Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
CAGL0A01133g6.5ON80180138540.0
NDAI0I027306.5ON83275623970.0
TDEL0G046606.5ON73968323690.0
NCAS0D022106.5ON77369223460.0
YPL270W (MDL2)6.5ON77359923460.0
Kpol_1045.836.5ON74859823320.0
Suva_16.356.5ON76768423280.0
Smik_6.4786.5ON77359923170.0
Skud_16.76.5ON77359923080.0
ZYRO0F00396g6.5ON73268922920.0
TPHA0J002206.5ON74060422890.0
SAKL0E00748g6.5ON77459622140.0
TBLA0A071906.5ON79459722010.0
KLTH0C11616g6.5ON74059721220.0
KNAG0E028006.5ON74169021160.0
KLLA0D00748g6.5ON78960021180.0
Kwal_56.223296.5ON77659521110.0
Ecym_30076.5ON76961220270.0
ACR022W6.5ON75462920140.0
KAFR0B064806.5ON75161119570.0
NCAS0B087001.67ON71560013561e-176
SAKL0C02244g1.67ON71260913541e-176
Ecym_10721.67ON68359813371e-174
TDEL0C063501.67ON69361113341e-174
NDAI0A005601.67ON71460413351e-173
TPHA0B046201.67ON72060913341e-173
Kpol_2000.791.67ON70760913261e-172
KLLA0C01991g1.67ON70659912971e-168
AFR683C1.67ON67768912921e-167
ZYRO0F17050g1.67ON71460912881e-166
Kwal_33.133081.67ON70660512861e-166
KLTH0F02024g1.67ON73462412841e-166
Skud_12.2531.67ON69260412781e-165
YLR188W (MDL1)1.67ON69560412781e-165
Smik_12.2481.67ON69660912671e-164
Suva_10.2841.67ON69360412541e-162
CAGL0E00385g1.67ON60860412071e-156
TBLA0A053001.67ON70760812001e-153
Kwal_26.94805.20ON7193935151e-54
SAKL0H00968g5.20ON7003935062e-53
YKL209C (STE6)1.527ON12905405134e-53
KLTH0B09482g5.20ON6943974841e-50
KAFR0I025805.20ON7093984832e-50
KNAG0E013205.20ON6953984822e-50
KLLA0A10131g5.20ON7203974789e-50
TPHA0L022705.20ON7113944701e-48
Skud_11.111.527ON12955214771e-48
TDEL0G004305.20ON6963984663e-48
Ecym_56495.20ON6963974645e-48
Suva_13.4915.20ON6934044636e-48
Skud_13.4755.20ON6914034611e-47
YMR301C (ATM1)5.20ON6903904602e-47
Smik_13.5185.20ON6873954558e-47
TDEL0F003401.527ON12575244629e-47
AGL335W5.20ON6913974549e-47
NCAS0D024305.20ON7024004551e-46
Kpol_513.235.20ON7083934551e-46
NDAI0I024405.20ON7304014542e-46
KAFR0E002301.527ON12705134592e-46
Suva_11.111.527ON12905424575e-46
Kpol_1018.1851.527ON12765194565e-46
KNAG0G001901.527ON12755214557e-46
TBLA0C070005.20ON7253954471e-45
CAGL0M13739g5.20ON7273804471e-45
ZYRO0D07106g5.20ON7093974443e-45
SAKL0A10208g1.527ON13104964405e-44
TBLA0B100701.527ON12963314362e-43
CAGL0K00363g1.527ON12274164291e-42
TPHA0O001601.527ON12534104254e-42
ZYRO0G02244g1.527ON12734074229e-42
NDAI0D015401.527ON12934224211e-41
KLLA0B14256g1.527ON12712514201e-41
NCAS0G035101.527ON12885114164e-41
Ecym_36121.527ON13155164148e-41
Smik_11.141.527ON13165334149e-41
AFR432W1.527ON12845074067e-40
TDEL0E056104.52ON15355303952e-38
KLTH0B01100g1.527ON12984253908e-38
Kwal_33.155611.527ON12972413863e-37
Ecym_42658.303ON15055053829e-37
TPHA0C009608.303ON15234953702e-35
NDAI0B006405.10ON14915193622e-34
CAGL0E03982g4.6ON16595303613e-34
YHL035C (VMR1)4.6ON15925113613e-34
NCAS0C059304.6ON16575393604e-34
NDAI0H001904.6ON16825413578e-34
TBLA0G007104.6ON16915403579e-34
NCAS0B034708.303ON15124853524e-33
NDAI0J011508.303ON15174933506e-33
KNAG0E011204.6ON17175393506e-33
Smik_8.64.6ON15855303506e-33
KAFR0B056308.303ON15154983497e-33
CAGL0G00242g5.10ON14775063497e-33
Smik_12.484.52ON15575553498e-33
Suva_7.5775.10ON14785243481e-32
SAKL0H16016g8.303ON14994823462e-32
NCAS0E041605.10ON15065323452e-32
YGR281W (YOR1)5.10ON14775243453e-32
KNAG0I009908.303ON15354953453e-32
KNAG0J027304.52ON15375413444e-32
KNAG0K001705.10ON14425313434e-32
Suva_10.234.6ON16615393426e-32
NCAS0J00160singletonON16545223427e-32
YLL048C (YBT1)4.6ON16615453418e-32
Skud_7.6145.10ON14775353391e-31
Kwal_56.22747na 1ON15385353382e-31
CAGL0E03355g4.52ON15355163372e-31
CAGL0C03289g4.6ON16485233372e-31
SAKL0H00704g5.10ON14395143372e-31
Smik_12.114.6ON16615453373e-31
Smik_16.275.10ON14775173345e-31
KLTH0C09240gna 1ON15465383345e-31
Kpol_1033.288.303ON15314893345e-31
KAFR0L001904.6ON16535253345e-31
Suva_10.594.52ON15615443346e-31
Suva_10.60singletonON9905453326e-31
KAFR0C065105.10ON14575063337e-31
Suva_8.164.6ON15995283338e-31
ZYRO0G22176g4.52ON15704913329e-31
TPHA0K023104.6ON16494923311e-30
AGR047W8.303ON14924763302e-30
Smik_4.3808.303ON15164703283e-30
Skud_4.3958.303ON15164873283e-30
SAKL0H26026g4.6ON16535293283e-30
KAFR0I013004.52ON15365293283e-30
KLTH0H16038g4.6ON16495313265e-30
Suva_2.2978.303ON15164813256e-30
Skud_12.524.52ON15615393256e-30
Kwal_56.238448.303ON14944863257e-30
KLTH0G12716g8.303ON15004923249e-30
Kpol_1060.75.10ON14605043231e-29
Skud_12.224.6ON16615403231e-29
Kwal_26.95325.10ON14714933222e-29
YDR135C (YCF1)8.303ON15154813222e-29
TPHA0A056205.10ON14775153212e-29
TPHA0F001804.6ON16465223212e-29
TDEL0F043008.303ON15144883212e-29
Skud_8.94.6ON15875383202e-29
TDEL0G018504.6ON16425173203e-29
Ecym_84184.6ON16784873193e-29
Kpol_311.34.6ON16575263167e-29
Kwal_34.157704.6ON14365313168e-29
KLLA0E00529g4.6ON16505323169e-29
YKR104WsingletonON3062882961e-28
ZYRO0D06160g8.303ON15254923141e-28
ZYRO0G07612g4.6ON16955313132e-28
Zrou_YGOB_Anc_5.105.10ON9925173094e-28
CAGL0L06402g8.303ON15352753086e-28
KLLA0F20075g8.303ON15164813061e-27
YLL015W (BPT1)4.52ON15595463052e-27
KLLA0D04059g4.52ON15685253042e-27
SAKL0H23958g4.52ON15585442998e-27
KLTH0B09724g5.10ON14865162971e-26
KLLA0C14234g5.10ON14545312962e-26
TBLA0C06400singletonON13775422943e-26
Skud_18.2singletonON15802732934e-26
TPHA0F004104.52ON15705462917e-26
TDEL0G003305.10ON14655112909e-26
KLTH0B00396gsingletonON15072342901e-25
Kpol_YGOB_1041.454.52ON15685312891e-25
Kpol_1041.45singletonOFF15965312882e-25
ACL072C4.6ON16275192882e-25
TBLA0A06840singletonON10582412872e-25
TBLA0A038008.303ON15465542829e-25
TBLA0C071005.10ON14855112811e-24
Smik_11.367na 2ON15955522792e-24
AGL346W5.10ON14004902748e-24
YKR103W (NFT1)na 2ON12182422175e-17
KAFR0A037908.661ON8761991978e-15
Kpol_175.1singletonON13773721971e-14
Ecym_56605.10ON15362131962e-14
YPL147W (PXA1)8.661ON8701971924e-14
Smik_6.3448.661ON8701971899e-14
NDAI0E012408.661ON8971861881e-13
Suva_16.1638.661ON8701971881e-13
ACR128C8.661ON8271901862e-13
KLTH0D10890g8.661ON8301981843e-13
Kwal_26.87308.661ON8311981834e-13
Skud_16.1358.661ON8701971834e-13
ZYRO0F07018g8.661ON8612511835e-13
KLLA0F11484g8.661ON8452051826e-13
TPHA0D011708.661ON9152031801e-12
Kpol_1012.108.661ON8551471701e-11
Ecym_24108.661ON8281901701e-11
TBLA0D043501.427ON11192381692e-11
SAKL0D10208g1.366ON7522361664e-11
KAFR0C045401.366ON7522381655e-11
KNAG0A029808.661ON8712601655e-11
SAKL0F01606g3.534ON6082201646e-11
NDAI0H035701.366ON7552041647e-11
SAKL0H06908g8.661ON8361851647e-11
TDEL0A060708.661ON8721851639e-11
SAKL0H21010gsingletonON14471981649e-11
KNAG0C019601.366ON7522331639e-11
CAGL0K10472g1.366ON7522111631e-10
AEL032W1.366ON7532401631e-10
NCAS0B015308.661ON8681971621e-10
ZYRO0G01144g1.366ON7522341611e-10
TBLA0C012201.366ON7512361602e-10
ZYRO0D11880g5.500ON14982221612e-10
KLTH0H13442g1.366ON7522291602e-10
TBLA0C017808.661ON8881971602e-10
Kwal_27.9666singletonON14742901603e-10
Kpol_1043.431.366ON7522291584e-10
KNAG0B038705.500ON15132181584e-10
ZYRO0E08800g3.534ON6102171574e-10
ZYRO0D17710gsingletonON14862381585e-10
Ecym_11943.534ON6091741565e-10
TPHA0A058903.534ON6101731565e-10
Suva_5.1343.534ON6101731566e-10
KAFR0C052205.500ON14992551576e-10
ZYRO0D11858gna 3ON15032231577e-10
CAGL0C02343g3.534ON7201761567e-10
NCAS0E004803.534ON6101731557e-10
TBLA0I033303.534ON6102331558e-10
Skud_14.404na 4ON14242351569e-10
Kwal_47.191163.534ON6071781541e-09
TBLA0D01820singletonON15512211551e-09
CAGL0M01760gsingletonON14992181541e-09
TPHA0D04700singletonON15102421541e-09
CAGL0M02387g8.661ON8561931541e-09
AGL142CsingletonON14972181541e-09
TBLA0D017805.500ON15952211541e-09
KAFR0E03450na 3ON15532231541e-09
KAFR0C05210na 3ON14932211542e-09
TDEL0D060203.534ON6102291522e-09
YOR328W (PDR10)na 5ON15642361532e-09
KAFR0E03480singletonON15522231532e-09
TDEL0A036405.500ON15092201532e-09
Smik_7.3131.366ON7522321522e-09
YFR009W (GCN20)1.366ON7522321522e-09
YER036C (ARB1)3.534ON6101741512e-09
Ecym_8014na 6ON15172351523e-09
Skud_5.1453.534ON6101741503e-09
Smik_5.1593.534ON6101741503e-09
Kpol_1050.263.534ON6101741503e-09
Suva_8.379na 5ON15652211513e-09
KAFR0E03460na 7ON15462231513e-09
NDAI0I030203.534ON6091731493e-09
ZYRO0D11836gna 7ON14622191504e-09
Smik_15.3335.500ON15102201504e-09
Skud_4.2623.220ON15012381504e-09
KAFR0J027003.534ON6081741494e-09
YDR406W (PDR15)5.500ON15292201504e-09
NCAS0E016303.220ON15652371495e-09
Skud_4.6805.500ON14452201495e-09
Skud_4.681na 3ON14452201495e-09
NCAS0A120605.500ON15432161495e-09
YOR153W (PDR5)5.500ON15112201495e-09
Kwal_0.3271.427ON10192301486e-09
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0A01133g
         (801 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0A01133g Chr1 (112037..114442) [2406 bp, 801 aa] {ON} simila...  1489   0.0  
NDAI0I02730 Chr9 complement(640429..642927) [2499 bp, 832 aa] {O...   927   0.0  
TDEL0G04660 Chr7 (850475..852694) [2220 bp, 739 aa] {ON} Anc_6.5...   917   0.0  
NCAS0D02210 Chr4 (410709..413030) [2322 bp, 773 aa] {ON} Anc_6.5      908   0.0  
YPL270W Chr16 (30482..32803) [2322 bp, 773 aa] {ON}  MDL2Mitocho...   908   0.0  
Kpol_1045.83 s1045 (193070..195316) [2247 bp, 748 aa] {ON} (1930...   902   0.0  
Suva_16.35 Chr16 (46072..48375) [2304 bp, 767 aa] {ON} YPL270W (...   901   0.0  
Smik_6.478 Chr6 complement(788399..790720) [2322 bp, 773 aa] {ON...   897   0.0  
Skud_16.7 Chr16 (9624..11945) [2322 bp, 773 aa] {ON} YPL270W (REAL)   893   0.0  
ZYRO0F00396g Chr6 complement(39330..41528) [2199 bp, 732 aa] {ON...   887   0.0  
TPHA0J00220 Chr10 complement(51873..54095) [2223 bp, 740 aa] {ON...   886   0.0  
SAKL0E00748g Chr5 complement(50683..53007) [2325 bp, 774 aa] {ON...   857   0.0  
TBLA0A07190 Chr1 complement(1792994..1795378) [2385 bp, 794 aa] ...   852   0.0  
KLTH0C11616g Chr3 (956011..958233) [2223 bp, 740 aa] {ON} simila...   822   0.0  
KNAG0E02800 Chr5 (562361..564586) [2226 bp, 741 aa] {ON} Anc_6.5...   819   0.0  
KLLA0D00748g Chr4 complement(69839..72208) [2370 bp, 789 aa] {ON...   820   0.0  
Kwal_56.22329 s56 complement(50448..52778) [2331 bp, 776 aa] {ON...   817   0.0  
Ecym_3007 Chr3 complement(14335..16644) [2310 bp, 769 aa] {ON} s...   785   0.0  
ACR022W Chr3 (395427..397691) [2265 bp, 754 aa] {ON} Syntenic ho...   780   0.0  
KAFR0B06480 Chr2 complement(1344413..1346668) [2256 bp, 751 aa] ...   758   0.0  
NCAS0B08700 Chr2 (1674262..1676409) [2148 bp, 715 aa] {ON} Anc_1...   526   e-176
SAKL0C02244g Chr3 (201281..203419) [2139 bp, 712 aa] {ON} simila...   526   e-176
Ecym_1072 Chr1 (137296..139347) [2052 bp, 683 aa] {ON} similar t...   519   e-174
TDEL0C06350 Chr3 complement(1159576..1161657) [2082 bp, 693 aa] ...   518   e-174
NDAI0A00560 Chr1 complement(100930..103074) [2145 bp, 714 aa] {O...   518   e-173
TPHA0B04620 Chr2 complement(1085725..1087887) [2163 bp, 720 aa] ...   518   e-173
Kpol_2000.79 s2000 complement(175048..177171) [2124 bp, 707 aa] ...   515   e-172
KLLA0C01991g Chr3 (160778..162898) [2121 bp, 706 aa] {ON} simila...   504   e-168
AFR683C Chr6 complement(1697786..1699819) [2034 bp, 677 aa] {ON}...   502   e-167
ZYRO0F17050g Chr6 complement(1417445..1419589) [2145 bp, 714 aa]...   500   e-166
Kwal_33.13308 s33 (166479..168599) [2121 bp, 706 aa] {ON} YLR188...   499   e-166
KLTH0F02024g Chr6 (161423..163627) [2205 bp, 734 aa] {ON} simila...   499   e-166
Skud_12.253 Chr12 (474886..476964) [2079 bp, 692 aa] {ON} YLR188...   496   e-165
YLR188W Chr12 (528300..530387) [2088 bp, 695 aa] {ON}  MDL1Mitoc...   496   e-165
Smik_12.248 Chr12 (475233..477323) [2091 bp, 696 aa] {ON} YLR188...   492   e-164
Suva_10.284 Chr10 (500972..503053) [2082 bp, 693 aa] {ON} YLR188...   487   e-162
CAGL0E00385g Chr5 (31960..33786) [1827 bp, 608 aa] {ON} similar ...   469   e-156
TBLA0A05300 Chr1 (1297764..1299887) [2124 bp, 707 aa] {ON} Anc_1...   466   e-153
Kwal_26.9480 s26 complement(1236178..1238337) [2160 bp, 719 aa] ...   202   1e-54
SAKL0H00968g Chr8 (107767..109869) [2103 bp, 700 aa] {ON} highly...   199   2e-53
YKL209C Chr11 complement(42423..46295) [3873 bp, 1290 aa] {ON}  ...   202   4e-53
KLTH0B09482g Chr2 complement(777282..779366) [2085 bp, 694 aa] {...   191   1e-50
KAFR0I02580 Chr9 complement(520294..522423) [2130 bp, 709 aa] {O...   190   2e-50
KNAG0E01320 Chr5 (261901..263988) [2088 bp, 695 aa] {ON} Anc_5.2...   190   2e-50
KLLA0A10131g Chr1 complement(889688..891850) [2163 bp, 720 aa] {...   188   9e-50
TPHA0L02270 Chr12 complement(473597..475732) [2136 bp, 711 aa] {...   185   1e-48
Skud_11.11 Chr11 complement(25896..29783) [3888 bp, 1295 aa] {ON...   188   1e-48
TDEL0G00430 Chr7 (89431..91521) [2091 bp, 696 aa] {ON} Anc_5.20 ...   184   3e-48
Ecym_5649 Chr5 complement(1310682..1312772) [2091 bp, 696 aa] {O...   183   5e-48
Suva_13.491 Chr13 complement(849300..851381) [2082 bp, 693 aa] {...   182   6e-48
Skud_13.475 Chr13 complement(841033..843108) [2076 bp, 691 aa] {...   182   1e-47
YMR301C Chr13 complement(867555..869627) [2073 bp, 690 aa] {ON} ...   181   2e-47
Smik_13.518 Chr13 complement(850174..852237) [2064 bp, 687 aa] {...   179   8e-47
TDEL0F00340 Chr6 complement(53876..57649) [3774 bp, 1257 aa] {ON...   182   9e-47
AGL335W Chr7 (82640..84715) [2076 bp, 691 aa] {ON} Syntenic homo...   179   9e-47
NCAS0D02430 Chr4 (462683..464791) [2109 bp, 702 aa] {ON} Anc_5.20     179   1e-46
Kpol_513.23 s513 complement(65118..67244) [2127 bp, 708 aa] {ON}...   179   1e-46
NDAI0I02440 Chr9 complement(556154..558346) [2193 bp, 730 aa] {O...   179   2e-46
KAFR0E00230 Chr5 complement(47473..51285) [3813 bp, 1270 aa] {ON...   181   2e-46
Suva_11.11 Chr11 complement(26032..29904) [3873 bp, 1290 aa] {ON...   180   5e-46
Kpol_1018.185 s1018 (464370..468200) [3831 bp, 1276 aa] {ON} (46...   180   5e-46
KNAG0G00190 Chr7 complement(20457..24284) [3828 bp, 1275 aa] {ON...   179   7e-46
TBLA0C07000 Chr3 complement(1688965..1691142) [2178 bp, 725 aa] ...   176   1e-45
CAGL0M13739g Chr13 complement(1347781..1349964) [2184 bp, 727 aa...   176   1e-45
ZYRO0D07106g Chr4 (616125..618254) [2130 bp, 709 aa] {ON} simila...   175   3e-45
SAKL0A10208g Chr1 (894334..898266) [3933 bp, 1310 aa] {ON} simil...   174   5e-44
TBLA0B10070 Chr2 (2422767..2426657) [3891 bp, 1296 aa] {ON} Anc_...   172   2e-43
CAGL0K00363g Chr11 complement(38281..41964) [3684 bp, 1227 aa] {...   169   1e-42
TPHA0O00160 Chr15 complement(16002..19763) [3762 bp, 1253 aa] {O...   168   4e-42
ZYRO0G02244g Chr7 (169369..173190) [3822 bp, 1273 aa] {ON} simil...   167   9e-42
NDAI0D01540 Chr4 (369687..373568) [3882 bp, 1293 aa] {ON} Anc_1....   166   1e-41
KLLA0B14256g Chr2 (1248654..1252469) [3816 bp, 1271 aa] {ON} sim...   166   1e-41
NCAS0G03510 Chr7 (652949..656815) [3867 bp, 1288 aa] {ON} Anc_1....   164   4e-41
Ecym_3612 Chr3 (1167419..1171366) [3948 bp, 1315 aa] {ON} simila...   164   8e-41
Smik_11.14 Chr11 complement(26603..30553) [3951 bp, 1316 aa] {ON...   164   9e-41
AFR432W Chr6 (1213211..1217065) [3855 bp, 1284 aa] {ON} Syntenic...   160   7e-40
TDEL0E05610 Chr5 (1038912..1043519) [4608 bp, 1535 aa] {ON} Anc_...   156   2e-38
KLTH0B01100g Chr2 complement(94260..98156) [3897 bp, 1298 aa] {O...   154   8e-38
Kwal_33.15561 s33 (1157299..1161192) [3894 bp, 1297 aa] {ON} YKL...   153   3e-37
Ecym_4265 Chr4 (560254..564771) [4518 bp, 1505 aa] {ON} similar ...   151   9e-37
TPHA0C00960 Chr3 (204061..208632) [4572 bp, 1523 aa] {ON} Anc_8....   147   2e-35
NDAI0B00640 Chr2 (141258..145733) [4476 bp, 1491 aa] {ON} Anc_5.10    144   2e-34
CAGL0E03982g Chr5 (378442..383421) [4980 bp, 1659 aa] {ON} simil...   143   3e-34
YHL035C Chr8 complement(27978..32756) [4779 bp, 1592 aa] {ON}  V...   143   3e-34
NCAS0C05930 Chr3 (1220180..1225153) [4974 bp, 1657 aa] {ON} Anc_...   143   4e-34
NDAI0H00190 Chr8 complement(20586..25634) [5049 bp, 1682 aa] {ON...   142   8e-34
TBLA0G00710 Chr7 (157927..163002) [5076 bp, 1691 aa] {ON} Anc_4....   142   9e-34
NCAS0B03470 Chr2 complement(606008..610546) [4539 bp, 1512 aa] {...   140   4e-33
NDAI0J01150 Chr10 complement(262920..267473) [4554 bp, 1517 aa] ...   139   6e-33
KNAG0E01120 Chr5 (214592..219745) [5154 bp, 1717 aa] {ON} Anc_4....   139   6e-33
Smik_8.6 Chr8 complement(11717..16474) [4758 bp, 1585 aa] {ON} Y...   139   6e-33
KAFR0B05630 Chr2 complement(1156621..1161168) [4548 bp, 1515 aa]...   139   7e-33
CAGL0G00242g Chr7 complement(20428..24861) [4434 bp, 1477 aa] {O...   139   7e-33
Smik_12.48 Chr12 (103624..108297) [4674 bp, 1557 aa] {ON} YLL015...   139   8e-33
Suva_7.577 Chr7 (1007741..1012177) [4437 bp, 1478 aa] {ON} YGR28...   138   1e-32
SAKL0H16016g Chr8 (1396707..1401206) [4500 bp, 1499 aa] {ON} sim...   137   2e-32
NCAS0E04160 Chr5 (818254..822774) [4521 bp, 1506 aa] {ON} Anc_5.10    137   2e-32
YGR281W Chr7 (1052824..1057257) [4434 bp, 1477 aa] {ON}  YOR1Pla...   137   3e-32
KNAG0I00990 Chr9 (188695..193302) [4608 bp, 1535 aa] {ON} Anc_8....   137   3e-32
KNAG0J02730 Chr10 complement(512373..516986) [4614 bp, 1537 aa] ...   137   4e-32
