRTLYGLAIDNKAPKIFAVTNRWGVPYYSLLMSSCFCLLAYMSVSSGSAKIFNYF 459
             Y +SRTL+G+A+D  APK  AV N+ GVP YS+ +S  + LL+ + ++S SA + N+ 
Sbjct: 382 YTYCSSRTLHGMALDGYAPKFLAVCNKQGVPIYSVAISLIWALLSLLQLNSNSAVVLNWL 441

Query: 460 VNVVSIFGLLSWISILITYLCFFRAVKAQNVDRSRFAYRAPFQPYGSYFTLAFCILIAFI 519
           +N+++   L+++  I ITYL F RA   Q        +++  QPY + F L   +++  +
Sbjct: 442 INIITASQLINFACICITYLFFRRAYLLQRDTLPDLPFKSWGQPYTAIFGLVCVLMMIIV 501

Query: 520 KNFTVFLNHHFDYKNFITGYIGIPVFVISYFGYKFV---------KKTKI-WKPE--EVD 567
           + +TVF    ++ ++F+  Y+ + +    Y  YKF+            KI ++PE  E++
Sbjct: 502 QGYTVFFPKLWNVQDFLFYYLMVFIDAAIYLSYKFIWTRGSDSFKDPLKINFEPELKEIE 561

Query: 568 LYTFKAAIDE 577
           ++  K + D+
Sbjct: 562 MHELKHSFDK 571

>NCAS0J00140 Chr10 complement(8478..10154) [1677 bp, 558 aa] {ON} 
          Length = 558

 Score =  228 bits (580), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 164/561 (29%), Positives = 270/561 (48%), Gaps = 29/561 (5%)

Query: 46  DKKDGLDINDMDNLSTVSSRLEDSEKQDDYMDDGKDEHTRLRKDLKARHISMIAXXXXXX 105
           D   GL+     N   V   L+ S   ++  D   +    L++ LK RHI+MI+      
Sbjct: 16  DYYKGLNTPPKKN--EVVVELDPSLTTEEDYDPEANIREDLQRALKPRHINMISIAGVIG 73

Query: 106 XXXXXXXXXXXYTAGPMSMFIAYAFVGVLVFFTMAALGEMASYIPLDG-FTSYASRYCDP 164
                      Y  GP S+F+ Y  +G +V+ T+  LGEM++Y+P+ G F SYA ++   
Sbjct: 74  TGLYLSTAKSLYQGGPASLFMNYTIMGGVVYLTLLCLGEMSTYMPISGSFCSYAKKFGSE 133

Query: 165 ALGFAVGYAYLCKYLILPPNQLTAAALVIQYWLDREQVNPGVWIT--IFLVIIVAMNFIG 222
           +   A+ + Y     +   + +TA  LV+ YW D E      W    +F  ++V +N I 
Sbjct: 134 SFACALMWNYWFNDAVSVASDMTALQLVMDYW-DTEASGFPYWAASLLFWFLVVLLNVIH 192

Query: 223 VKFFGEFEFWLSTFKVIVMIGLIILLFVIMLGGGPTHDRLGFRFYDHPGAFKPYSKSIDG 282
           V+F+GE E+WL+  KVI +I   IL  V+ +G  P H+ +GF+ ++H  A  P+   +DG
Sbjct: 193 VRFYGEAEYWLAMLKVIAIIIFFILSIVVNVGHNPQHEYIGFKNWNHGEA--PF---VDG 247

Query: 283 SKGKXXXXXXXXXXXXXXXXGIELTGIVAAEAANPRKSIPKAIKLTMYRIIVFYLVTIFL 342
            KG                 G E   +   EAANP ++ PK +K   +RI+VFY+ + F 
Sbjct: 248 FKG----FASLFVSASFAYGGTESITLTNGEAANPLRNTPKIVKTVFWRILVFYVGSTFF 303

Query: 343 LGMCVAYDDPLLXXXXXXXXXXXXXPYVVAIINSGIKALPHIFNACVLMFVFSACNSDLY 402
           + M + YD P L             P+ +    +G KA     NA ++  V SACN  L+
Sbjct: 304 IAMNIPYDYPGL-----DTKSVVTSPFTLVFQMAGTKAAGSFMNAVIMTSVISACNHALF 358

Query: 403 VASRTLYGLAIDNKAP-KIFAVTNRWGVPYYSLLMSSCFCLLAYMSVSSGSAKIFNYFVN 461
             SR +Y + ++   P KI + TNR+ VPY S+L++S   LL + +   G+  ++ +  N
Sbjct: 359 AGSRVMYNMGLEGFLPKKIVSRTNRYKVPYVSVLITSSIGLLCFGASFIGAGTVWTWLQN 418