KNAG0K00170 Chr11 complement(15700..20028) [4329 bp, 1442 aa] {O...   136   4e-32
Suva_10.23 Chr10 complement(44719..49704) [4986 bp, 1661 aa] {ON...   136   6e-32
NCAS0J00160 Chr10 complement(12361..17325) [4965 bp, 1654 aa] {O...   136   7e-32
YLL048C Chr12 complement(41280..46265) [4986 bp, 1661 aa] {ON}  ...   135   8e-32
Skud_7.614 Chr7 (1027230..1031663) [4434 bp, 1477 aa] {ON} YGR28...   135   1e-31
Kwal_56.22747 s56 (262824..267440) [4617 bp, 1538 aa] {ON} YLL01...   134   2e-31
CAGL0E03355g Chr5 complement(307479..312086) [4608 bp, 1535 aa] ...   134   2e-31
CAGL0C03289g Chr3 (328799..333745) [4947 bp, 1648 aa] {ON} simil...   134   2e-31
SAKL0H00704g Chr8 (85322..89641) [4320 bp, 1439 aa] {ON} similar...   134   2e-31
Smik_12.11 Chr12 complement(26055..31040) [4986 bp, 1661 aa] {ON...   134   3e-31
Smik_16.27 Chr16 complement(40287..44720) [4434 bp, 1477 aa] {ON...   133   5e-31
KLTH0C09240g Chr3 complement(766620..771260) [4641 bp, 1546 aa] ...   133   5e-31
Kpol_1033.28 s1033 complement(69924..74519) [4596 bp, 1531 aa] {...   133   5e-31
KAFR0L00190 Chr12 complement(21836..26797) [4962 bp, 1653 aa] {O...   133   5e-31
Suva_10.59 Chr10 (121460..126142) [4683 bp, 1561 aa] {ON} YLL015...   133   6e-31
Suva_10.60 Chr10 (123173..126145) [2973 bp, 990 aa] {ON} YLL015W...   132   6e-31
KAFR0C06510 Chr3 (1306097..1310470) [4374 bp, 1457 aa] {ON} Anc_...   132   7e-31
Suva_8.16 Chr8 complement(29573..34372) [4800 bp, 1599 aa] {ON} ...   132   8e-31
ZYRO0G22176g Chr7 (1822665..1827377) [4713 bp, 1570 aa] {ON} sim...   132   9e-31
TPHA0K02310 Chr11 (497267..502216) [4950 bp, 1649 aa] {ON} Anc_4...   132   1e-30
AGR047W Chr7 (802679..807157) [4479 bp, 1492 aa] {ON} Syntenic h...   131   2e-30
Smik_4.380 Chr4 complement(684148..688698) [4551 bp, 1516 aa] {O...   130   3e-30
Skud_4.395 Chr4 complement(694806..699356) [4551 bp, 1516 aa] {O...   130   3e-30
SAKL0H26026g Chr8 (2287664..2292625) [4962 bp, 1653 aa] {ON} sim...   130   3e-30
KAFR0I01300 Chr9 complement(262852..267462) [4611 bp, 1536 aa] {...   130   3e-30
KLTH0H16038g Chr8 (1376941..1381890) [4950 bp, 1649 aa] {ON} sim...   130   5e-30
Suva_2.297 Chr2 complement(518369..522919) [4551 bp, 1516 aa] {O...   129   6e-30
Skud_12.52 Chr12 (107860..112545) [4686 bp, 1561 aa] {ON} YLL015...   129   6e-30
Kwal_56.23844 s56 complement(733654..738138) [4485 bp, 1494 aa] ...   129   7e-30
KLTH0G12716g Chr7 (1080818..1085320) [4503 bp, 1500 aa] {ON} hig...   129   9e-30
Kpol_1060.7 s1060 complement(13248..17630) [4383 bp, 1460 aa] {O...   129   1e-29
Skud_12.22 Chr12 complement(31933..36918) [4986 bp, 1661 aa] {ON...   129   1e-29
Kwal_26.9532 s26 complement(1256241..1260656) [4416 bp, 1471 aa]...   128   2e-29
YDR135C Chr4 complement(723004..727551) [4548 bp, 1515 aa] {ON} ...   128   2e-29
TPHA0A05620 Chr1 (1273220..1277653) [4434 bp, 1477 aa] {ON} Anc_...   128   2e-29
TPHA0F00180 Chr6 complement(23050..27990) [4941 bp, 1646 aa] {ON...   128   2e-29
TDEL0F04300 Chr6 complement(802866..807410) [4545 bp, 1514 aa] {...   128   2e-29
Skud_8.9 Chr8 complement(16026..20789) [4764 bp, 1587 aa] {ON} Y...   127   2e-29
TDEL0G01850 Chr7 (369839..374767) [4929 bp, 1642 aa] {ON} Anc_4....   127   3e-29
Ecym_8418 Chr8 (874901..879937) [5037 bp, 1678 aa] {ON} similar ...   127   3e-29
Kpol_311.3 s311 (5480..10453) [4974 bp, 1657 aa] {ON} (5480..104...   126   7e-29
Kwal_34.15770 s34 complement(51755..56065) [4311 bp, 1436 aa] {O...   126   8e-29
KLLA0E00529g Chr5 complement(39173..44125) [4953 bp, 1650 aa] {O...   126   9e-29
YKR104W Chr11 (656836..657756) [921 bp, 306 aa] {ON} Putative tr...   118   1e-28
ZYRO0D06160g Chr4 (524435..529012) [4578 bp, 1525 aa] {ON} highl...   125   1e-28
ZYRO0G07612g Chr7 complement(601181..606268) [5088 bp, 1695 aa] ...   125   2e-28
Zrou_YGOB_Anc_5.10 Chr3 complement(92067..95045) [2979 bp, 992 a...   123   4e-28
CAGL0L06402g Chr12 (720723..725330) [4608 bp, 1535 aa] {ON} high...   123   6e-28
KLLA0F20075g Chr6 complement(1868786..1873336) [4551 bp, 1516 aa...   122   1e-27
YLL015W Chr12 (116432..121111) [4680 bp, 1559 aa] {ON}  BPT1ABC ...   122   2e-27
KLLA0D04059g Chr4 complement(338422..343128) [4707 bp, 1568 aa] ...   121   2e-27
SAKL0H23958g Chr8 complement(2062067..2066743) [4677 bp, 1558 aa...   119   8e-27
KLTH0B09724g Chr2 complement(796023..800483) [4461 bp, 1486 aa] ...   119   1e-26
KLLA0C14234g Chr3 (1234598..1238962) [4365 bp, 1454 aa] {ON} sim...   118   2e-26
TBLA0C06400 Chr3 complement(1545011..1549144) [4134 bp, 1377 aa]...   117   3e-26
Skud_18.2 Chr18 (5442..10184) [4743 bp, 1580 aa] {ON} YHL035C (R...   117   4e-26
TPHA0F00410 Chr6 (98503..103215) [4713 bp, 1570 aa] {ON} Anc_4.5...   116   7e-26
TDEL0G00330 Chr7 complement(58587..62984) [4398 bp, 1465 aa] {ON...   116   9e-26
KLTH0B00396g Chr2 complement(38234..42757) [4524 bp, 1507 aa] {O...   116   1e-25
Kpol_YGOB_1041.45 s1041 complement(118923..123629) [4707 bp, 156...   115   1e-25
Kpol_1041.45 s1041 complement(118923..123713) [4791 bp, 1596 aa]...   115   2e-25
ACL072C Chr3 complement(224562..229445) [4884 bp, 1627 aa] {ON} ...   115   2e-25
TBLA0A06840 Chr1 (1666910..1670086) [3177 bp, 1058 aa] {ON} Anc_...   115   2e-25
TBLA0A03800 Chr1 complement(947158..951798) [4641 bp, 1546 aa] {...   113   9e-25
TBLA0C07100 Chr3 (1721628..1726085) [4458 bp, 1485 aa] {ON}           112   1e-24
Smik_11.367 Chr11 (644116..648903) [4788 bp, 1595 aa] {ON} YKR10...   112   2e-24
AGL346W Chr7 (61232..65434) [4203 bp, 1400 aa] {ON} Syntenic hom...   110   8e-24
YKR103W Chr11 (653080..656736) [3657 bp, 1218 aa] {ON}  NFT1Puta...    88   5e-17
KAFR0A03790 Chr1 complement(770906..773536) [2631 bp, 876 aa] {O...    80   8e-15
Kpol_175.1 s175 complement(1..4131) [4131 bp, 1377 aa] {ON} comp...    80   1e-14
Ecym_5660 Chr5 complement(1331316..1335926) [4611 bp, 1536 aa] {...    80   2e-14
YPL147W Chr16 (273255..275867) [2613 bp, 870 aa] {ON}  PXA1Subun...    79   4e-14
Smik_6.344 Chr6 complement(548373..550985) [2613 bp, 870 aa] {ON...    77   9e-14
NDAI0E01240 Chr5 (244737..247430) [2694 bp, 897 aa] {ON} Anc_8.661     77   1e-13
Suva_16.163 Chr16 (282462..285074) [2613 bp, 870 aa] {ON} YPL147...    77   1e-13
ACR128C Chr3 complement(573251..575734) [2484 bp, 827 aa] {ON} S...    76   2e-13
KLTH0D10890g Chr4 complement(891012..893504) [2493 bp, 830 aa] {...    75   3e-13
Kwal_26.8730 s26 complement(918498..920993) [2496 bp, 831 aa] {O...    75   4e-13
Skud_16.135 Chr16 (244860..247472) [2613 bp, 870 aa] {ON} YPL147...    75   4e-13
ZYRO0F07018g Chr6 complement(571276..573861) [2586 bp, 861 aa] {...    75   5e-13
KLLA0F11484g Chr6 (1052991..1055528) [2538 bp, 845 aa] {ON} simi...    75   6e-13
TPHA0D01170 Chr4 complement(245675..248422) [2748 bp, 915 aa] {O...    74   1e-12
Kpol_1012.10 s1012 complement(20013..20741,21318..21326,21750..2...    70   1e-11
Ecym_2410 Chr2 (797543..800029) [2487 bp, 828 aa] {ON} similar t...    70   1e-11
TBLA0D04350 Chr4 complement(1076344..1079703) [3360 bp, 1119 aa]...    70   2e-11
SAKL0D10208g Chr4 complement(855378..857636) [2259 bp, 752 aa] {...    69   4e-11
KAFR0C04540 Chr3 complement(907385..909643) [2259 bp, 752 aa] {O...    68   5e-11
KNAG0A02980 Chr1 (363468..366083) [2616 bp, 871 aa] {ON} Anc_8.6...    68   5e-11
SAKL0F01606g Chr6 (133318..135144) [1827 bp, 608 aa] {ON} highly...    68   6e-11
NDAI0H03570 Chr8 complement(872905..875172) [2268 bp, 755 aa] {O...    68   7e-11
SAKL0H06908g Chr8 (605838..608348) [2511 bp, 836 aa] {ON} simila...    68   7e-11
TDEL0A06070 Chr1 complement(1064071..1066689) [2619 bp, 872 aa] ...    67   9e-11
SAKL0H21010g Chr8 (1835185..1839528) [4344 bp, 1447 aa] {ON} sim...    68   9e-11
KNAG0C01960 Chr3 complement(380896..383154) [2259 bp, 752 aa] {O...    67   9e-11
CAGL0K10472g Chr11 (1020845..1023103) [2259 bp, 752 aa] {ON} hig...    67   1e-10
AEL032W Chr5 (572196..574457) [2262 bp, 753 aa] {ON} Syntenic ho...    67   1e-10
NCAS0B01530 Chr2 complement(249743..252349) [2607 bp, 868 aa] {O...    67   1e-10
ZYRO0G01144g Chr7 (89341..91599) [2259 bp, 752 aa] {ON} highly s...    67   1e-10
TBLA0C01220 Chr3 complement(263093..265348) [2256 bp, 751 aa] {O...    66   2e-10
ZYRO0D11880g Chr4 (1003647..1008143) [4497 bp, 1498 aa] {ON} sim...    67   2e-10
KLTH0H13442g Chr8 complement(1175860..1178118) [2259 bp, 752 aa]...    66   2e-10
TBLA0C01780 Chr3 complement(421045..423711) [2667 bp, 888 aa] {O...    66   2e-10
Kwal_27.9666 s27 complement(9636..14060) [4425 bp, 1474 aa] {ON}...    66   3e-10
Kpol_1043.43 s1043 complement(86642..88900) [2259 bp, 752 aa] {O...    65   4e-10
KNAG0B03870 Chr2 complement(741637..746178) [4542 bp, 1513 aa] {...    65   4e-10
ZYRO0E08800g Chr5 complement(702554..704386) [1833 bp, 610 aa] {...    65   4e-10
ZYRO0D17710g Chr4 complement(1466189..1470649) [4461 bp, 1486 aa...    65   5e-10
Ecym_1194 Chr1 (393697..395526) [1830 bp, 609 aa] {ON} similar t...    65   5e-10
TPHA0A05890 Chr1 complement(1334117..1335949) [1833 bp, 610 aa] ...    65   5e-10
Suva_5.134 Chr5 complement(199609..201441) [1833 bp, 610 aa] {ON...    65   6e-10
KAFR0C05220 Chr3 (1042497..1046996) [4500 bp, 1499 aa] {ON} Anc_...    65   6e-10
ZYRO0D11858g Chr4 (998646..1003157) [4512 bp, 1503 aa] {ON} high...    65   7e-10
CAGL0C02343g Chr3 (236112..236391,236790..238672) [2163 bp, 720 ...    65   7e-10
NCAS0E00480 Chr5 (81549..83381) [1833 bp, 610 aa] {ON}                 64   7e-10
TBLA0I03330 Chr9 complement(806242..808074) [1833 bp, 610 aa] {O...    64   8e-10
Skud_14.404 Chr14 (733442..737716) [4275 bp, 1424 aa] {ON} YNR07...    65   9e-10
Kwal_47.19116 s47 complement(1101559..1103382) [1824 bp, 607 aa]...    64   1e-09
TBLA0D01820 Chr4 (448516..453171) [4656 bp, 1551 aa] {ON}              64   1e-09
CAGL0M01760g Chr13 (203616..208115) [4500 bp, 1499 aa] {ON} high...    64   1e-09
TPHA0D04700 Chr4 (1026978..1031510) [4533 bp, 1510 aa] {ON}            64   1e-09
CAGL0M02387g Chr13 (280372..282942) [2571 bp, 856 aa] {ON} simil...    64   1e-09
AGL142C Chr7 complement(434247..438740) [4494 bp, 1497 aa] {ON} ...    64   1e-09
TBLA0D01780 Chr4 complement(438830..443617) [4788 bp, 1595 aa] {...    64   1e-09
KAFR0E03450 Chr5 complement(689571..694232) [4662 bp, 1553 aa] {...    64   1e-09
KAFR0C05210 Chr3 (1037177..1041658) [4482 bp, 1493 aa] {ON}            64   2e-09
TDEL0D06020 Chr4 complement(1087102..1088934) [1833 bp, 610 aa] ...    63   2e-09
YOR328W Chr15 (931803..936497) [4695 bp, 1564 aa] {ON}  PDR10ATP...    64   2e-09
KAFR0E03480 Chr5 complement(701160..705818) [4659 bp, 1552 aa] {...    64   2e-09
TDEL0A03640 Chr1 (646252..650781) [4530 bp, 1509 aa] {ON} Anc_5....    64   2e-09
Smik_7.313 Chr7 (524077..526335) [2259 bp, 752 aa] {ON} YFR009W ...    63   2e-09
YFR009W Chr6 (162488..164746) [2259 bp, 752 aa] {ON}  GCN20Posit...    63   2e-09
YER036C Chr5 complement(223367..225199) [1833 bp, 610 aa] {ON}  ...    63   2e-09
Ecym_8014 Chr8 (37756..42309) [4554 bp, 1517 aa] {ON} similar to...    63   3e-09
Skud_5.145 Chr5 complement(221173..223005) [1833 bp, 610 aa] {ON...    62   3e-09
Smik_5.159 Chr5 complement(228179..230011) [1833 bp, 610 aa] {ON...    62   3e-09
Kpol_1050.26 s1050 complement(62452..64284) [1833 bp, 610 aa] {O...    62   3e-09
Suva_8.379 Chr8 (672487..677184) [4698 bp, 1565 aa] {ON} YPL058C...    63   3e-09
KAFR0E03460 Chr5 complement(695361..700001) [4641 bp, 1546 aa] {...    63   3e-09
NDAI0I03020 Chr9 complement(713821..715650) [1830 bp, 609 aa] {O...    62   3e-09
ZYRO0D11836g Chr4 (993707..998095) [4389 bp, 1462 aa] {ON} simil...    62   4e-09
Smik_15.333 Chr15 (575791..580323) [4533 bp, 1510 aa] {ON} YOR15...    62   4e-09
Skud_4.262 Chr4 (456192..460697) [4506 bp, 1501 aa] {ON} YDR011W...    62   4e-09
KAFR0J02700 Chr10 complement(515978..517804) [1827 bp, 608 aa] {...    62   4e-09
YDR406W Chr4 (1279210..1283799) [4590 bp, 1529 aa] {ON}  PDR15Pl...    62   4e-09
NCAS0E01630 Chr5 complement(308563..313260) [4698 bp, 1565 aa] {...    62   5e-09
Skud_4.680 Chr4 (1201243..1205580) [4338 bp, 1445 aa] {ON} YDR40...    62   5e-09
Skud_4.681 Chr4 (1201243..1205580) [4338 bp, 1445 aa] {ON} YDR40...    62   5e-09
NCAS0A12060 Chr1 (2388467..2393098) [4632 bp, 1543 aa] {ON} Anc_...    62   5e-09
YOR153W Chr15 (619840..624375) [4536 bp, 1511 aa] {ON}  PDR5Plas...    62   5e-09
Kwal_0.327 s0 complement(154643..157702) [3060 bp, 1019 aa] {ON}...    62   6e-09
KNAG0I00530 Chr9 (88076..91219) [3144 bp, 1047 aa] {ON} Anc_1.42...    62   6e-09
TDEL0B05760 Chr2 (1017816..1020926) [3111 bp, 1036 aa] {ON} Anc_...    62   6e-09
NDAI0C01220 Chr3 (246762..251291) [4530 bp, 1509 aa] {ON} Anc_5....    62   6e-09
TPHA0A02310 Chr1 (483447..485705) [2259 bp, 752 aa] {ON} Anc_1.3...    61   7e-09
NDAI0A04200 Chr1 complement(948224..952879) [4656 bp, 1551 aa] {...    62   8e-09
ZYRO0A04114g Chr1 complement(328582..333138) [4557 bp, 1518 aa] ...    62   8e-09
AFR232C Chr6 complement(859612..861435) [1824 bp, 607 aa] {ON} S...    61   8e-09
Kwal_34.16240 s34 (257762..260020) [2259 bp, 752 aa] {ON} YFR009...    61   8e-09
Suva_6.84 Chr6 complement(145289..147547) [2259 bp, 752 aa] {ON}...    61   9e-09
NCAS0A08570 Chr1 (1693304..1696486) [3183 bp, 1060 aa] {ON} Anc_...    61   1e-08
Smik_4.678 Chr4 (1200036..1204637) [4602 bp, 1533 aa] {ON} YDR40...    61   1e-08
KLTH0G01452g Chr7 (105741..107564) [1824 bp, 607 aa] {ON} highly...    60   1e-08
KNAG0B00460 Chr2 (76565..78547) [1983 bp, 660 aa] {ON} Anc_3.534...    60   1e-08
NCAS0F00410 Chr6 (70678..75273) [4596 bp, 1531 aa] {ON}                61   1e-08
ZYRO0B05588g Chr2 (440556..444368) [3813 bp, 1270 aa] {ON} simil...    61   1e-08
KLLA0A10857g Chr1 complement(941784..944042) [2259 bp, 752 aa] {...    60   1e-08
NCAS0H02420 Chr8 (477754..482316) [4563 bp, 1520 aa] {ON} Anc_5....    61   1e-08
Smik_15.508 Chr15 (881347..886047) [4701 bp, 1566 aa] {ON} YOR32...    60   1e-08
SAKL0C11616g Chr3 complement(1041794..1046248) [4455 bp, 1484 aa...    60   1e-08
YNR070W Chr14 (765375..769376) [4002 bp, 1333 aa] {ON}  PDR18Put...    60   2e-08
CAGL0F02717g Chr6 (261361..265989) [4629 bp, 1542 aa] {ON}             60   2e-08
ZYRO0E04092g Chr5 (308495..311683) [3189 bp, 1062 aa] {ON} simil...    60   2e-08
KNAG0C04500 Chr3 complement(882896..887563) [4668 bp, 1555 aa] {...    60   2e-08
KAFR0E03440 Chr5 complement(684043..688692) [4650 bp, 1549 aa] {...    60   2e-08
Suva_2.583 Chr2 (1030711..1035324) [4614 bp, 1537 aa] {ON} YDR40...    60   2e-08
YDR011W Chr4 (465919..470424) [4506 bp, 1501 aa] {ON}  SNQ2Plasm...    60   2e-08
Skud_15.495 Chr15 (871539..876233) [4695 bp, 1564 aa] {ON} YOR32...    60   2e-08
KLLA0B02563g Chr2 complement(222951..225377) [2427 bp, 808 aa] {...    60   2e-08
Skud_6.95 Chr6 complement(175462..177720) [2259 bp, 752 aa] {ON}...    59   3e-08
KLLA0F21692g Chr6 complement(2014152..2018729) [4578 bp, 1525 aa...    60   3e-08
YOL075C Chr15 complement(189658..193542) [3885 bp, 1294 aa] {ON}...    60   3e-08
KAFR0G03010 Chr7 (623976..628094) [4119 bp, 1372 aa] {ON}  YIL013C     59   4e-08
CAGL0I04862g Chr9 complement(438338..442861) [4524 bp, 1507 aa] ...    59   4e-08
KAFR0F01460 Chr6 (284981..288154) [3174 bp, 1057 aa] {ON} Anc_1....    59   4e-08
Kwal_23.5161 s23 (1040608..1045077) [4470 bp, 1489 aa] {ON} YDR0...    59   4e-08
Kpol_1049.23 s1049 complement(67726..68058) [333 bp, 110 aa] {ON...    54   4e-08
Smik_4.244 Chr4 (445916..450421) [4506 bp, 1501 aa] {ON} YDR011W...    59   4e-08
Smik_17.26 Chr17 complement(23946..28454) [4509 bp, 1502 aa] {ON...    59   4e-08
KLTH0D15246g Chr4 (1257193..1259589) [2397 bp, 798 aa] {ON} simi...    59   5e-08
KAFR0C00820 Chr3 (157878..162431) [4554 bp, 1517 aa] {ON}              59   5e-08
Ecym_2714 Chr2 (1380718..1382964) [2247 bp, 748 aa] {ON} similar...    59   5e-08
Skud_15.317 Chr15 (568579..573117) [4539 bp, 1512 aa] {ON} YOR15...    59   5e-08
Kpol_1050.16 s1050 complement(38346..41489) [3144 bp, 1047 aa] {...    59   5e-08
KLLA0D04554g Chr4 complement(385733..388801) [3069 bp, 1022 aa] ...    59   6e-08
Kwal_23.4045 s23 complement(543590..545875) [2286 bp, 761 aa] {O...    58   7e-08
CAGL0I08019g Chr9 complement(783133..786990) [3858 bp, 1285 aa] ...    58   7e-08
ZYRO0B14762g Chr2 (1201028..1205575) [4548 bp, 1515 aa] {ON} sim...    58   7e-08
Smik_14.399 Chr14 (709641..713906) [4266 bp, 1421 aa] {ON} YNR07...    58   9e-08
KAFR0G03410 Chr7 (702624..705056) [2433 bp, 810 aa] {ON} Anc_4.2...    58   9e-08
Suva_8.204 Chr8 (368920..373455) [4536 bp, 1511 aa] {ON} YOR153W...    58   9e-08
Ecym_3604 Chr3 complement(1143009..1147433) [4425 bp, 1474 aa] {...    58   9e-08
TBLA0G02820 Chr7 (745762..750297) [4536 bp, 1511 aa] {ON} Anc_3....    58   1e-07
TPHA0O01000 Chr15 (185595..188630) [3036 bp, 1011 aa] {ON} Anc_1...    57   1e-07
CAGL0F01419g Chr6 complement(142623..146819) [4197 bp, 1398 aa] ...    57   1e-07
SAKL0C11704g Chr3 (1050447..1054979) [4533 bp, 1510 aa] {ON} sim...    57   1e-07
Kpol_1053.48 s1053 complement(92949..93236,93239..96817) [3867 b...    57   1e-07
Suva_15.91 Chr15 complement(162469..166377) [3909 bp, 1302 aa] {...    57   1e-07
NDAI0G05020 Chr7 (1217458..1220751) [3294 bp, 1097 aa] {ON} Anc_...    57   1e-07
TBLA0A02440 Chr1 complement(582029..586894) [4866 bp, 1621 aa] {...    57   2e-07
KLLA0D03432g Chr4 (287805..292256) [4452 bp, 1483 aa] {ON} simil...    57   2e-07
KLLA0A01452g Chr1 (130078..131901) [1824 bp, 607 aa] {ON} highly...    57   2e-07
TBLA0A08720 Chr1 complement(2139184..2140668) [1485 bp, 494 aa] ...    57   2e-07
Smik_9.181 Chr9 complement(302896..307125) [4230 bp, 1409 aa] {O...    57   2e-07
KAFR0C00830 Chr3 (163830..168284) [4455 bp, 1484 aa] {ON} Anc_3....    57   2e-07
ABR126W Chr2 (628624..633162) [4539 bp, 1512 aa] {ON} Non-synten...    57   2e-07
KAFR0K01230 Chr11 (254346..258488) [4143 bp, 1380 aa] {ON}  YIL013C    56   3e-07
TPHA0A00840 Chr1 complement(163812..167750) [3939 bp, 1312 aa] {...    56   3e-07
NCAS0F00790 Chr6 complement(158502..162704) [4203 bp, 1400 aa] {...    56   3e-07
KNAG0K00950 Chr11 complement(186381..190235) [3855 bp, 1284 aa] ...    56   4e-07
Ecym_2737 Chr2 (1425670..1428726) [3057 bp, 1018 aa] {ON} simila...    56   4e-07
KLTH0E15796g Chr5 (1400194..1403937) [3744 bp, 1247 aa] {ON} sim...    56   4e-07
Smik_15.84 Chr15 complement(153969..157856) [3888 bp, 1295 aa] {...    56   4e-07
Skud_15.174 Chr15 (310212..314393) [4182 bp, 1393 aa] {ON} YALI0...    56   4e-07
Smik_3.97 Chr3 complement(133624..136773) [3150 bp, 1049 aa] {ON...    55   4e-07
SAKL0C06996g Chr3 complement(649424..654061) [4638 bp, 1545 aa] ...    56   5e-07
KLLA0D03476g Chr4 (296287..300969) [4683 bp, 1560 aa] {ON} simil...    56   5e-07
KLTH0G19448g Chr7 (1676895..1681355) [4461 bp, 1486 aa] {ON} sim...    55   5e-07
CAGL0L07744g Chr12 (851958..855125) [3168 bp, 1055 aa] {ON} simi...    55   5e-07
Smik_15.185 Chr15 (316883..321064) [4182 bp, 1393 aa] {ON} YNR07...    55   5e-07
KNAG0L00680 Chr12 complement(105318..109460) [4143 bp, 1380 aa] ...    55   6e-07
KAFR0C03470 Chr3 (707203..708039) [837 bp, 278 aa] {ON} Anc_8.42...    54   6e-07
KLLA0F08833g Chr6 (822039..822860) [822 bp, 273 aa] {ON} similar...    54   7e-07
AER190W Chr5 (994534..997569) [3036 bp, 1011 aa] {ON} Syntenic h...    55   8e-07
Kpol_1035.32 s1035 (76084..76926) [843 bp, 280 aa] {ON} (76084.....    53   8e-07
NCAS0D00580 Chr4 (96350..98611) [2262 bp, 753 aa] {ON} Anc_1.366       55   9e-07
YFL028C Chr6 complement(79344..80213) [870 bp, 289 aa] {ON}  CAF...    53   1e-06
Suva_3.37 Chr3 complement(47453..50614) [3162 bp, 1053 aa] {ON} ...    54   1e-06
TDEL0C00680 Chr3 complement(110674..111519) [846 bp, 281 aa] {ON...    53   1e-06
YIL013C Chr9 complement(328207..332442) [4236 bp, 1411 aa] {ON} ...    54   1e-06
KLTH0H12760g Chr8 complement(1083450..1086512) [3063 bp, 1020 aa...    54   1e-06
TDEL0E00840 Chr5 complement(172712..175192) [2481 bp, 826 aa] {O...    54   1e-06
Smik_6.50 Chr6 complement(94583..95452) [870 bp, 289 aa] {ON} YF...    53   1e-06
TBLA0A01150 Chr1 (262829..266992) [4164 bp, 1387 aa] {ON}              54   1e-06
YCR011C Chr3 complement(133724..136873) [3150 bp, 1049 aa] {ON} ...    54   1e-06
TPHA0M00640 Chr13 complement(117604..122076) [4473 bp, 1490 aa] ...    54   2e-06
SAKL0C08074g Chr3 complement(747926..751699) [3774 bp, 1257 aa] ...    54   2e-06
Suva_15.188 Chr15 (324904..329088) [4185 bp, 1394 aa] {ON} YOR01...    54   2e-06
Suva_7.3 Chr7 complement(6379..10671) [4293 bp, 1430 aa] {ON} YN...    54   2e-06
NDAI0G01840 Chr7 complement(404289..408797) [4509 bp, 1502 aa] {...    54   2e-06
YDR061W Chr4 (574164..575783) [1620 bp, 539 aa] {ON} Protein wit...    53   2e-06
NCAS0I00670 Chr9 (111140..115240) [4101 bp, 1366 aa] {ON}              54   2e-06
SAKL0D09394g Chr4 complement(780019..783102) [3084 bp, 1027 aa] ...    53   2e-06
SAKL0G08008g Chr7 complement(673391..678040) [4650 bp, 1549 aa] ...    53   3e-06
SAKL0G16280g Chr7 (1408229..1410607) [2379 bp, 792 aa] {ON} simi...    53   3e-06
YOR011W Chr15 (349679..353863) [4185 bp, 1394 aa] {ON}  AUS1Plas...    53   3e-06
NCAS0B04350 Chr2 complement(786960..788561) [1602 bp, 533 aa] {O...    52   3e-06
ZYRO0G09130g Chr7 (732487..734034) [1548 bp, 515 aa] {ON} simila...    52   3e-06
Suva_6.30 Chr6 complement(52879..53748) [870 bp, 289 aa] {ON} YF...    52   3e-06
TDEL0D02370 Chr4 (460691..462952) [2262 bp, 753 aa] {ON} Anc_1.3...    52   4e-06
Ecym_3605 Chr3 (1148339..1152817) [4479 bp, 1492 aa] {ON} simila...    53   4e-06
KNAG0G01040 Chr7 (221426..225631) [4206 bp, 1401 aa] {ON}  YIL013C     53   4e-06
Suva_2.220 Chr2 (374470..376092) [1623 bp, 540 aa] {ON} YDR061W ...    52   4e-06
KLTH0H11902g Chr8 (1017096..1020230) [3135 bp, 1044 aa] {ON} hig...    52   5e-06
SAKL0B01518g Chr2 complement(148745..149542) [798 bp, 265 aa] {O...    51   5e-06
TBLA0D02530 Chr4 complement(629614..630444) [831 bp, 276 aa] {ON...    51   5e-06
KNAG0E03270 Chr5 complement(655376..656218) [843 bp, 280 aa] {ON...    51   5e-06
NCAS0B05300 Chr2 (980856..984677) [3822 bp, 1273 aa] {ON} Anc_3....    52   5e-06
Suva_9.192 Chr9 complement(316679..320920) [4242 bp, 1413 aa] {O...    52   5e-06
TPHA0B01940 Chr2 (434881..437436) [2556 bp, 851 aa] {ON} Anc_4.2...    52   5e-06
TBLA0D04410 Chr4 complement(1093035..1096169) [3135 bp, 1044 aa]...    52   5e-06
KAFR0C01200 Chr3 (240350..244171) [3822 bp, 1273 aa] {ON} Anc_3....    52   6e-06
Ecym_3232 Chr3 complement(431386..433830) [2445 bp, 814 aa] {ON}...    52   7e-06
Kwal_0.167 s0 (88989..92123) [3135 bp, 1044 aa] {ON} YNL014W (HE...    52   7e-06
Skud_9.159 Chr9 complement(298165..302388) [4224 bp, 1407 aa] {O...    52   7e-06
NDAI0B02870 Chr2 complement(726822..730625) [3804 bp, 1267 aa] {...    52   8e-06
SAKL0H19294g Chr8 complement(1703651..1705213) [1563 bp, 520 aa]...    51   8e-06
Smik_12.322 Chr12 (581596..584730) [3135 bp, 1044 aa] {ON} YLR24...    51   9e-06
TDEL0B06150 Chr2 complement(1083103..1086237) [3135 bp, 1044 aa]...    51   9e-06
YLR249W Chr12 (636780..639914) [3135 bp, 1044 aa] {ON}  YEF3Gamm...    51   1e-05
TBLA0F01040 Chr6 (252002..255817) [3816 bp, 1271 aa] {ON} Anc_3....    51   1e-05
Kpol_487.13 s487 complement(50878..54012) [3135 bp, 1044 aa] {ON...    51   1e-05
AAL028W Chr1 (291808..294942) [3135 bp, 1044 aa] {ON} Syntenic h...    51   1e-05
Skud_14.314 Chr14 (573040..576174) [3135 bp, 1044 aa] {ON} YNL01...    51   1e-05
NDAI0H01280 Chr8 complement(308593..312771) [4179 bp, 1392 aa] {...    51   2e-05
CAGL0K12474g Chr11 (1218012..1218896) [885 bp, 294 aa] {ON} simi...    49   2e-05
Suva_14.333 Chr14 (585838..588972) [3135 bp, 1044 aa] {ON} YNL01...    50   2e-05
Kwal_26.6702 s26 complement(29426..31279) [1854 bp, 617 aa] {ON}...    50   2e-05
Skud_12.330 Chr12 (583354..586488) [3135 bp, 1044 aa] {ON} YLR24...    50   2e-05
YNL014W Chr14 (606319..609453) [3135 bp, 1044 aa] {ON}  HEF3Tran...    50   2e-05
TPHA0A04220 Chr1 complement(948357..952811) [4455 bp, 1484 aa] {...    50   2e-05
KNAG0I01340 Chr9 complement(258887..262024) [3138 bp, 1045 aa] {...    50   2e-05
KAFR0I02110 Chr9 (433759..436896) [3138 bp, 1045 aa] {ON} Anc_1....    50   2e-05
CAGL0G05093g Chr7 complement(483230..484864) [1635 bp, 544 aa] {...    50   2e-05
KAFR0C02740 Chr3 complement(537867..539465) [1599 bp, 532 aa] {O...    50   2e-05
Skud_3.76 Chr3 complement(116029..119199) [3171 bp, 1056 aa] {ON...    50   3e-05
KNAG0A02100 Chr1 complement(177773..182290) [4518 bp, 1505 aa] {...    50   3e-05
Ecym_1312 Chr1 complement(630006..633140) [3135 bp, 1044 aa] {ON...    50   3e-05
Kwal_33.15623 s33 (1193685..1195373) [1689 bp, 562 aa] {ON} YFR0...    49   3e-05
KAFR0A01180 Chr1 (225692..230218) [4527 bp, 1508 aa] {ON} Anc_8....    49   5e-05
CAGL0B03487g Chr2 complement(345399..348536) [3138 bp, 1045 aa] ...    49   5e-05
Kwal_27.12711 s27 (1342807..1346547) [3741 bp, 1246 aa] {ON} YOL...    49   5e-05
NCAS0A06310 Chr1 complement(1243683..1246823) [3141 bp, 1046 aa]...    49   5e-05
KAFR0H03200 Chr8 complement(610545..613694) [3150 bp, 1049 aa] {...    49   6e-05
Kpol_1055.54 s1055 complement(131851..134565) [2715 bp, 904 aa] ...    49   7e-05
NDAI0A03750 Chr1 complement(849511..851118) [1608 bp, 535 aa] {O...    48   8e-05
TPHA0D00450 Chr4 complement(76541..77377) [837 bp, 278 aa] {ON} ...    47   1e-04
NDAI0G03160 Chr7 complement(744284..745141) [858 bp, 285 aa] {ON...    47   1e-04
NCAS0A08760 Chr1 complement(1729600..1732737) [3138 bp, 1045 aa]...    48   1e-04
Smik_14.315 Chr14 (564639..567773) [3135 bp, 1044 aa] {ON} YNL01...    47   1e-04
Skud_15.78 Chr15 complement(148836..152720) [3885 bp, 1294 aa] {...    47   1e-04
ZYRO0B13266g Chr2 (1074171..1076639) [2469 bp, 822 aa] {ON} simi...    47   2e-04
Skud_6.42 Chr6 complement(82602..83471) [870 bp, 289 aa] {ON} YF...    46   2e-04
KNAG0D02010 Chr4 complement(335815..337413) [1599 bp, 532 aa] {O...    47   2e-04
TBLA0H03470 Chr8 (847762..852312) [4551 bp, 1516 aa] {ON} Anc_8....    47   2e-04
TDEL0B04340 Chr2 complement(764357..766018) [1662 bp, 553 aa] {O...    47   2e-04
TBLA0G02050 Chr7 complement(537114..540098) [2985 bp, 994 aa] {O...    47   2e-04
SAKL0C05654g Chr3 complement(532258..536787) [4530 bp, 1509 aa] ...    47   2e-04
SAKL0H10670g Chr8 complement(918091..922620) [4530 bp, 1509 aa] ...    47   2e-04
CAGL0M07293g Chr13 complement(733072..737619) [4548 bp, 1515 aa]...    47   2e-04
KLLA0F12210g Chr6 (1125630..1128764) [3135 bp, 1044 aa] {ON} hig...    47   2e-04
Ecym_1500 Chr1 (1027467..1028318) [852 bp, 283 aa] {ON} similar ...    46   2e-04
SAKL0D08316g Chr4 (695101..698235) [3135 bp, 1044 aa] {ON} highl...    47   3e-04
ZYRO0E05148g Chr5 complement(387268..390405) [3138 bp, 1045 aa] ...    47   3e-04
YPL058C Chr16 complement(445842..450377) [4536 bp, 1511 aa] {ON}...    47   3e-04
TPHA0L01500 Chr12 (311715..316274) [4560 bp, 1519 aa] {ON} Anc_8...    47   3e-04
TDEL0B01210 Chr2 complement(219068..223606) [4539 bp, 1512 aa] {...    47   3e-04
Smik_16.179 Chr16 complement(321239..325774) [4536 bp, 1511 aa] ...    47   3e-04
Smik_4.299 Chr4 (540966..542588) [1623 bp, 540 aa] {ON} YDR061W ...    46   3e-04
KLLA0C04477g Chr3 complement(409543..413304) [3762 bp, 1253 aa] ...    46   3e-04
CAGL0D03674g Chr4 (370066..373626) [3561 bp, 1186 aa] {ON} highl...    46   3e-04
CAGL0D00352g Chr4 complement(42946..45531) [2586 bp, 861 aa] {ON...    46   5e-04
TPHA0H00120 Chr8 complement(11464..13092) [1629 bp, 542 aa] {ON}...    45   5e-04
Skud_4.316 Chr4 (550218..551840) [1623 bp, 540 aa] {ON} YDR061W ...    45   5e-04
Suva_10.346 Chr10 (604006..607140) [3135 bp, 1044 aa] {ON} YLR24...    45   6e-04
NCAS0C03820 Chr3 complement(774039..774923) [885 bp, 294 aa] {ON...    44   7e-04
Kpol_1048.72 s1048 complement(202581..205715) [3135 bp, 1044 aa]...    45   7e-04
NDAI0G05180 Chr7 complement(1254531..1257665) [3135 bp, 1044 aa]...    45   7e-04
AER091W Chr5 (809767..812172) [2406 bp, 801 aa] {ON} Syntenic ho...    45   7e-04
NCAS0C02250 Chr3 complement(418244..422770) [4527 bp, 1508 aa] {...    45   7e-04
NDAI0G00810 Chr7 (169366..172515) [3150 bp, 1049 aa] {ON} Anc_1....    45   8e-04
TBLA0A05970 Chr1 (1471379..1474975) [3597 bp, 1198 aa] {ON} Anc_...    45   9e-04
Suva_16.256 Chr16 complement(448846..453387) [4542 bp, 1513 aa] ...    45   9e-04
KLLA0B09702g Chr2 complement(842245..846801) [4557 bp, 1518 aa] ...    45   0.001
TPHA0O00680 Chr15 (128579..131713) [3135 bp, 1044 aa] {ON} Anc_1...    45   0.001
Skud_16.225 Chr16 complement(410106..414641) [4536 bp, 1511 aa] ...    45   0.001
Ecym_5557 Chr5 (1126965..1128539) [1575 bp, 524 aa] {ON} similar...    44   0.001
NDAI0E02950 Chr5 complement(620841..625379) [4539 bp, 1512 aa] {...    45   0.001
NCAS0A02680 Chr1 (510902..513559) [2658 bp, 885 aa] {ON} Anc_4.287     44   0.001
Kwal_56.24221 s56 complement(908983..912147) [3165 bp, 1054 aa] ...    44   0.001
Kpol_1002.105 s1002 complement(266533..268176) [1644 bp, 547 aa]...    44   0.001
Kwal_YGOB_56.24219 s56 complement(908618..909109,909112..912147)...    44   0.002
KNAG0F01740 Chr6 (326444..329950) [3507 bp, 1168 aa] {ON} Anc_6....    44   0.002
KLTH0H03300g Chr8 (295271..298801) [3531 bp, 1176 aa] {ON} simil...    44   0.002
Suva_51.1 Chr51 (3..968) [966 bp, 322 aa] {ON} YDR011W (REAL)          43   0.002
NDAI0D04610 Chr4 (1084921..1087599) [2679 bp, 892 aa] {ON} Anc_4...    44   0.002
ZYRO0F08866g Chr6 (709888..714450) [4563 bp, 1520 aa] {ON} highl...    44   0.002
SAKL0A03586g Chr1 (328346..331885) [3540 bp, 1179 aa] {ON} simil...    44   0.002
ZYRO0E07634g Chr5 complement(593495..597025) [3531 bp, 1176 aa] ...    44   0.002
Kpol_513.9 s513 (23141..27682) [4542 bp, 1513 aa] {ON} (23141..2...    43   0.003
TPHA0H01820 Chr8 complement(415382..418765) [3384 bp, 1127 aa] {...    43   0.003
NCAS0D03950 Chr4 (737216..740788) [3573 bp, 1190 aa] {ON} Anc_6....    43   0.003
YKL188C Chr11 complement(86225..88786) [2562 bp, 853 aa] {ON}  P...    43   0.003
ZYRO0F08888g Chr6 (716318..720880) [4563 bp, 1520 aa] {ON} highl...    43   0.004
KAFR0A07090 Chr1 complement(1427525..1431157) [3633 bp, 1210 aa]...    43   0.004
Skud_16.52 Chr16 (95317..98853) [3537 bp, 1178 aa] {ON} YPL226W ...    43   0.004
YPL226W Chr16 (121767..125357) [3591 bp, 1196 aa] {ON}  NEW1ATP ...    42   0.005
KLLA0C16115g Chr3 (1405766..1409317) [3552 bp, 1183 aa] {ON} sim...    42   0.005
Kpol_1002.29 s1002 (89520..93068) [3549 bp, 1182 aa] {ON} (89520...    42   0.005
Kwal_14.1242 s14 (250275..251084) [810 bp, 269 aa] {ON} YFL028C ...    41   0.006
NDAI0I00960 Chr9 complement(226758..230396) [3639 bp, 1212 aa] {...    42   0.006
Smik_6.431 Chr6 complement(699005..702574) [3570 bp, 1189 aa] {O...    42   0.006
Suva_16.80 Chr16 (131166..134702) [3537 bp, 1178 aa] {ON} YPL226...    42   0.006
TDEL0F01870 Chr6 (348408..351950) [3543 bp, 1180 aa] {ON} Anc_6....    42   0.007
Ecym_2164 Chr2 (314802..318317) [3516 bp, 1171 aa] {ON} similar ...    42   0.010
Suva_11.36 Chr11 complement(70977..73538) [2562 bp, 853 aa] {ON}...    41   0.010
KNAG0D04550 Chr4 (824870..827338) [2469 bp, 822 aa] {ON} Anc_4.2...    41   0.011
AFL131W Chr6 (186656..190225) [3570 bp, 1189 aa] {ON} Syntenic h...    41   0.013
Skud_11.38 Chr11 complement(72504..75071) [2568 bp, 855 aa] {ON}...    41   0.013
Smik_11.42 Chr11 complement(71610..74165) [2556 bp, 851 aa] {ON}...    41   0.014
ZYRO0F03234g Chr6 complement(273742..274569) [828 bp, 275 aa] {O...    40   0.015
KLTH0G18326g Chr7 complement(1579374..1580183) [810 bp, 269 aa] ...    40   0.016
NCAS0E01640 Chr5 complement(313479..317987) [4509 bp, 1502 aa] {...    41   0.017
KLTH0H07942g Chr8 complement(696683..698269) [1587 bp, 528 aa] {...    40   0.022
Suva_2.252 Chr2 complement(426492..428318) [1827 bp, 608 aa] {ON...    39   0.065
CAGL0G08041g Chr7 complement(758811..760634) [1824 bp, 607 aa] {...    37   0.14 
Kpol_1036.28 s1036 (70446..70928,73046..77023) [4461 bp, 1486 aa...    37   0.19 
Kpol_1037.47 s1037 (114295..118818) [4524 bp, 1507 aa] {ON} (114...    37   0.19 
TDEL0A01370 Chr1 (248469..250292) [1824 bp, 607 aa] {ON} Anc_8.2...    37   0.19 
YDR091C Chr4 complement(626708..628534) [1827 bp, 608 aa] {ON}  ...    37   0.23 
Smik_4.334 Chr4 complement(592554..594380) [1827 bp, 608 aa] {ON...    37   0.25 
KLLA0C17556g Chr3 complement(1544404..1546227) [1824 bp, 607 aa]...    36   0.38 
Kwal_14.2052 s14 complement(589149..590720) [1572 bp, 523 aa] {O...    35   0.63 
KLLA0D02156g Chr4 complement(184520..186085) [1566 bp, 521 aa] {...    35   0.64 
Skud_4.351 Chr4 complement(602770..604596) [1827 bp, 608 aa] {ON...    35   0.68 
KNAG0H02970 Chr8 complement(548970..550802) [1833 bp, 610 aa] {O...    35   0.72 
ZYRO0B11616g Chr2 complement(910480..912303) [1824 bp, 607 aa] {...    35   0.73 
AFR152C Chr6 complement(710014..710826) [813 bp, 270 aa] {ON} Sy...    34   1.0  
Kwal_YGOB_56.23429 s56 complement(532059..532313,532316..533998)...    35   1.2  
KAFR0A02430 Chr1 (508632..510455) [1824 bp, 607 aa] {ON} Anc_8.2...    35   1.2  
Kwal_56.23429 s56 complement(532382..533998) [1617 bp, 539 aa] {...    34   1.3  
NCAS0E01650 Chr5 complement(319448..323914) [4467 bp, 1488 aa] {...    34   1.6  
Ecym_1222 Chr1 complement(458018..462082) [4065 bp, 1354 aa] {ON...    34   1.7  
AGR125W Chr7 (987077..988900) [1824 bp, 607 aa] {ON} Syntenic ho...    34   2.1  
KLTH0G14520g Chr7 (1276585..1278411) [1827 bp, 608 aa] {ON} high...    33   2.8  
SAKL0H17996g Chr8 (1607260..1609323) [2064 bp, 687 aa] {ON} high...    33   2.8  
Ecym_5560 Chr5 complement(1134384..1136207) [1824 bp, 607 aa] {O...    33   3.1  
NCAS0B04030 Chr2 (730062..731888) [1827 bp, 608 aa] {ON} Anc_8.2...    33   3.6  
TPHA0A01980 Chr1 (400671..402494) [1824 bp, 607 aa] {ON} Anc_8.2...    32   5.0  