Query: 462 VVSIFGLLSWISILITYLCFFRAVKAQNVDRSRFAYRAPFQPYGSYFTLAFCILIAFIKN 521
           +V +   ++W+ I IT + F + ++ Q        Y+    PYG YF + F   I  ++ 
Sbjct: 419 IVGVSNQIAWLCIGITSIRFRKGLEKQG-KTHELRYKNWTYPYGPYFLVIFVTFIILVQG 477

Query: 522 FTVFLNHHFDYKNFITGYIGIPVFVISYFGYKFVKKTKIWKPEEVDLYTFKAAIDEEEEQ 581
           ++ F    +D  NF + Y+ + VF   +  +   K+ +  K E++D  T +    +E   
Sbjct: 478 WSAF--DPWDVTNFFSYYLDLFVFPFCFIIWWLYKRDRFVKLEDMDFVTDRYIPTKE--- 532

Query: 582 GKIADAERRERLKNSK-TKGW 601
             I   E  + LK  K T+ W
Sbjct: 533 -IIELNENLDHLKGWKRTRQW 552

>TBLA0C02520 Chr3 (595918..597660) [1743 bp, 580 aa] {ON} Anc_3.397
           YBR132C
          Length = 580

 Score =  228 bits (581), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 153/534 (28%), Positives = 264/534 (49%), Gaps = 16/534 (2%)

Query: 57  DNLSTVSSRLEDSEKQDDYMDDGKDEHTRLRKDLKARHISMIAXXXXXXXXXXXXXXXXX 116
           D+ S+ +S+   S  +  + D      T+  ++LK RH+  IA                 
Sbjct: 35  DDNSSTTSKCCWSSSESIHSDTTLIPTTK--RNLKNRHVQFIAISGVIGTALFVTIGKPL 92

Query: 117 YTAGPMSMFIAYAFVGVLVFFTMAALGEMASYIPLDG-FTSYASRYCDPALGFAVGYAYL 175
           Y  GP+S+ +A+    + +F    +  EM  + P+   F   A++  D +L F   + + 
Sbjct: 93  YKGGPVSLILAFILWCIPIFAITVSTAEMVCFYPVSSPFLRLANKCVDESLAFMASWNFW 152

Query: 176 CKYLILPPNQLTAAALVIQYWLDREQVNPGVWITIFLVIIVAMNFIGVKFFGEFEFWLST 235
               +  P ++ +   +I YW      +P + + + +V+   ++   VK++GE EFWLS+
Sbjct: 153 FLECVQIPFEIVSVNTMIHYW--TTNYSPAIPLVVQVVLYFIISITAVKYYGELEFWLSS 210

Query: 236 FKVIVMIGLIILLFVIMLGGGPTHDRLGFRFYDHPGAFKPYSKSID---GSKGKXXXXXX 292
           FK+I+ IGL +   + M GG P  D  GFR Y     FK Y  S +    S G       
Sbjct: 211 FKIILAIGLFLFTLITMCGGNPERDHFGFRNYK-VEPFKQYFPSGNHSPASLGYFQGFLN 269

Query: 293 XXXXXXXXXXGIELTGIVAAEAANPRKSIPKAIKLTMYRIIVFYLVTIFLLGMCVAYDDP 352
                     G E   ++A E   PRK +PKA K   YR+   ++ +   +G+  + +DP
Sbjct: 270 CLIQAAFTIAGGEYISMLAGEVHLPRKVLPKAFKQVFYRLTFIFIGSCLCVGIICSPNDP 329

Query: 353 -LLXXXXXXXXXXXXXPYVVAIINSGIKALPHIFNACVLMFVFSACNSDLYVASRTLYGL 411
            L              PYV+A+ N  I+ LPHI N  ++   FSA N+  Y +SRTLYG+
Sbjct: 330 DLTAAISESRPGAGSSPYVIAMNNLKIRILPHIVNVALITAAFSAGNAYTYCSSRTLYGM 389

Query: 412 AIDNKAPKIFAVTNRWGVPYYSLLMSSCFCLLAYMSVSSGSAKIFNYFVNVVSIFGLLSW 471
           A+D  APKIF+  N++GVP YS+++S  + LL+ + ++S SA + N+ VN+++   L+++
Sbjct: 390 ALDGYAPKIFSRCNKYGVPIYSVVISLLWALLSLLQLNSNSAVVLNWLVNLITASQLINF 449

Query: 472 ISILITYLCFFRAVKAQNVDRSRFAYRAPFQPYGSYFTLAFCILIAFIKNFTVFLNHHFD 531
             I ITYL F ++ +AQ+ D     +++ FQPY + F LA  +++  ++ +T  +   + 
Sbjct: 450 SVICITYLFFRKSYRAQSNDLPSLPFKSWFQPYTAIFGLACAVIMIGVQGYTTLIPSIWS 509