>CAGL0A01133g Chr1 (112037..114442) [2406 bp, 801 aa] {ON} similar
           to uniprot|P33311 Saccharomyces cerevisiae YPL270w MDL2
          Length = 801

 Score = 1489 bits (3854), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 736/801 (91%), Positives = 736/801 (91%)

Query: 1   MKYSGIAVLRGVRVTPLALPRAGSRYLSLLARPPTRQIIHNTGAGYGVWVSHKVLTSSTI 60
           MKYSGIAVLRGVRVTPLALPRAGSRYLSLLARPPTRQIIHNTGAGYGVWVSHKVLTSSTI
Sbjct: 1   MKYSGIAVLRGVRVTPLALPRAGSRYLSLLARPPTRQIIHNTGAGYGVWVSHKVLTSSTI 60

Query: 61  RRPFTAHRALNNEYNTTAGNASVKSQSATKEKNEEDRXXXXXXXXXXXXXXXNHSEFRDI 120
           RRPFTAHRALNNEYNTTAGNASVKSQSATKEKNEEDR               NHSEFRDI
Sbjct: 61  RRPFTAHRALNNEYNTTAGNASVKSQSATKEKNEEDRKYSKKEKEEQSETKENHSEFRDI 120

Query: 121 VRLMLLVRRDWKLLLTAVGLLTISCSIGMTIPKVIGLILDQLKNALAANSVDGQPVSIDK 180
           VRLMLLVRRDWKLLLTAVGLLTISCSIGMTIPKVIGLILDQLKNALAANSVDGQPVSIDK
Sbjct: 121 VRLMLLVRRDWKLLLTAVGLLTISCSIGMTIPKVIGLILDQLKNALAANSVDGQPVSIDK 180

Query: 181 LPPIVFGLSFYEXXXXXXXXXXVGIAANYGRIILLRVLSERLVARLRATVIKKTIHQDAE 240
           LPPIVFGLSFYE          VGIAANYGRIILLRVLSERLVARLRATVIKKTIHQDAE
Sbjct: 181 LPPIVFGLSFYEFLGGFALALLVGIAANYGRIILLRVLSERLVARLRATVIKKTIHQDAE 240

Query: 241 FFDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGSVGIGMMXXXXXXXXXXXXVF 300
           FFDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGSVGIGMM            VF
Sbjct: 241 FFDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGSVGIGMMLALSPQLSCLLLVF 300

Query: 301 TPPVILSASVFGKQISTTSRELQEATGHLTKVAEEQLSGIKTVQSFVAEQREINRYNFAI 360
           TPPVILSASVFGKQISTTSRELQEATGHLTKVAEEQLSGIKTVQSFVAEQREINRYNFAI
Sbjct: 301 TPPVILSASVFGKQISTTSRELQEATGHLTKVAEEQLSGIKTVQSFVAEQREINRYNFAI 360

Query: 361 RDIFNIGKKAAVINAKFFSSTSAMGDLSFLTVLGFGSYLVLQNSLTIGDLTAFMMYTEYT 420
           RDIFNIGKKAAVINAKFFSSTSAMGDLSFLTVLGFGSYLVLQNSLTIGDLTAFMMYTEYT
Sbjct: 361 RDIFNIGKKAAVINAKFFSSTSAMGDLSFLTVLGFGSYLVLQNSLTIGDLTAFMMYTEYT 420

Query: 421 GNSIFGLSTFYSEIMQGAGAASRLFELTDRVPSISTTKGVKYKPGNGEIEFKNVSFAYPT 480
           GNSIFGLSTFYSEIMQGAGAASRLFELTDRVPSISTTKGVKYKPGNGEIEFKNVSFAYPT
Sbjct: 421 GNSIFGLSTFYSEIMQGAGAASRLFELTDRVPSISTTKGVKYKPGNGEIEFKNVSFAYPT 480

Query: 481 RPSNMIFKNLNFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPSSGEILIDGQNINDLNS 540
           RPSNMIFKNLNFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPSSGEILIDGQNINDLNS
Sbjct: 481 RPSNMIFKNLNFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPSSGEILIDGQNINDLNS 540

Query: 541 KSLRRHIGLVQQEPILMSGTIRDNIVYGLTEMPTKDEIRQVAKQCFCHNFITRFQSSYDT 600
           KSLRRHIGLVQQEPILMSGTIRDNIVYGLTEMPTKDEIRQVAKQCFCHNFITRFQSSYDT
Sbjct: 541 KSLRRHIGLVQQEPILMSGTIRDNIVYGLTEMPTKDEIRQVAKQCFCHNFITRFQSSYDT 600

Query: 601 VIGPHGTLLSGGQKQRIAIARALIKKPRILILDEATSALDVESEGAINYTFGQLMKKKEM 660
           VIGPHGTLLSGGQKQRIAIARALIKKPRILILDEATSALDVESEGAINYTFGQLMKKKEM
Sbjct: 601 VIGPHGTLLSGGQKQRIAIARALIKKPRILILDEATSALDVESEGAINYTFGQLMKKKEM 660

Query: 661 TIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELWDDPTSELSQLLNEKSTPHQXXXX 720
           TIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELWDDPTSELSQLLNEKSTPHQ    
Sbjct: 661 TIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELWDDPTSELSQLLNEKSTPHQTTNI 720

Query: 721 XXXXXXXXMAXXXXXXXXXXXXXXXXIEDPGSPPMYISTVSEVSAEGHELINEQIEDTIE 780
                   MA                IEDPGSPPMYISTVSEVSAEGHELINEQIEDTIE
Sbjct: 721 TVTPPPTTMAEKVVEEVVENAEPETVIEDPGSPPMYISTVSEVSAEGHELINEQIEDTIE 780

Query: 781 NVMKDVTSERKPLKLQKDENL 801
           NVMKDVTSERKPLKLQKDENL
Sbjct: 781 NVMKDVTSERKPLKLQKDENL 801

>NDAI0I02730 Chr9 complement(640429..642927) [2499 bp, 832 aa] {ON}
           Anc_6.5
          Length = 832

 Score =  927 bits (2397), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 477/756 (63%), Positives = 562/756 (74%), Gaps = 50/756 (6%)

Query: 62  RPFTAHRA---LNNEYNTT----AGNASVKSQSATKEKNEEDRXXXXXXXXXXXXXXXNH 114
           +PF  ++     N+  NTT        S +S  A+ E NE +                  
Sbjct: 111 KPFNCNKVALRFNSTTNTTDTIPPHTESTESTKASTEPNEIE-------------PDQGE 157

Query: 115 SEFRDIVRLMLLVRRDWKLLLTAVGLLTISCSIGMTIPKVIGLILDQLKNALAANSVDGQ 174
           S F+D+ RL LLV++D+KLL+ ++ LLTISC+IGM IPK+IGLILD LK+   A + DG 
Sbjct: 158 SNFKDVFRLFLLVKKDYKLLIVSLTLLTISCTIGMMIPKIIGLILDALKSV--ATTPDGG 215

Query: 175 PVSIDKLPPIVFGLSFYEXXXXXXXXXXVGIAANYGRIILLRVLSERLVARLRATVIKKT 234
                  P I+FGL+ YE          +G AANYGR+ILLR+LSERLVARLR+ V+K T
Sbjct: 216 S---SPPPTIMFGLTLYEFLGGFSVALFIGCAANYGRLILLRILSERLVARLRSVVMKHT 272

Query: 235 IHQDAEFFDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGSVGIGMMXXXXXXXX 294
           +HQD+EFFD HKVGDLISRLG+D+Y+VSRS+TQK+SDG K+LICG VGIGMM        
Sbjct: 273 LHQDSEFFDVHKVGDLISRLGADSYIVSRSITQKISDGVKSLICGGVGIGMMLELSMDLS 332

Query: 295 XXXXVFTPPVILSASVFGKQISTTSRELQEATGHLTKVAEEQLSGIKTVQSFVAEQREIN 354
                F  PV+LSAS+FGKQI   SRELQ+ATG LT+V+EEQL+G++TVQSFVAEQREI 
Sbjct: 333 SVLVCFVIPVVLSASIFGKQIRINSRELQDATGQLTRVSEEQLNGVRTVQSFVAEQREIK 392

Query: 355 RYNFAIRDIFNIGKKAAVINAKFFSSTSAMGDLSFLTVLGFGSYLVLQNSLTIGDLTAFM 414
           R+N +IR+IF++GK+AA INAKFF+STS +GDLSFLTVL +GSYLVL  SLTIGDLTAFM
Sbjct: 393 RFNHSIREIFDVGKRAAFINAKFFTSTSLVGDLSFLTVLVYGSYLVLHGSLTIGDLTAFM 452

Query: 415 MYTEYTGNSIFGLSTFYSEIMQGAGAASRLFELTDRVPSISTTKGVKYKPGNGEIEFKNV 474
           +YTEYTGN+IFGLSTFYSEIMQGAGAASRLFELTDRVP+I  T G  Y PG GEIEFKNV
Sbjct: 453 LYTEYTGNAIFGLSTFYSEIMQGAGAASRLFELTDRVPTIRPTLGKTYTPGKGEIEFKNV 512

Query: 475 SFAYPTRPSNMIFKNLNFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPSSGEILIDGQN 534
           SFAYPTRPSN IFK+LNFKI+ GSNVCIVGPSG+GKST+ALLL  YY P+SG+ILIDGQ+
Sbjct: 513 SFAYPTRPSNQIFKSLNFKIKPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQD 572

Query: 535 INDLNSKSLRRHIGLVQQEPILMSGTIRDNIVYGLTEMPTKDEIRQVAKQCFCHNFITRF 594
           I  LNSKSLRR I +VQQEP+LMSGTIRDNI YGLTE PTK+EIR VAKQCFCHNFI +F
Sbjct: 573 ITKLNSKSLRRQIAVVQQEPVLMSGTIRDNITYGLTEEPTKEEIRTVAKQCFCHNFIVKF 632

Query: 595 QSSYDTVIGPHGTLLSGGQKQRIAIARALIKKPRILILDEATSALDVESEGAINYTFGQL 654
             +YDT IGPHGTLLSGGQKQRIAIARALIKKP ILILDEATSALDVESEGAINYTFGQL
Sbjct: 633 PYTYDTYIGPHGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQL 692

Query: 655 MKKKEMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELWDDPTSELSQLLNEKSTP 714
           MK K MTIVSIAHRLSTIRRSEN+IVLG+DGSVVEMGKFKEL+ DPTSELS+LLNEKS+ 
Sbjct: 693 MKSKSMTIVSIAHRLSTIRRSENIIVLGNDGSVVEMGKFKELFADPTSELSKLLNEKSSR 752

Query: 715 HQXXXXXXXXXXXXMAXXXXXXXXXXXXXXXXIEDPGSPPMYISTVSEV--SAEGHE--- 769
            +                                  GS   +  T+ E   + E HE   
Sbjct: 753 KKVVTKTVPPVSSTSVSSAN----------------GSSIHHEGTILEEDHAQEDHESEA 796

Query: 770 ----LINEQIEDTIENVMKDVTSERKPLKLQKDENL 801
               +  +Q+ED+IE+V+ DV++E KP+KL   + L
Sbjct: 797 PPTIITTQQLEDSIESVLNDVSAESKPIKLSPKDPL 832

>TDEL0G04660 Chr7 (850475..852694) [2220 bp, 739 aa] {ON} Anc_6.5
           YPL270W
          Length = 739

 Score =  917 bits (2369), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 448/683 (65%), Positives = 531/683 (77%), Gaps = 31/683 (4%)

Query: 113 NHSEFRDIVRLMLLVRRDWKLLLTAVGLLTISCSIGMTIPKVIGLILDQLKNALAANSVD 172
             S  +D+VRL++L + DWKLL+ A+ LLT+SC IGMTIPKVIG+ILD LK  L  N   
Sbjct: 87  QKSGLKDVVRLLMLAKPDWKLLVIAITLLTVSCGIGMTIPKVIGMILDVLKTGLETNEGK 146

Query: 173 GQPVSIDKLPPIVFGLSFYEXXXXXXXXXXVGIAANYGRIILLRVLSERLVARLRATVIK 232
             P+S+  +PPI  G S YE           GI ANYGRI+LLR+LSER+VARLRA VIK
Sbjct: 147 DGPISMADVPPIFMGYSIYEFLGGFAALMVFGIVANYGRIVLLRILSERVVARLRANVIK 206

Query: 233 KTIHQDAEFFDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGSVGIGMMXXXXXX 292
           KTIHQD+EFFD HKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICG VG+GMM      
Sbjct: 207 KTIHQDSEFFDRHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGGVGVGMMVSISPQ 266

Query: 293 XXXXXXVFTPPVILSASVFGKQISTTSRELQEATGHLTKVAEEQLSGIKTVQSFVAEQRE 352
                 +FTPPV+ SAS+FG++I  TS +LQEATG LT+V+EEQLSG++TVQSFVAEQ+E
Sbjct: 267 LSGLLLLFTPPVLFSASIFGRKIRDTSTDLQEATGQLTRVSEEQLSGVRTVQSFVAEQKE 326

Query: 353 INRYNFAIRDIFNIGKKAAVINAKFFSSTSAMGDLSFLTVLGFGSYLVLQNSLTIGDLTA 412
           I+RY+ AIRDIFN+GK+AA INA+FF++TS++GD+SFL VL +GSYLVLQ  LTIGDLTA
Sbjct: 327 IHRYSHAIRDIFNVGKRAAYINAQFFTATSSLGDISFLVVLAYGSYLVLQGGLTIGDLTA 386

Query: 413 FMMYTEYTGNSIFGLSTFYSEIMQGAGAASRLFELTDRVPSISTTKGVKYKPGNGEIEFK 472
           FM+YTEYTG+S+FGL++FYSE+MQG GAA+RLFELTDRVPSI  T G K+ PG GEI FK
Sbjct: 387 FMLYTEYTGSSVFGLTSFYSELMQGVGAATRLFELTDRVPSIKPTTGKKFVPGKGEIVFK 446

Query: 473 NVSFAYPTRPSNMIFKNLNFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPSSGEILIDG 532
           +V+F+YPTRP N+IF++++ KI AGSNVC+VGPSGRGKST+ALLL ++Y PSSG+I IDG
Sbjct: 447 DVTFSYPTRPGNVIFRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRFYNPSSGQIFIDG 506

Query: 533 QNINDLNSKSLRRHIGLVQQEPILMSGTIRDNIVYGLTEMPTKDEIRQVAKQCFCHNFIT 592
           Q+I+ LN KSLRRHIGLVQQEP+LMSGT+RDNI YGLTE P+K+EIR VAKQCFCHNFI 
Sbjct: 507 QDISKLNIKSLRRHIGLVQQEPVLMSGTLRDNITYGLTETPSKEEIRMVAKQCFCHNFIV 566

Query: 593 RFQSSYDTVIGPHGTLLSGGQKQRIAIARALIKKPRILILDEATSALDVESEGAINYTFG 652
           +F   YDTVIGP G LLSGGQKQRIAIARALIKKP IL+LDEATSALDVESEGAINYTFG
Sbjct: 567 KFPHGYDTVIGPQGALLSGGQKQRIAIARALIKKPTILVLDEATSALDVESEGAINYTFG 626

Query: 653 QLMKKKEMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELWDDPTSELSQLLNEKS 712
           QLMK K +TIVSIAHRLSTIRRSEN+IVLG+DGSVVE GKFKEL+ DP+SELS+LLNEKS
Sbjct: 627 QLMKSKSVTIVSIAHRLSTIRRSENIIVLGNDGSVVETGKFKELFADPSSELSKLLNEKS 686

Query: 713 TPHQXXXXXXXXXXXXMAXXXXXXXXXXXXXXXXIEDPGSPPMYISTVSEVSAEGHELIN 772
           +                                  E P           E  A       
Sbjct: 687 S--------------------RSENSSSSYSPNASEQP-----------EDEANQKNAPE 715

Query: 773 EQIEDTIENVMKDVTSERKPLKL 795
           E  +D++E ++KDVT+E KP+K+
Sbjct: 716 EAHDDSVEEILKDVTAEGKPIKI 738

>NCAS0D02210 Chr4 (410709..413030) [2322 bp, 773 aa] {ON} Anc_6.5
          Length = 773

 Score =  908 bits (2346), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 466/692 (67%), Positives = 538/692 (77%), Gaps = 45/692 (6%)

Query: 115 SEFRDIVRLMLLVRRDWKLLLTAVGLLTISCSIGMTIPKVIGLILDQLKNALAANSVDGQ 174
           S F D++RL LLV+ DWKLLL A+ LLTISC IGM IPKVIG+ILD LK   A  S +G+
Sbjct: 122 SNFSDVIRLFLLVKTDWKLLLVALTLLTISCVIGMMIPKVIGIILDSLKVQTATQS-EGE 180

Query: 175 PVSIDKLPPIV-FGLSFYEXXXXXXXXXXVGIAANYGRIILLRVLSERLVARLRATVIKK 233
               +  PPI+ FGL+ YE           G  AN+GR+ILLR+LSERLVARLR+TVIK+
Sbjct: 181 ----EAPPPIMMFGLTIYEFLGGFSIALLAGCMANFGRLILLRILSERLVARLRSTVIKR 236

Query: 234 TIHQDAEFFDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGSVGIGMMXXXXXXX 293
           TIHQDA+F+D HK GDLISRLG+DAY+VSRS+TQK+SDGFK+LICG VG+GMM       
Sbjct: 237 TIHQDAQFYDIHKTGDLISRLGADAYIVSRSITQKISDGFKSLICGGVGVGMMCSLSLDL 296

Query: 294 XXXXXVFTPPVILSASVFGKQISTTSRELQEATGHLTKVAEEQLSGIKTVQSFVAEQREI 353
                V   PV++SAS+FGKQI   SRELQ+ATG LT+V+EEQL+G+KTVQSFVAEQREI
Sbjct: 297 SAVLGVLIIPVVISASIFGKQIRINSRELQDATGQLTRVSEEQLNGVKTVQSFVAEQREI 356

Query: 354 NRYNFAIRDIFNIGKKAAVINAKFFSSTSAMGDLSFLTVLGFGSYLVLQNSLTIGDLTAF 413
            R+N AIR+IF++GK++A INAKFF+STS +GDLSFLTVL +GSYLVL  SLTIGDLTAF
Sbjct: 357 KRFNEAIRNIFHVGKRSAFINAKFFTSTSLVGDLSFLTVLVYGSYLVLHGSLTIGDLTAF 416

Query: 414 MMYTEYTGNSIFGLSTFYSEIMQGAGAASRLFELTDRVPSISTTKGVKYKPGNGEIEFKN 473
           M+YTEYTGNSIFGLSTFYSEIMQGAGAASRLFELTD VP I  T G  Y PG GEIEFKN
Sbjct: 417 MLYTEYTGNSIFGLSTFYSEIMQGAGAASRLFELTDYVPEIRPTLGKTYLPGKGEIEFKN 476

Query: 474 VSFAYPTRPSNMIFKNLNFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPSSGEILIDGQ 533
           VSF+YPTRP N IFKNLNFKIE GSNVCIVGPSG+GKST+ALLL  YY P+SG+ILIDGQ
Sbjct: 477 VSFSYPTRPQNQIFKNLNFKIEPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQ 536

Query: 534 NINDLNSKSLRRHIGLVQQEPILMSGTIRDNIVYGLTEMPTKDEIRQVAKQCFCHNFITR 593
           +I  +NSKSLRR +G+VQQEP+LMSG+IRDNI YGLT  PTK+EIR+VAKQCFCHNFIT+
Sbjct: 537 DITKMNSKSLRRKLGIVQQEPVLMSGSIRDNITYGLTYTPTKEEIRKVAKQCFCHNFITK 596

Query: 594 FQSSYDTVIGPHGTLLSGGQKQRIAIARALIKKPRILILDEATSALDVESEGAINYTFGQ 653
           F  +YDT IGP GTLLSGGQKQRIAIARALIKKP ILILDEATSALDVESEGAINYTFGQ
Sbjct: 597 FPHTYDTQIGPSGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQ 656

Query: 654 LMKKKEMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELWDDPTSELSQLLNEKST 713
           LMK K MTIVSIAHRLSTIRRSENVIVLG+DGSV+EMGKFKEL+ DP+SELS+LLNEKS+
Sbjct: 657 LMKTKSMTIVSIAHRLSTIRRSENVIVLGNDGSVIEMGKFKELFSDPSSELSKLLNEKSS 716

Query: 714 PHQXXXXXXXXXXXXMAXXXXXXXXXXXXXXXXIEDPGSPPMYISTVSEVSAEGH----E 769
             +                                DP      IS+  EV A+      E
Sbjct: 717 RKKTK-----------------------------SDP------ISSAPEVDADATGEPVE 741

Query: 770 LINEQIEDTIENVMKDVTSERKPLKLQKDENL 801
            I+  IED + +V+ DVTSE KP+K+   + L
Sbjct: 742 PIDPAIEDALHSVLNDVTSESKPIKMSTTDTL 773

>YPL270W Chr16 (30482..32803) [2322 bp, 773 aa] {ON}
           MDL2Mitochondrial inner membrane half-type ATP-binding
           cassette (ABC) transporter, required for respiratory
           growth at high temperature; similar to human TAP1 and
           TAP2 implicated in bare lymphocyte syndrome and
           Wegener-like granulomatosis
          Length = 773

 Score =  908 bits (2346), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 451/599 (75%), Positives = 506/599 (84%), Gaps = 8/599 (1%)

Query: 116 EFRDIVRLMLLVRRDWKLLLTAVGLLTISCSIGMTIPKVIGLILDQLKNALAANSVDGQP 175
           +++DI+RL +L +RDWKLLLTA+ LLTISCSIGM+IPKVIG++LD LK +  ++  D   
Sbjct: 101 DYKDIIRLFMLAKRDWKLLLTAILLLTISCSIGMSIPKVIGIVLDTLKTSSGSDFFDL-- 158

Query: 176 VSIDKLPPIVFGLSFYEXXXXXXXXXXVGIAANYGRIILLRVLSERLVARLRATVIKKTI 235
               K+P  +F L  YE          +G AAN+GR ILLR+LSER+VARLRA VIKKT+
Sbjct: 159 ----KIP--IFSLPLYEFLSFFTVALLIGCAANFGRFILLRILSERVVARLRANVIKKTL 212

Query: 236 HQDAEFFDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGSVGIGMMXXXXXXXXX 295
           HQDAEFFD HKVGDLISRLGSDAYVVSRSMTQKVSDG KALICG VG+GMM         
Sbjct: 213 HQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSLSPQLSI 272

Query: 296 XXXVFTPPVILSASVFGKQISTTSRELQEATGHLTKVAEEQLSGIKTVQSFVAEQREINR 355
               FTPPV+ SASVFGKQI  TS++LQEATG LT+VAEEQLSGIKTVQSFVAE  E++R
Sbjct: 273 LLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSR 332

Query: 356 YNFAIRDIFNIGKKAAVINAKFFSSTSAMGDLSFLTVLGFGSYLVLQNSLTIGDLTAFMM 415
           YN AIRDIF +GK AA  NAKFF++TS +GDLSFLTVL +GSYLVLQ+ L+IGDLTAFM+
Sbjct: 333 YNVAIRDIFQVGKTAAFTNAKFFTTTSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFML 392

Query: 416 YTEYTGNSIFGLSTFYSEIMQGAGAASRLFELTDRVPSISTTKGVKYKPGNGEIEFKNVS 475
           YTEYTGN++FGLSTFYSEIMQGAGAASRLFELTDR PSIS T G KYKP  G IEFK+VS
Sbjct: 393 YTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHKYKPDRGVIEFKDVS 452

Query: 476 FAYPTRPSNMIFKNLNFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPSSGEILIDGQNI 535
           F+YPTRPS  IFKNLNFKI  GS+VCIVGPSGRGKST+ALLL +YY P++G I ID Q+I
Sbjct: 453 FSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTITIDNQDI 512

Query: 536 NDLNSKSLRRHIGLVQQEPILMSGTIRDNIVYGLTEMPTKDEIRQVAKQCFCHNFITRFQ 595
           + LN KSLRRHIG+VQQEP+LMSGTIRDNI YGLT  PTK+EIR VAKQCFCHNFIT+F 
Sbjct: 513 SKLNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFP 572

Query: 596 SSYDTVIGPHGTLLSGGQKQRIAIARALIKKPRILILDEATSALDVESEGAINYTFGQLM 655
           ++YDTVIGPHGTLLSGGQKQRIAIARALIKKP ILILDEATSALDVESEGAINYTFGQLM
Sbjct: 573 NTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQLM 632

Query: 656 KKKEMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELWDDPTSELSQLLNEKSTP 714
           K K MTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKEL+ +PTS LSQLLNEK+ P
Sbjct: 633 KSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANPTSALSQLLNEKAAP 691

>Kpol_1045.83 s1045 (193070..195316) [2247 bp, 748 aa] {ON}
           (193072..195318) [2247 nt, 749 aa]
          Length = 748

 Score =  902 bits (2332), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 431/598 (72%), Positives = 504/598 (84%), Gaps = 5/598 (0%)

Query: 116 EFRDIVRLMLLVRRDWKLLLTAVGLLTISCSIGMTIPKVIGLILDQLKNALAANSVDGQP 175
           E  D+ RL  L +RDWKLLLTA+ LL++SC IGM++PK+IG++LD+LK  ++        
Sbjct: 98  ELSDLKRLARLAKRDWKLLLTAISLLSVSCLIGMSLPKIIGIVLDELKQIMS-----NPD 152

Query: 176 VSIDKLPPIVFGLSFYEXXXXXXXXXXVGIAANYGRIILLRVLSERLVARLRATVIKKTI 235
            ++D +P I FGL+ YE          VG AANYGR+ILLRVLSER+VARLRA VIKKT+
Sbjct: 153 FTVDDVPEIAFGLNLYEFISLVGVSLLVGTAANYGRVILLRVLSERVVARLRANVIKKTM 212

Query: 236 HQDAEFFDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGSVGIGMMXXXXXXXXX 295
           HQDAEFFD +KVGDLISRL SDAYVVSRS+TQKVSDGFKA++CGSVGIGMM         
Sbjct: 213 HQDAEFFDNNKVGDLISRLSSDAYVVSRSLTQKVSDGFKAMLCGSVGIGMMISISPQLSA 272