Query: 532 YKNFITGYIGIPVFVISYFGYKF------VKKTKIWKPEEVDLYTFKAAIDEEE 579
            +NF+  Y+ + + +I YF +KF       K      P +++       I+  E
Sbjct: 510 VQNFLFCYLMVFLNLIFYFVHKFGWTYYKTKSLSFRNPTQINFKNDLMVIENHE 563

>Skud_2.192 Chr2 complement(344951..346810) [1860 bp, 619 aa] {ON}
           YBR069C (REAL)
          Length = 619

 Score =  229 bits (583), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 145/509 (28%), Positives = 248/509 (48%), Gaps = 24/509 (4%)

Query: 73  DDYMDDGKDEHTRLRKDLKARHISMIAXXXXXXXXXXXXXXXXXYTAGPMSMFIAYAFVG 132
           D   +    E   LRK +K+RH+ MI+                  TAGP  + + Y    
Sbjct: 77  DQNSELESQEKNNLRKSIKSRHLVMISLGTGIGTGLLVGNGQVLGTAGPAGLVLGYGIAS 136

Query: 133 VLVFFTMAALGEMA-SYIPLDG-FTSYASRYCDPALGFAVGYAYLCKYLILPPNQLTAAA 190
           ++++  + A GE+   Y  L G +T Y+S   DP+LGFAV   Y  ++L + P QL  AA
Sbjct: 137 IMLYCIIQAAGELGLCYAGLTGNYTRYSSILVDPSLGFAVSVVYTIQWLTVLPLQLVTAA 196

Query: 191 LVIQYWLDREQVNPGVWITIFLVIIVAMNFIGVKFFGEFEFWLSTFKVIVMIGLIILLFV 250
           + ++YW +   VN  +++ +  + ++ +N  G + + E EF  +  K++++ G +IL  V
Sbjct: 197 MTVKYWTN---VNADIFVAVVFIFVIIINLFGSRGYAEAEFIFNICKILMVAGFVILAIV 253

Query: 251 IMLGGGPTHDRLGFRFYDHPGAFKPYSKSIDGSKGKXXXXXXXXXXXXXXXXGIELTGIV 310
           I  GG      +G  ++ +PG F        G KG                 GIE+  + 
Sbjct: 254 INCGGAGDRRYIGTEYWHNPGPFA------HGFKG----VCTVFCYAAFSYGGIEVLLLS 303

Query: 311 AAEAANPRKSIPKAIKLTMYRIIVFYLVTIFLLGMCVAYD-DPLLXXXXXXXXXXXXXPY 369
           AAE  NP +SIP A K  +YRI++ Y++T  L+G  V Y+ D LL             P+
Sbjct: 304 AAEQENPTESIPNACKKVVYRILLIYMLTTILIGFLVPYNSDELLGSGSSSGSHAS--PF 361

Query: 370 VVAIINSGIKALPHIFNACVLMFVFSACNSDLYVASRTLYGLAIDNKAPKIFAVTNRWGV 429
           V+A+ + G+K +PH  NA +L+ V S  NS LY   R L  LA     PK  A  +R G 
Sbjct: 362 VIAVSSHGVKVVPHFINAVILISVISVANSSLYSGPRLLLSLAEQGVLPKCLAYVDRNGR 421

Query: 430 PYYSLLMSSCFCLLAYMSVSSGSAKIFNYFVNVVSIFGLLSWISILITYLCFFRAVKAQN 489
           P    L+S  F  + +++ S+   ++F + + + S+  L  W+S+ ++++ F  A+  Q 
Sbjct: 422 PLLCFLVSLAFGCIGFVATSNAEEQVFTWLLAISSLSQLFIWMSMCLSHIRFRDAMAKQG 481

Query: 490 VDRSRFAYRAPFQPYGSYFTLAFCILIAFIKNFTVF--LNHH--FDYKNFITGYIGIPVF 545
                  Y+A    +GS+  +   +     + +     ++ H   D K F   Y+ +P+ 
Sbjct: 482 RSMDEVGYKAQTGYWGSWIAVLIAVFFLVCQFWVAIAPVSEHGKLDVKVFFQNYLAMPIV 541

Query: 546 VISYFGYK-FVKKTKIWKP-EEVDLYTFK 572
           +++YFG+K + K  + W P E++DL + +
Sbjct: 542 LLAYFGHKMYFKSWRFWIPAEKIDLDSHR 570

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.327    0.142    0.439 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 55,703,028
Number of extensions: 2173754
Number of successful extensions: 11657
Number of sequences better than 10.0: 377
Number of HSP's gapped: 10087
Number of HSP's successfully gapped: 397
Length of query: 613
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 497
Effective length of database: 40,180,143
Effective search space: 19969531071
Effective search space used: 19969531071
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 69 (31.2 bits)