Query: 296 XXXVFTPPVILSASVFGKQISTTSRELQEATGHLTKVAEEQLSGIKTVQSFVAEQREINR 355
                TPPV+LSAS FG+ I   SR+LQEATG LTKVAEEQ SGIKTVQSFVAEQ+EI R
Sbjct: 273 FLLFLTPPVMLSASYFGRLIRNNSRDLQEATGSLTKVAEEQFSGIKTVQSFVAEQKEIKR 332

Query: 356 YNFAIRDIFNIGKKAAVINAKFFSSTSAMGDLSFLTVLGFGSYLVLQNSLTIGDLTAFMM 415
           YN AIR IFN+GK++A INAKFFS T+ +GD+SFL VL +GSYLVL  SL+IGDLTA+MM
Sbjct: 333 YNHAIRHIFNVGKQSAFINAKFFSLTAVLGDMSFLVVLAYGSYLVLHGSLSIGDLTAYMM 392

Query: 416 YTEYTGNSIFGLSTFYSEIMQGAGAASRLFELTDRVPSISTTKGVKYKPGNGEIEFKNVS 475
           YTEYTG+SIFGLSTFYSEIMQGAGAASRLFELTDR+PSIS T G K+ P  GEIEFKNVS
Sbjct: 393 YTEYTGSSIFGLSTFYSEIMQGAGAASRLFELTDRIPSISPTLGKKFVPNKGEIEFKNVS 452

Query: 476 FAYPTRPSNMIFKNLNFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPSSGEILIDGQNI 535
           F+YPTR SN IFKNL+FKI+AGSNVCIVGPSGRGKST+A LL +YY P++G+I +DGQ+I
Sbjct: 453 FSYPTRASNQIFKNLSFKIDAGSNVCIVGPSGRGKSTIASLLLRYYNPTTGQIFVDGQDI 512

Query: 536 NDLNSKSLRRHIGLVQQEPILMSGTIRDNIVYGLTEMPTKDEIRQVAKQCFCHNFITRFQ 595
           + ++SKSLRRH+ +VQQEP+LMSGTIRDNI YGL E PT+DE+R + K+CFCHNFIT+F 
Sbjct: 513 SKVSSKSLRRHMSIVQQEPVLMSGTIRDNITYGLVEKPTQDEVRSITKKCFCHNFITKFP 572

Query: 596 SSYDTVIGPHGTLLSGGQKQRIAIARALIKKPRILILDEATSALDVESEGAINYTFGQLM 655
           +SYDT++GPHGTLLSGGQKQRIAIARALIKKP ILILDEATSALDVESEGAINYTFG+LM
Sbjct: 573 NSYDTILGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGKLM 632

Query: 656 KKKEMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELWDDPTSELSQLLNEKST 713
           K K +TI+SIAHRLSTIRRSENVIVLG+DGSV E+GKFKEL+ DP SELS+LL+EK+T
Sbjct: 633 KSKSITIISIAHRLSTIRRSENVIVLGNDGSVAEVGKFKELYADPGSELSKLLHEKAT 690

>Suva_16.35 Chr16 (46072..48375) [2304 bp, 767 aa] {ON} YPL270W
           (REAL)
          Length = 767

 Score =  901 bits (2328), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 459/684 (67%), Positives = 530/684 (77%), Gaps = 22/684 (3%)

Query: 116 EFRDIVRLMLLVRRDWKLLLTAVGLLTISCSIGMTIPKVIGLILDQLKNALAANSVDGQP 175
           +++DI+RL +L +RDWKLLLTA+ LLTISCSIGM+IPKVIG++LD LK +  ++  D   
Sbjct: 98  DYKDIIRLFMLAKRDWKLLLTAILLLTISCSIGMSIPKVIGIVLDTLKTSSGSDFFDL-- 155

Query: 176 VSIDKLPPIVFGLSFYEXXXXXXXXXXVGIAANYGRIILLRVLSERLVARLRATVIKKTI 235
               K+P  +F L  YE          +G  AN+GR ILLR+LSER+VARLRA VIKKT+
Sbjct: 156 ----KIP--IFSLPLYEFLSFFTVALLIGCVANFGRFILLRILSERVVARLRAHVIKKTL 209

Query: 236 HQDAEFFDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGSVGIGMMXXXXXXXXX 295
           HQDAEFFD HKVGDLISRLGSDAYVVSRSMTQKVSDG KALICG VG+GMM         
Sbjct: 210 HQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSLSPQLSV 269

Query: 296 XXXVFTPPVILSASVFGKQISTTSRELQEATGHLTKVAEEQLSGIKTVQSFVAEQREINR 355
               FTPPV+ SASVFGKQI  TS++LQEATG LT+VAEEQLSGIKTVQSFVAE  E++R
Sbjct: 270 LLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSR 329

Query: 356 YNFAIRDIFNIGKKAAVINAKFFSSTSAMGDLSFLTVLGFGSYLVLQNSLTIGDLTAFMM 415
           YN AIRDIF +GK AA  NAKFF++TS +GDLSFLTVL +GSYLVLQ+ L+IGDLTAFM+
Sbjct: 330 YNVAIRDIFQVGKTAAFTNAKFFTTTSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFML 389

Query: 416 YTEYTGNSIFGLSTFYSEIMQGAGAASRLFELTDRVPSISTTKGVKYKPGNGEIEFKNVS 475
           YTEYTGN++FGLSTFYSEIMQGAGAASRLFELTDR PSIS T G KYKP  G IEFK+VS
Sbjct: 390 YTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHKYKPDRGVIEFKDVS 449

Query: 476 FAYPTRPSNMIFKNLNFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPSSGEILIDGQNI 535
           F+YPTRPS  IFK+LNFKI  GS+VCIVGPSGRGKST+ALLL +YY P++G I+ID Q+I
Sbjct: 450 FSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDI 509

Query: 536 NDLNSKSLRRHIGLVQQEPILMSGTIRDNIVYGLTEMPTKDEIRQVAKQCFCHNFITRFQ 595
             +N KSLRRHIG+VQQEP+LMSGTIRDNI YGLT  PTK+EIR VAKQCFCHNFIT+F 
Sbjct: 510 TKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFP 569

Query: 596 SSYDTVIGPHGTLLSGGQKQRIAIARALIKKPRILILDEATSALDVESEGAINYTFGQLM 655
           ++YDTVIGP+GTLLSGGQKQRIAIARALIKKP +LILDEATSALDVESEGAINYTFGQLM
Sbjct: 570 NTYDTVIGPNGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLM 629

Query: 656 KKKEMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELWDDPTSELSQLLNEKSTP- 714
           K K MTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKEL+ +PTS LSQLLNE++ P 
Sbjct: 630 KSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYSNPTSALSQLLNERTAPV 689

Query: 715 ---HQXXXXXXXXXXXXMAXXXXXXXXXXXXXXXXIEDPGSPPMYISTVSEVSAEGHELI 771
               Q                                D  + P+          E  +  
Sbjct: 690 PSEQQQQVEKDNEKEEPNEDENHDQRNEGDDGSNHDNDSNNKPL----------ESKDKK 739

Query: 772 NEQIEDTIENVMKDVTSERKPLKL 795
           ++ IE+++E+V+KD   E  P+KL
Sbjct: 740 SDDIEESVEHVLKDAAKEANPIKL 763

>Smik_6.478 Chr6 complement(788399..790720) [2322 bp, 773 aa] {ON}
           YPL270W (REAL)
          Length = 773

 Score =  897 bits (2317), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 446/599 (74%), Positives = 504/599 (84%), Gaps = 8/599 (1%)

Query: 116 EFRDIVRLMLLVRRDWKLLLTAVGLLTISCSIGMTIPKVIGLILDQLKNALAANSVDGQP 175
           +++DI+RL +L +RDWKLLLTA+ LLTISCSIGM+IPKVIG++LD LK +  ++  D   
Sbjct: 101 DYKDIIRLFMLAKRDWKLLLTAILLLTISCSIGMSIPKVIGIVLDTLKTSSGSDFFDL-- 158

Query: 176 VSIDKLPPIVFGLSFYEXXXXXXXXXXVGIAANYGRIILLRVLSERLVARLRATVIKKTI 235
               K+P  +F L  YE          +G AAN+GR ILLR+LSER+VARLRA VIKKT+
Sbjct: 159 ----KIP--IFSLPLYEFLSFFTVALLIGCAANFGRFILLRILSERVVARLRAHVIKKTL 212

Query: 236 HQDAEFFDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGSVGIGMMXXXXXXXXX 295
           HQDAEFFD HKVGDLISRLGSDAYVVSRSMTQKVSDG KALICG VG+GMM         
Sbjct: 213 HQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGIVGVGMMCSLSPQLSI 272

Query: 296 XXXVFTPPVILSASVFGKQISTTSRELQEATGHLTKVAEEQLSGIKTVQSFVAEQREINR 355
               FTPPV+ SASVFGKQI  TS++LQEATG LT+VAEEQLSGIKTVQSFVAE  E++R
Sbjct: 273 LLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSR 332

Query: 356 YNFAIRDIFNIGKKAAVINAKFFSSTSAMGDLSFLTVLGFGSYLVLQNSLTIGDLTAFMM 415
           YN AIRDIF +GK AA  NAKFF++TS +GDLSFLTVL +GSYLVLQ+ L+IGDLTAFM+
Sbjct: 333 YNVAIRDIFQVGKTAAFTNAKFFTTTSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFML 392

Query: 416 YTEYTGNSIFGLSTFYSEIMQGAGAASRLFELTDRVPSISTTKGVKYKPGNGEIEFKNVS 475
           YTEYTGN++FGLSTFYSEIMQGAGAASRLFELTDR PSIS T G KY+P  G IEFK+VS
Sbjct: 393 YTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHKYQPERGVIEFKDVS 452

Query: 476 FAYPTRPSNMIFKNLNFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPSSGEILIDGQNI 535
           F+YPTRPS  IFK+LNFKI  GS+VCIVGPSGRGKST+ALLL +YY P++G I+ID Q+I
Sbjct: 453 FSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDI 512

Query: 536 NDLNSKSLRRHIGLVQQEPILMSGTIRDNIVYGLTEMPTKDEIRQVAKQCFCHNFITRFQ 595
             LN KSLRR IG+VQQEP+LMSGTIRDNI YGLT  PTK+EIR VAKQCFCHNFIT+F 
Sbjct: 513 TKLNCKSLRRQIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFP 572

Query: 596 SSYDTVIGPHGTLLSGGQKQRIAIARALIKKPRILILDEATSALDVESEGAINYTFGQLM 655
           ++YDTVIGPHGTLLSGGQKQRIAIARALIKKP ILILDEATSALDVESEGAINYTFGQLM
Sbjct: 573 NTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQLM 632

Query: 656 KKKEMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELWDDPTSELSQLLNEKSTP 714
           K K MTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKEL+ + TS LSQLLNE++ P
Sbjct: 633 KSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANSTSALSQLLNERAAP 691

>Skud_16.7 Chr16 (9624..11945) [2322 bp, 773 aa] {ON} YPL270W (REAL)
          Length = 773

 Score =  893 bits (2308), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 443/599 (73%), Positives = 503/599 (83%), Gaps = 8/599 (1%)

Query: 116 EFRDIVRLMLLVRRDWKLLLTAVGLLTISCSIGMTIPKVIGLILDQLKNALAANSVDGQP 175
           +++DI+RL +L +RDWKLLLTA+ LLTISCSIGM+IPKVIG++LD LK +  ++  +   
Sbjct: 101 DYKDIIRLFMLAKRDWKLLLTAILLLTISCSIGMSIPKVIGIVLDTLKTSSGSDFFEL-- 158

Query: 176 VSIDKLPPIVFGLSFYEXXXXXXXXXXVGIAANYGRIILLRVLSERLVARLRATVIKKTI 235
               K+P  +F L  YE          +G AAN+GR ILLR+LSER+VARLRA VIKKT+
Sbjct: 159 ----KIP--IFSLPLYEFLSFFTVALLIGCAANFGRFILLRILSERVVARLRAHVIKKTL 212

Query: 236 HQDAEFFDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGSVGIGMMXXXXXXXXX 295
           HQDAEFFD HKVGDLISRLGSDAYVVSRSMTQKVSDG KALICG VG+GMM         
Sbjct: 213 HQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSLSPQLSI 272

Query: 296 XXXVFTPPVILSASVFGKQISTTSRELQEATGHLTKVAEEQLSGIKTVQSFVAEQREINR 355
               FTPPV+ SASVFGKQI  TS++LQEATG LT+VAEEQLSGIKTVQSFVAE  E++R
Sbjct: 273 LLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSR 332

Query: 356 YNFAIRDIFNIGKKAAVINAKFFSSTSAMGDLSFLTVLGFGSYLVLQNSLTIGDLTAFMM 415
           YN AIRDIF +GK AA  NAKFF++TS +GDLSFLTVL +GSYLVLQ+ L+IGDLTAFM+
Sbjct: 333 YNVAIRDIFQVGKTAAFTNAKFFTTTSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFML 392

Query: 416 YTEYTGNSIFGLSTFYSEIMQGAGAASRLFELTDRVPSISTTKGVKYKPGNGEIEFKNVS 475
           YTEYTGN++FGLSTFYSEIMQGAGAASRLFELTDR PSIS T G KYKP  G +EFK+VS
Sbjct: 393 YTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTAGHKYKPHRGVVEFKDVS 452

Query: 476 FAYPTRPSNMIFKNLNFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPSSGEILIDGQNI 535
           F+YPTRPS  IFKNLNFKI  GS+VCIVGPSGRGKST+ALLL +YY PS+G I+ID Q+I
Sbjct: 453 FSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPSTGTIMIDDQDI 512

Query: 536 NDLNSKSLRRHIGLVQQEPILMSGTIRDNIVYGLTEMPTKDEIRQVAKQCFCHNFITRFQ 595
             +N KSLRRHIG+VQQEP+LMSGTIRDNI YGLT  PTK+EIR VAKQCFCHNFIT+F 
Sbjct: 513 TKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFP 572

Query: 596 SSYDTVIGPHGTLLSGGQKQRIAIARALIKKPRILILDEATSALDVESEGAINYTFGQLM 655
           ++YDTVIG  GTLLSGGQKQRIAIARALIKKP ILILDEATSALDVESEGAINYTFG LM
Sbjct: 573 NTYDTVIGSRGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGHLM 632

Query: 656 KKKEMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELWDDPTSELSQLLNEKSTP 714
           K K MTI+SIAHRLSTIRRSENVIVLGHDGSVVEMGKFK+L+ +PTS LSQLLNE++ P
Sbjct: 633 KSKSMTIISIAHRLSTIRRSENVIVLGHDGSVVEMGKFKKLYANPTSALSQLLNERAAP 691

>ZYRO0F00396g Chr6 complement(39330..41528) [2199 bp, 732 aa] {ON}
           similar to uniprot|P33311 Saccharomyces cerevisiae
           YPL270W MDL2 Half-type ATP-binding cassette (ABC)
           transporter of the inner mitochondrial membrane
          Length = 732

 Score =  887 bits (2292), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 441/689 (64%), Positives = 527/689 (76%), Gaps = 39/689 (5%)

Query: 114 HSEFRDIVRLMLLVRRDWKLLLTAVGLLTISCSIGMTIPKVIGLILDQLKNALAANSVDG 173
            S ++D VRL  L +RDW+LL  A+ LLTISC IGM+IPKVIGL+LD L+  +     D 
Sbjct: 74  ESSYKDAVRLFSLAKRDWRLLCAAIALLTISCVIGMSIPKVIGLVLDVLRKGIEGK--DL 131

Query: 174 QPVSIDKLPPIVFGLSFYEXXXXXXXXXXVGIAANYGRIILLRVLSERLVARLRATVIKK 233
           Q V++D L PI FGL+ Y+          VG AAN+ RI++LR+LSER+VARLR+ V+ K
Sbjct: 132 QNVNMDDLGPIAFGLTIYQFLGVFAGLLLVGTAANFARIVMLRILSERVVARLRSGVMNK 191

Query: 234 TIHQDAEFFDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGSVGIGMMXXXXXXX 293
           T+HQD+EF+DTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICG VGIGMM       
Sbjct: 192 TLHQDSEFYDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGGVGIGMMVSISPEL 251

Query: 294 XXXXXVFTPPVILSASVFGKQISTTSRELQEATGHLTKVAEEQLSGIKTVQSFVAEQREI 353
                 F PP++ SASVFGK+I  TS++LQEATG LT+VAEEQLSG+KTVQSFVAEQRE+
Sbjct: 252 SGVLLFFAPPILWSASVFGKKIRHTSKDLQEATGQLTRVAEEQLSGVKTVQSFVAEQREL 311

Query: 354 NRYNFAIRDIFNIGKKAAVINAKFFSSTSAMGDLSFLTVLGFGSYLVLQNSLTIGDLTAF 413
           +RYN AIR I+N+G+KAA INA+FF+ST+ +GD+SF+ VL +GSYLVLQ SLTIGDLTAF
Sbjct: 312 HRYNGAIRGIYNVGRKAAFINAEFFTSTTMLGDMSFIVVLLYGSYLVLQGSLTIGDLTAF 371

Query: 414 MMYTEYTGNSIFGLSTFYSEIMQGAGAASRLFELTDRVPSISTTKGVKYKPGNGEIEFKN 473
           M+YTEYTG+S+FGL+TFYSE+MQG GAASRLF+LTD + SIS TKG KY PG G+IEFKN
Sbjct: 372 MLYTEYTGSSVFGLTTFYSELMQGVGAASRLFDLTDHISSISPTKGQKYIPGKGDIEFKN 431

Query: 474 VSFAYPTRPSNMIFKNLNFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPSSGEILIDGQ 533
           VSF+YPTRP N IFK++N K+  GSNVCIVGPSGRGKST+ALLL +YY P++G+IL+DGQ
Sbjct: 432 VSFSYPTRPENQIFKDINIKVPPGSNVCIVGPSGRGKSTIALLLLRYYNPTNGQILVDGQ 491

Query: 534 NINDLNSKSLRRHIGLVQQEPILMSGTIRDNIVYGLTEMPTKDEIRQVAKQCFCHNFITR 593
           +I+ +N K+LRRHIGLVQQEPILMSGTIRDNI YGL E  TK+EIR VAKQCFCHNFIT+
Sbjct: 492 DISKVNCKTLRRHIGLVQQEPILMSGTIRDNITYGLAEPATKEEIRSVAKQCFCHNFITK 551

Query: 594 FQSSYDTVIGPHGTLLSGGQKQRIAIARALIKKPRILILDEATSALDVESEGAINYTFGQ 653
           F   YDT+IG  G LLSGGQ+QRIAIARALIKKP IL+LDEATSALDVESEGAINYTFGQ
Sbjct: 552 FPDGYDTMIGAQGALLSGGQRQRIAIARALIKKPNILVLDEATSALDVESEGAINYTFGQ 611

Query: 654 LMKKKEMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELWDDPTSELSQLLNEKST 713
           LMK   MTIVSIAHRLSTI+RSENVIVLG DGSV+E GKFKEL+ +P SEL +LL EKS+
Sbjct: 612 LMKSGSMTIVSIAHRLSTIKRSENVIVLGKDGSVIEAGKFKELFANPNSELCKLLTEKSS 671

Query: 714 PHQXXXXXXXXXXXXMAXXXXXXXXXXXXXXXXIEDPGSPPMYISTVSEVSAEGHELINE 773
                                              D   PP   +T  +V  +  E I E
Sbjct: 672 RSDG------------------------------NDSLPPPPPNATQDKVVEQIAEKILE 701

Query: 774 QIED-------TIENVMKDVTSERKPLKL 795
           +  +       T++ + KDV+SE KP+K+
Sbjct: 702 RFPEAGQSPDATVKEIFKDVSSEGKPIKI 730

>TPHA0J00220 Chr10 complement(51873..54095) [2223 bp, 740 aa] {ON}
           Anc_6.5 YPL270W
          Length = 740

 Score =  886 bits (2289), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 429/604 (71%), Positives = 504/604 (83%), Gaps = 7/604 (1%)

Query: 119 DIVRLMLLVRRDWKLLLTAVGLLTISCSIGMTIPKVIGLILDQLKNALAANSVDGQPVSI 178
           DI RL+ L ++DWKLL  AVGLLT+SC+IGM++PKVIG++LD LKNA++  S D +  S 
Sbjct: 76  DIKRLLSLAKKDWKLLCIAVGLLTVSCTIGMSLPKVIGMVLDLLKNAIS-KSEDAELGSA 134

Query: 179 D------KLPPIVFGLSFYEXXXXXXXXXXVGIAANYGRIILLRVLSERLVARLRATVIK 232
           D      +LPPI FGLS YE          +G AAN+GR++LLRVLSER+VARLR+ VIK
Sbjct: 135 DLSIESSELPPIAFGLSLYEFLGCIGAALLIGTAANFGRVVLLRVLSERVVARLRSQVIK 194

Query: 233 KTIHQDAEFFDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGSVGIGMMXXXXXX 292
           KTIHQDAEFFD +KVGDLISRLGSDAYVVSRSMTQKVSDGFKAL+CG VG+GMM      
Sbjct: 195 KTIHQDAEFFDNNKVGDLISRLGSDAYVVSRSMTQKVSDGFKALLCGGVGVGMMVSISPE 254

Query: 293 XXXXXXVFTPPVILSASVFGKQISTTSRELQEATGHLTKVAEEQLSGIKTVQSFVAEQRE 352
                  FTPPV+LS+  FG+ I   SR+LQEATG LT+V+EEQ SG+KTVQ+FVAEQRE
Sbjct: 255 LSAFLLFFTPPVMLSSMYFGRLIRDNSRKLQEATGQLTRVSEEQFSGVKTVQAFVAEQRE 314

Query: 353 INRYNFAIRDIFNIGKKAAVINAKFFSSTSAMGDLSFLTVLGFGSYLVLQNSLTIGDLTA 412
           I RYN  I+D++N+GK++A INAK F+ TS++GD+SFL VL +GSYLVL   L+IGDLTA
Sbjct: 315 IKRYNNVIKDVYNVGKESAFINAKLFTITSSLGDMSFLLVLAYGSYLVLHGGLSIGDLTA 374

Query: 413 FMMYTEYTGNSIFGLSTFYSEIMQGAGAASRLFELTDRVPSISTTKGVKYKPGNGEIEFK 472
           +MMYTE TG+++FGLS+FYSEIMQG GAASRLFELTDR+P IS T G KY PG GEIEFK
Sbjct: 375 YMMYTELTGSAVFGLSSFYSEIMQGVGAASRLFELTDRIPMISPTTGKKYIPGKGEIEFK 434

Query: 473 NVSFAYPTRPSNMIFKNLNFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPSSGEILIDG 532
           NVSFAYPTRP + IFK+LNFKIE GSNVCIVGPSGRGKST+A LL KYYKP++G I +DG
Sbjct: 435 NVSFAYPTRPGSQIFKSLNFKIEPGSNVCIVGPSGRGKSTIASLLLKYYKPTAGTITVDG 494

Query: 533 QNINDLNSKSLRRHIGLVQQEPILMSGTIRDNIVYGLTEMPTKDEIRQVAKQCFCHNFIT 592
           Q+I+ LNSKSLRRHIG+VQQEPILMSG+IRDNI YGLT   T +EIR+V KQCFCHNFIT
Sbjct: 495 QDISKLNSKSLRRHIGIVQQEPILMSGSIRDNITYGLTYEATAEEIRRVTKQCFCHNFIT 554

Query: 593 RFQSSYDTVIGPHGTLLSGGQKQRIAIARALIKKPRILILDEATSALDVESEGAINYTFG 652
           +F   Y T++GP+GTLLSGGQKQRIAIARAL+KKP +LILDEATSALDVESE AINYTFG
Sbjct: 555 KFPDQYQTILGPNGTLLSGGQKQRIAIARALLKKPNVLILDEATSALDVESESAINYTFG 614

Query: 653 QLMKKKEMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELWDDPTSELSQLLNEKS 712
           +LMKKKE+TI+SIAHRLSTIRRSE VIVLG+DGSVVE+GKFK L+ +P SELSQLLNEKS
Sbjct: 615 KLMKKKEVTIISIAHRLSTIRRSEIVIVLGNDGSVVEIGKFKTLFGNPLSELSQLLNEKS 674

Query: 713 TPHQ 716
           T ++
Sbjct: 675 TINE 678

>SAKL0E00748g Chr5 complement(50683..53007) [2325 bp, 774 aa] {ON}
           similar to uniprot|P33311 Saccharomyces cerevisiae
           YPL270W MDL2 Half-type ATP-binding cassette (ABC)
           transporter of the inner mitochondrial membrane
          Length = 774

 Score =  857 bits (2214), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 405/596 (67%), Positives = 491/596 (82%), Gaps = 3/596 (0%)

Query: 117 FRDIVRLMLLVRRDWKLLLTAVGLLTISCSIGMTIPKVIGLILDQLKNALAANSVDGQPV 176
           +++I RL  L R DWKLLL A+ LLTISCSIGM +PKVIG++LD  KNA+ +   D +P 
Sbjct: 124 YKEIFRLFRLARHDWKLLLVAISLLTISCSIGMAVPKVIGMVLDVAKNAITS---DEKPK 180

Query: 177 SIDKLPPIVFGLSFYEXXXXXXXXXXVGIAANYGRIILLRVLSERLVARLRATVIKKTIH 236
            +  LPP+V+GL  Y+          +   AN+GR++LLR+L E+LVARLR+ VIKKTIH
Sbjct: 181 DLRDLPPVVWGLGLYDFLAVFAGALVLSTFANFGRVVLLRILGEKLVARLRSNVIKKTIH 240

Query: 237 QDAEFFDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGSVGIGMMXXXXXXXXXX 296
           QDAEFFD +KVGDLISRL SDAYVVSRSMTQ +SDGFKA+ICG VGIGMM          
Sbjct: 241 QDAEFFDRNKVGDLISRLSSDAYVVSRSMTQNISDGFKAIICGGVGIGMMFHISSTLATA 300

Query: 297 XXVFTPPVILSASVFGKQISTTSRELQEATGHLTKVAEEQLSGIKTVQSFVAEQREINRY 356
             +F PP+++ A+++G++I + SR+LQ++TG+LTKVAEEQLSG+KTVQSFVAEQ+EI RY
Sbjct: 301 LFLFAPPLLVGATIYGRKIRSISRDLQQSTGNLTKVAEEQLSGVKTVQSFVAEQKEIKRY 360

Query: 357 NFAIRDIFNIGKKAAVINAKFFSSTSAMGDLSFLTVLGFGSYLVLQNSLTIGDLTAFMMY 416
           N AIR +F++GK+ A+ NA FFSSTS +GD SFL VL +GS+LVLQ SL+IGDLTAFM+Y
Sbjct: 361 NHAIRKVFDVGKREALTNATFFSSTSVLGDFSFLIVLAYGSHLVLQGSLSIGDLTAFMLY 420

Query: 417 TEYTGNSIFGLSTFYSEIMQGAGAASRLFELTDRVPSISTTKGVKYKPGNGEIEFKNVSF 476
           TEY+G+++FGLS FYSE+M+GAGAASRLFELTD  PSI  TKGV Y PG GEI+F+NVSF
Sbjct: 421 TEYSGSAVFGLSNFYSELMKGAGAASRLFELTDHQPSIYATKGVPYVPGKGEIKFENVSF 480

Query: 477 AYPTRPSNMIFKNLNFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPSSGEILIDGQNIN 536
           +YPTR +N IF NLNF I++GSNVC+VGPSGRGKST+A LL KYY P+SG I IDGQ+I+
Sbjct: 481 SYPTRSANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRITIDGQDIS 540

Query: 537 DLNSKSLRRHIGLVQQEPILMSGTIRDNIVYGLTEMPTKDEIRQVAKQCFCHNFITRFQS 596
            +++KSLRRH+G+VQQEPILMSG+IRDNI YG+   PT DEIR V+K+CFCHNFIT+F  
Sbjct: 541 KISAKSLRRHLGVVQQEPILMSGSIRDNITYGVPYTPTIDEIRSVSKKCFCHNFITKFSD 600

Query: 597 SYDTVIGPHGTLLSGGQKQRIAIARALIKKPRILILDEATSALDVESEGAINYTFGQLMK 656
            Y+TVIGP G LLSGGQKQRIAIARALIKKP ILILDEATSALDVESEGAINYT GQLMK
Sbjct: 601 GYETVIGPKGALLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTLGQLMK 660

Query: 657 KKEMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELWDDPTSELSQLLNEKS 712
            +++TI+SIAHRLSTIRRSENVIVLG DGSVVEMGKFKEL+    S+L +LLNEK+
Sbjct: 661 SRDITIISIAHRLSTIRRSENVIVLGDDGSVVEMGKFKELYASKESKLYKLLNEKA 716

>TBLA0A07190 Chr1 complement(1792994..1795378) [2385 bp, 794 aa]
           {ON} Anc_6.5 YPL270W
          Length = 794

 Score =  852 bits (2201), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 420/597 (70%), Positives = 494/597 (82%), Gaps = 7/597 (1%)

Query: 119 DIVRLMLLVRRDWKLLLTAVGLLTISCSIGMTIPKVIGLILDQLKNALAANSVDGQPVSI 178
           ++ RL+L+  RDWKLLL A+ LLTISCSIGM IPKVIGL+LD LKN +  +     P S+
Sbjct: 147 ELARLVLMTLRDWKLLLLAITLLTISCSIGMAIPKVIGLVLDALKNVMTDS-----PSSL 201

Query: 179 D--KLPPIVFGLSFYEXXXXXXXXXXVGIAANYGRIILLRVLSERLVARLRATVIKKTIH 236
           +   LPPI FGL+ Y           +G   NYGR ILLR+LSER+VARLR+ VIKKT+H
Sbjct: 202 ETSDLPPIAFGLTLYPFLGAFAGALVIGTMCNYGRYILLRLLSERVVARLRSHVIKKTLH 261

Query: 237 QDAEFFDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGSVGIGMMXXXXXXXXXX 296
           QDAEFFD +KVGDLISRLGSDAYVVSRS+TQKVSDGFKA++CG  GIGMM          
Sbjct: 262 QDAEFFDQNKVGDLISRLGSDAYVVSRSLTQKVSDGFKAILCGGAGIGMMISISPQLSSF 321

Query: 297 XXVFTPPVILSASVFGKQISTTSRELQEATGHLTKVAEEQLSGIKTVQSFVAEQREINRY 356
             +F P V++SAS+FGK+I   S  LQEATG LT+V+EEQL+G+KTVQSFVAEQ+EI RY
Sbjct: 322 LVIFAPAVVISASIFGKKIRDISTILQEATGQLTRVSEEQLNGVKTVQSFVAEQKEIRRY 381

Query: 357 NFAIRDIFNIGKKAAVINAKFFSSTSAMGDLSFLTVLGFGSYLVLQNSLTIGDLTAFMMY 416
           N AIRDI+NIGK +AV+N+KF +STS +GD+SFL VL +GSYLVL  SLTIGDLTAFM+Y
Sbjct: 382 NNAIRDIYNIGKMSAVVNSKFSTSTSVIGDMSFLVVLAYGSYLVLHGSLTIGDLTAFMLY 441

Query: 417 TEYTGNSIFGLSTFYSEIMQGAGAASRLFELTDRVPSISTTKGVKYKPGNGEIEFKNVSF 476
           T+YT NSIFGLS FYSEIMQG GAA RLF+LTDR+P+I  T G K+ PG+G IEF+N+ F
Sbjct: 442 TDYTANSIFGLSNFYSEIMQGVGAAKRLFDLTDRIPAIRPTIGEKFIPGDGCIEFRNLGF 501

Query: 477 AYPTRPSNMIFKNLNFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPSSGEILIDGQNIN 536
           AYPTRP N +FKNLNFKIE G++VCIVGPSGRGKST+ALLL +YY PSSG+ILID Q+I 
Sbjct: 502 AYPTRPENQVFKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYYNPSSGQILIDNQDIM 561

Query: 537 DLNSKSLRRHIGLVQQEPILMSGTIRDNIVYGLTEMPTKDEIRQVAKQCFCHNFITRFQS 596
            LN KSLR+++G+VQQEP+LMSG+IRDNI YGL    T DEIR+V+KQCFCHNFIT+F  
Sbjct: 562 KLNPKSLRQYMGIVQQEPVLMSGSIRDNITYGLKREATPDEIREVSKQCFCHNFITKFPD 621

Query: 597 SYDTVIGPHGTLLSGGQKQRIAIARALIKKPRILILDEATSALDVESEGAINYTFGQLMK 656
           +Y+T+IGPHGTLLSGGQKQRIAIARALIKKP+ILILDEATSALDVESEGAINYTFG+LMK
Sbjct: 622 AYETIIGPHGTLLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAINYTFGKLMK 681

Query: 657 KKEMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELWDDPTSELSQLLNEKST 713
            K +TIVSIAHRLSTIRRSE +IVLG+DGSVVE GKFKEL+ DPTSELS+LLNEK +
Sbjct: 682 SKSVTIVSIAHRLSTIRRSEYIIVLGNDGSVVETGKFKELYADPTSELSKLLNEKQS 738

>KLTH0C11616g Chr3 (956011..958233) [2223 bp, 740 aa] {ON} similar
           to uniprot|P33311 Saccharomyces cerevisiae YPL270W MDL2
           Half-type ATP-binding cassette (ABC) transporter of the
           inner mitochondrial membrane
          Length = 740

 Score =  822 bits (2122), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 393/597 (65%), Positives = 481/597 (80%), Gaps = 3/597 (0%)

Query: 115 SEFRDIVRLMLLVRRDWKLLLTAVGLLTISCSIGMTIPKVIGLILDQLKNALAANSVDGQ 174
           + +R+I+RL+ L R DWKLL  A+GLLTIS ++GMTIPKVIG++LD +KNA    S    
Sbjct: 104 TNYREILRLIRLARHDWKLLSVAIGLLTISSTVGMTIPKVIGIVLDAVKNASGGFS---G 160

Query: 175 PVSIDKLPPIVFGLSFYEXXXXXXXXXXVGIAANYGRIILLRVLSERLVARLRATVIKKT 234
           P++++ LPPI++GL  ++           G  AN+GRI+LLRVL E+LVARLR+ VIKK 
Sbjct: 161 PMTLEDLPPIIYGLGMFDFLAIFAGILVFGTIANFGRIVLLRVLGEKLVARLRSNVIKKI 220

Query: 235 IHQDAEFFDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGSVGIGMMXXXXXXXX 294
           IHQDAEFFD +KVGDLISRL SDAYVVSRSMTQ VSDGFKA+ICG VGIGMM        
Sbjct: 221 IHQDAEFFDRNKVGDLISRLSSDAYVVSRSMTQNVSDGFKAIICGGVGIGMMINISASLT 280

Query: 295 XXXXVFTPPVILSASVFGKQISTTSRELQEATGHLTKVAEEQLSGIKTVQSFVAEQREIN 354
               +F PP+++ A ++GK+I   SRELQE+TG+LTKV+EEQLSG+KT+Q+FVAE +E++
Sbjct: 281 SALFLFAPPLLVGALIYGKKIRMISRELQESTGNLTKVSEEQLSGVKTIQAFVAEGKELH 340

Query: 355 RYNFAIRDIFNIGKKAAVINAKFFSSTSAMGDLSFLTVLGFGSYLVLQNSLTIGDLTAFM 414
           RYN AIR +F+ GKK A+ NA FFSST  +GDLSFL VL +GS+LVLQ  L++GDLTAFM
Sbjct: 341 RYNNAIRKVFSFGKKEALTNATFFSSTGILGDLSFLIVLAYGSHLVLQGGLSVGDLTAFM 400

Query: 415 MYTEYTGNSIFGLSTFYSEIMQGAGAASRLFELTDRVPSISTTKGVKYKPGNGEIEFKNV 474
           +YTEYTG+++FGLS FYSE+M+GAGAASRLFE+TD    I  + G  Y P  GEI+F++V
Sbjct: 401 LYTEYTGSAVFGLSNFYSELMKGAGAASRLFEMTDHTSQIKPSSGKPYVPSWGEIKFEDV 460

Query: 475 SFAYPTRPSNMIFKNLNFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPSSGEILIDGQN 534
           SF+YPTRP N IF  LNF IE GSNVC+VGPSGRGKST+A LL +YY P+SG I+IDGQN
Sbjct: 461 SFSYPTRPGNQIFNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNSGRIMIDGQN 520

Query: 535 INDLNSKSLRRHIGLVQQEPILMSGTIRDNIVYGLTEMPTKDEIRQVAKQCFCHNFITRF 594
           I+ L+ KSLRRH+G+VQQEP+LMSG+IR N+ YG+    T DEIR VAK+CFCH FIT+F
Sbjct: 521 ISKLSCKSLRRHLGVVQQEPMLMSGSIRYNLTYGMNSEVTMDEIRSVAKKCFCHGFITKF 580

Query: 595 QSSYDTVIGPHGTLLSGGQKQRIAIARALIKKPRILILDEATSALDVESEGAINYTFGQL 654
              Y+TVIGP G  LSGGQKQRIAIARALIKKP+ILILDEATSALDVESEGAINYT G+L
Sbjct: 581 PEGYETVIGPRGASLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRL 640

Query: 655 MKKKEMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELWDDPTSELSQLLNEK 711
           M+ +E+TI+SIAHRLSTIRRSENVIVLG+DGSVVEMGKFKEL+ +  SEL +LLN+K
Sbjct: 641 MRSRELTIISIAHRLSTIRRSENVIVLGNDGSVVEMGKFKELYANDQSELFKLLNDK 697

>KNAG0E02800 Chr5 (562361..564586) [2226 bp, 741 aa] {ON} Anc_6.5
           YPL270W
          Length = 741

 Score =  819 bits (2116), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 422/690 (61%), Positives = 512/690 (74%), Gaps = 43/690 (6%)

Query: 117 FRDIVRLMLLVRRDWKLLLTAVGLLTISCSIGMTIPKVIGLILDQLKNALAANSVDGQPV 176
           ++DI RL LLV+ DWKLL++A+ LLT+SC IGM IPKVIG +LD LK+      + G+  
Sbjct: 88  YKDIWRLFLLVKSDWKLLMSALTLLTVSCGIGMCIPKVIGTVLDSLKD------IQGKEF 141

Query: 177 SIDKLPPIVFGLSFYEXXXXXXXXXXVGIAANYGRIILLRVLSERLVARLRATVIKKTIH 236
           S      +++ +S             +G  ANY R+ILLR+LSE LVA+LRA VIK  IH
Sbjct: 142 S----ELMIWDMSLKHFFYGLSGLLLLGCGANYVRVILLRILSENLVAKLRANVIKHIIH 197

Query: 237 QDAEFFDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGSVGIGMMXXXXXXXXXX 296
           QDA+FFDT+KVGDLISR+G+DA++VSRS+TQK+SDG KA+  GS G+GMM          
Sbjct: 198 QDAQFFDTYKVGDLISRVGNDAFIVSRSITQKISDGVKAVFIGSAGVGMMLSISIPLSCS 257

Query: 297 XXVFT-PPVILSASVFGKQISTTSRELQEATGHLTKVAEEQLSGIKTVQSFVAEQREINR 355
             +    P++LSA VFGKQI   S++LQE T +LT+V+EEQ +GIKT+QSFVAEQ E+++
Sbjct: 258 ILILMGSPLLLSAKVFGKQIRDNSKKLQEVTANLTRVSEEQFNGIKTIQSFVAEQSEMHK 317

Query: 356 YNFAIRDIFNIGKKAAVINAKFFSSTSAMGDLSFLTVLGFGSYLVLQNSLTIGDLTAFMM 415
           +N +IR IF +GK+AA INAKFF++ S +GDLSFL VL +GS+LV Q  L++GDLTAFM+
Sbjct: 318 FNGSIRKIFAVGKEAAFINAKFFTTASIIGDLSFLVVLSYGSWLVFQQQLSVGDLTAFML 377

Query: 416 YTEYTGNSIFGLSTFYSEIMQGAGAASRLFELTDRVPSISTTKGVKYKPGNG-EIEFKNV 474
           YTEYTGN+IF LS F+SEIMQGAGAASR+FELTD  P I+ T+G K+ P  G EIEFKNV
Sbjct: 378 YTEYTGNAIFNLSGFFSEIMQGAGAASRIFELTDLKPRINPTRGSKFIPAKGGEIEFKNV 437

Query: 475 SFAYPTRPSNMIFKNLNFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPSSGEILIDGQN 534
           SF YPTRP+  IF+NLNFKIE GSNVCIVGPSG+GKST+A LL  YY PS G+ILIDGQ+
Sbjct: 438 SFNYPTRPTVPIFRNLNFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPSQGQILIDGQD 497

Query: 535 INDLNSKSLRRHIGLVQQEPILMSGTIRDNIVYGLTEMPTKDEIRQVAKQCFCHNFITRF 594
           I+ L++KSLRRHIG+VQQEPILMSGTIRDNI YGLT  PTK+EIR VAKQCFCHNFITRF
Sbjct: 498 ISALSTKSLRRHIGIVQQEPILMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITRF 557

Query: 595 QSSYDTVIGPHGTLLSGGQKQRIAIARALIKKPRILILDEATSALDVESEGAINYTFGQL 654
             +YDT IGPHGTLLSGGQKQRIAIARALIKKP +LILDEATSALDVESEGAINYTFGQL
Sbjct: 558 PDTYDTAIGPHGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQL 617

Query: 655 MKKKEMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELWDDPTSELSQLLNEKSTP 714
           MK K MTIVSIAHRLSTIRRSENVIVLG+DGSVVE GKFKEL+ +P SELS+LL EKS+ 
Sbjct: 618 MKSKSMTIVSIAHRLSTIRRSENVIVLGNDGSVVEQGKFKELFANPASELSKLLREKSSG 677

Query: 715 HQXXXXXXXXXXXXMAXXXXXXXXXXXXXXXXIEDP-----GSPPMYISTVSEVSAEGHE 769
           +                                EDP      +P    S+V+   AE   
Sbjct: 678 NNAAPEIQPQEISQTIE----------------EDPSFSGEATPA---SSVTGFKAETE- 717

Query: 770 LINEQIEDTIENVMKDVTSERKPLKLQKDE 799
                  +TI  V+KD+++E KPLK+ ++E
Sbjct: 718 ------AETINEVLKDISTEGKPLKIPQNE 741

>KLLA0D00748g Chr4 complement(69839..72208) [2370 bp, 789 aa] {ON}
           similar to uniprot|P33311 Saccharomyces cerevisiae
           YPL270W MDL2 Half-type ATP-binding cassette (ABC)
           transporter of the inner mitochondrial membrane
          Length = 789

 Score =  820 bits (2118), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 388/600 (64%), Positives = 486/600 (81%), Gaps = 8/600 (1%)

Query: 119 DIVRLMLLVRRDWKLLLTAVGLLTISCSIGMTIPKVIGLILDQLKNALAANSV------- 171
           D+ RL  L R DWK+L+ AV LLT+SC+IGM +PKVIGL+LD  KNAL+ ++        
Sbjct: 114 DVKRLFYLARHDWKMLVLAVSLLTVSCTIGMAVPKVIGLVLDATKNALSGSNTNNGNGGL 173

Query: 172 -DGQPVSIDKLPPIVFGLSFYEXXXXXXXXXXVGIAANYGRIILLRVLSERLVARLRATV 230
            D + +++D LPPIV  +  Y+          +G  AN+GR++LL++L ERLVARLR+ V
Sbjct: 174 EDSKSLTLDDLPPIVGDIQLYDFFLLFGGALLIGTMANFGRVVLLKILGERLVARLRSNV 233

Query: 231 IKKTIHQDAEFFDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGSVGIGMMXXXX 290
           IKKT+H D EF+D +KVGDL+SRLG+DAY+VSRSMTQ +SDGFKALICG VGIGMM    
Sbjct: 234 IKKTMHHDMEFYDRNKVGDLLSRLGADAYIVSRSMTQNISDGFKALICGGVGIGMMFHIS 293

Query: 291 XXXXXXXXVFTPPVILSASVFGKQISTTSRELQEATGHLTKVAEEQLSGIKTVQSFVAEQ 350
                   +F PP+++ A+++G +I   SRELQ+A+G+LTKVAEEQLSGIKTVQSFVAE 
Sbjct: 294 STLASVLFLFAPPLLVGATIYGNKIRAISRELQQASGNLTKVAEEQLSGIKTVQSFVAEG 353

Query: 351 REINRYNFAIRDIFNIGKKAAVINAKFFSSTSAMGDLSFLTVLGFGSYLVLQNSLTIGDL 410
           +E++RYN A+R +FN+GKK A  NA FFSST+ +GD SFL VL +GS+LVLQ +LTIGDL
Sbjct: 354 KEVHRYNNAVRQVFNVGKKEAFTNATFFSSTNVLGDFSFLLVLAYGSHLVLQGNLTIGDL 413

Query: 411 TAFMMYTEYTGNSIFGLSTFYSEIMQGAGAASRLFELTDRVPSISTTKGVKYKPGNGEIE 470
           TAFM+YTEYTG+++FGLSTFYSE+M+GAGAA+RLFEL D  P+I +T G  +KP NG++E
Sbjct: 414 TAFMLYTEYTGSAVFGLSTFYSELMKGAGAATRLFELLDYKPTIKSTTGKAFKPLNGKVE 473

Query: 471 FKNVSFAYPTRPSNMIFKNLNFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPSSGEILI 530
           F++VSF+YPTR +N IFK+LNF IE GSNVCIVGPSGRGKST+A LL +YY P+SG+IL+
Sbjct: 474 FQHVSFSYPTRKTNQIFKDLNFTIEPGSNVCIVGPSGRGKSTIASLLLRYYNPTSGKILV 533

Query: 531 DGQNINDLNSKSLRRHIGLVQQEPILMSGTIRDNIVYGLTEMPTKDEIRQVAKQCFCHNF 590
           DGQ+I  L+SKSLRR +G+VQQEPILMSGTIR+NI YG++  P+ +EIR VAK+CFCH F
Sbjct: 534 DGQDITKLSSKSLRRQLGVVQQEPILMSGTIRENITYGVSRQPSMEEIRSVAKKCFCHAF 593

Query: 591 ITRFQSSYDTVIGPHGTLLSGGQKQRIAIARALIKKPRILILDEATSALDVESEGAINYT 650
           I++F + Y+T+IGP G LLSGGQKQRIAIARAL+ KP+ILILDEATSALDVESEGAINYT
Sbjct: 594 ISKFPNGYETIIGPRGALLSGGQKQRIAIARALLNKPKILILDEATSALDVESEGAINYT 653

Query: 651 FGQLMKKKEMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELWDDPTSELSQLLNE 710
            G+LMK KE+TI+SIAHRLSTIRRSENVIVLG DGSVVEMGKFK+L+ +  S L +LL E
Sbjct: 654 LGRLMKSKELTIISIAHRLSTIRRSENVIVLGIDGSVVEMGKFKDLYANHDSALHKLLTE 713

>Kwal_56.22329 s56 complement(50448..52778) [2331 bp, 776 aa] {ON}
           YPL270W (MDL2) - ATP-binding cassette (ABC) transporter
           family member [contig 186] FULL
          Length = 776

 Score =  817 bits (2111), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 392/595 (65%), Positives = 477/595 (80%), Gaps = 3/595 (0%)

Query: 117 FRDIVRLMLLVRRDWKLLLTAVGLLTISCSIGMTIPKVIGLILDQLKNALAANSVDGQPV 176
           +++++RL  L   DWKLL  A+GLL IS  IGM+IPKVIG++LD +KN  ++ +    PV
Sbjct: 139 YKEVIRLFKLATHDWKLLTFAIGLLAISSVIGMSIPKVIGMVLDAIKNTYSSAT---GPV 195

Query: 177 SIDKLPPIVFGLSFYEXXXXXXXXXXVGIAANYGRIILLRVLSERLVARLRATVIKKTIH 236
            +D LPPIV  LS YE          +G  AN+GRI+LLRVL E+LVARLR+ VI+K IH
Sbjct: 196 GLDDLPPIVNDLSMYEFLGIFAGALVIGTVANFGRIVLLRVLGEKLVARLRSNVIRKIIH 255

Query: 237 QDAEFFDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGSVGIGMMXXXXXXXXXX 296
           QDAEFFD +KVGDLISRL SDAYVVSRSMTQ VSDGFKA+ICG VGIGMM          
Sbjct: 256 QDAEFFDRNKVGDLISRLSSDAYVVSRSMTQNVSDGFKAIICGGVGIGMMVNISISLTSA 315

Query: 297 XXVFTPPVILSASVFGKQISTTSRELQEATGHLTKVAEEQLSGIKTVQSFVAEQREINRY 356
             +F PP+++ A ++GK+I   SR+LQE+TG+LT+V+EEQLSG+KT+QSFVAE +E+ RY
Sbjct: 316 LLMFAPPLLIGALIYGKRIRMISRDLQESTGNLTRVSEEQLSGVKTIQSFVAEGKELQRY 375

Query: 357 NFAIRDIFNIGKKAAVINAKFFSSTSAMGDLSFLTVLGFGSYLVLQNSLTIGDLTAFMMY 416
           N AIR +F  GKK A+ NA FFSST+ +GDLSFL VL +GS+LVLQ  LT+GDLTAFM+Y
Sbjct: 376 NTAIRKVFLYGKKEALTNATFFSSTNVLGDLSFLIVLAYGSHLVLQGGLTVGDLTAFMLY 435

Query: 417 TEYTGNSIFGLSTFYSEIMQGAGAASRLFELTDRVPSISTTKGVKYKPGNGEIEFKNVSF 476
           TEYTG+++FGLS FYSE+M+GAGAASRLFE+TD  PSI  T G  Y PG+G+I FK+VSF
Sbjct: 436 TEYTGSAVFGLSNFYSELMKGAGAASRLFEMTDHAPSIKPTAGKPYVPGSGKISFKDVSF 495

Query: 477 AYPTRPSNMIFKNLNFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPSSGEILIDGQNIN 536
           +YPTRP N IF  LNF IE GSNVCIVGPSGRGKST+  LL +YY PSSG+I ID Q+I+
Sbjct: 496 SYPTRPGNQIFNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSSGQITIDDQDIS 555

Query: 537 DLNSKSLRRHIGLVQQEPILMSGTIRDNIVYGLTEMPTKDEIRQVAKQCFCHNFITRFQS 596
            L+ KSLRRH+G+VQQEP+LMSG+I+ N+ YGL    + DEIR VAK+CFCH F+T+F +
Sbjct: 556 RLSCKSLRRHLGVVQQEPMLMSGSIKYNLTYGLQSEVSMDEIRSVAKKCFCHGFVTKFPN 615

Query: 597 SYDTVIGPHGTLLSGGQKQRIAIARALIKKPRILILDEATSALDVESEGAINYTFGQLMK 656
            YDT+IGP G  LSGGQKQRIAIARAL+KKP+ILILDEATSALDVESEGAINYT G+LMK
Sbjct: 616 GYDTIIGPRGASLSGGQKQRIAIARALMKKPKILILDEATSALDVESEGAINYTLGKLMK 675

Query: 657 KKEMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELWDDPTSELSQLLNEK 711
            KE+TI+SIAHRLSTIRRSENVIVLG+DGSVVE+GKFK+L+ D  SEL +LLN+K
Sbjct: 676 SKELTIISIAHRLSTIRRSENVIVLGNDGSVVEVGKFKDLYADQQSELYKLLNDK 730

>Ecym_3007 Chr3 complement(14335..16644) [2310 bp, 769 aa] {ON}
           similar to Ashbya gossypii ACR022W
          Length = 769

 Score =  785 bits (2027), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 376/612 (61%), Positives = 475/612 (77%), Gaps = 17/612 (2%)

Query: 117 FRDIVRLMLLVRRDWKLLLTAVGLLTISCSIGMTIPKVIGLILDQLKNALAANS------ 170
           +R+++RL  L + DWKLL  A+GLL++SC+IGM +PKVIGL+LD  KN L ++       
Sbjct: 97  WREVLRLCSLAKHDWKLLAVAIGLLSVSCTIGMAVPKVIGLVLDATKNTLKSSYEKGSQD 156

Query: 171 -----------VDGQPVSIDKLPPIVFGLSFYEXXXXXXXXXXVGIAANYGRIILLRVLS 219
                      + G   S+D LPPIV  LS  +          VG  AN+GR++LL+++ 
Sbjct: 157 LEGVNEDKESLIAGPIASLDALPPIVGTLSITQFVGIFAGALVVGATANFGRVVLLKIIG 216

Query: 220 ERLVARLRATVIKKTIHQDAEFFDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICG 279
           ERLV+RLR+ VIK+T+H D EFFD +KVGDLISR GSDAYVVSRSMTQ VSDGFKA+ICG
Sbjct: 217 ERLVSRLRSQVIKRTMHHDIEFFDRNKVGDLISRFGSDAYVVSRSMTQNVSDGFKAIICG 276

Query: 280 SVGIGMMXXXXXXXXXXXXVFTPPVILSASVFGKQISTTSRELQEATGHLTKVAEEQLSG 339
            VG+GMM            +F PP+++ A ++GK+IS  SR+LQ+++G+LT+VAEEQL+G
Sbjct: 277 GVGMGMMFHISSTLTSVMLLFAPPLLVGAFIYGKKISAISRQLQQSSGNLTRVAEEQLNG 336

Query: 340 IKTVQSFVAEQREINRYNFAIRDIFNIGKKAAVINAKFFSSTSAMGDLSFLTVLGFGSYL 399
           I+T++SFVAE++EI RYN AIR +F +GK+ A  NA FFSST+ +GD+SF+ VL +G+ L
Sbjct: 337 IRTIKSFVAEKKEIRRYNDAIRQLFYVGKREAFTNATFFSSTTILGDMSFVIVLLYGANL 396

Query: 400 VLQNSLTIGDLTAFMMYTEYTGNSIFGLSTFYSEIMQGAGAASRLFELTDRVPSISTTKG 459
           VLQ +L+IGDLTAFM+YTEYTG+S+FGLSTFYSE+M+GAGAASRLFEL D   S+ +   
Sbjct: 397 VLQGALSIGDLTAFMLYTEYTGSSVFGLSTFYSELMKGAGAASRLFELMDHKNSVRSNIS 456

Query: 460 VKYKPGNGEIEFKNVSFAYPTRPSNMIFKNLNFKIEAGSNVCIVGPSGRGKSTVALLLEK 519
               P  G+IEF++VSF+YPTRPSN IFK+++F IE GSNVCIVGPSG+GKST+  LL +
Sbjct: 457 HALTPTQGKIEFRDVSFSYPTRPSNQIFKHMSFTIEPGSNVCIVGPSGKGKSTITSLLLR 516

Query: 520 YYKPSSGEILIDGQNINDLNSKSLRRHIGLVQQEPILMSGTIRDNIVYGLTEMPTKDEIR 579
           +Y P+ G ILID  +I+   +KSLRRH+G+VQQEP LMSGTIRDNI YGL+  PT DEIR
Sbjct: 517 FYDPNYGSILIDNHDISKFTTKSLRRHLGVVQQEPTLMSGTIRDNITYGLSYTPTMDEIR 576

Query: 580 QVAKQCFCHNFITRFQSSYDTVIGPHGTLLSGGQKQRIAIARALIKKPRILILDEATSAL 639
            V+KQCFCH FIT+F   YDTVIGP G  LSGGQ+QRIAIARALIKKP+ILILDEATSAL
Sbjct: 577 VVSKQCFCHGFITKFPDGYDTVIGPRGASLSGGQRQRIAIARALIKKPKILILDEATSAL 636

Query: 640 DVESEGAINYTFGQLMKKKEMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELWDD 699
           DVESEGAINYT G LM+ KE+TI+SIAHRLSTIRRSEN+IV+G+DGSVVE+GKF +L+ +
Sbjct: 637 DVESEGAINYTLGTLMRSKELTIISIAHRLSTIRRSENIIVVGNDGSVVEVGKFDKLYRN 696

Query: 700 PTSELSQLLNEK 711
             SEL +LLNEK
Sbjct: 697 EESELFKLLNEK 708

>ACR022W Chr3 (395427..397691) [2265 bp, 754 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL270W (MDL2)
          Length = 754

 Score =  780 bits (2014), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 379/629 (60%), Positives = 488/629 (77%), Gaps = 2/629 (0%)

Query: 87  SATKEKNEEDRXXXXXXXXXXXXXXXNHSEFRDIVRLMLLVRRDWKLLLTAVGLLTISCS 146
           S   +++E++R                 + + ++ RL+ LV+ DWKLLL A+GLLTISCS
Sbjct: 73  SPRDKEHEQERKVEKRPAEPSRAQPAKPAGWHEVFRLLRLVKPDWKLLLAALGLLTISCS 132

Query: 147 IGMTIPKVIGLILDQLKNALAANSVD--GQPVSIDKLPPIVFGLSFYEXXXXXXXXXXVG 204
           IGM +PKVIGL+LD  K+A+A    +  G P+S+  +P I+   +  +          VG
Sbjct: 133 IGMAVPKVIGLVLDATKDAVAQAEKNETGAPMSLLDMPSIIGNFTLVDVLAAFAGALLVG 192

Query: 205 IAANYGRIILLRVLSERLVARLRATVIKKTIHQDAEFFDTHKVGDLISRLGSDAYVVSRS 264
            AAN+GR+ LL++L ERLVARLRA VIKKT+H DAEFFD +KVGDLISRLGSDAY+VSRS
Sbjct: 193 SAANFGRMFLLKMLGERLVARLRAQVIKKTLHHDAEFFDRNKVGDLISRLGSDAYIVSRS 252

Query: 265 MTQKVSDGFKALICGSVGIGMMXXXXXXXXXXXXVFTPPVILSASVFGKQISTTSRELQE 324
           MT  +SDG KA +CG VG+GMM            +F PP++++A+++GK+I   SRELQ+
Sbjct: 253 MTHNISDGVKAALCGGVGVGMMFHISSTLTSAMIMFAPPLLIAATIYGKRIRAISRELQQ 312

Query: 325 ATGHLTKVAEEQLSGIKTVQSFVAEQREINRYNFAIRDIFNIGKKAAVINAKFFSSTSAM 384
           +TG+LT+V+EEQ +GIKT++SFVAE +E+ RYN A+R +FN+ K+  + +A FFS T+ +
Sbjct: 313 STGNLTRVSEEQFNGIKTIKSFVAEGKEMRRYNTAVRRLFNVAKREGITSATFFSGTNVL 372

Query: 385 GDLSFLTVLGFGSYLVLQNSLTIGDLTAFMMYTEYTGNSIFGLSTFYSEIMQGAGAASRL 444
           GD+SFL VL +GS+LVLQ  L++G LTAFM+YTEYTG+S+FGLS FYSE+M+GAGAASRL
Sbjct: 373 GDVSFLLVLAYGSHLVLQGELSLGSLTAFMLYTEYTGSSVFGLSNFYSELMKGAGAASRL 432

Query: 445 FELTDRVPSISTTKGVKYKPGNGEIEFKNVSFAYPTRPSNMIFKNLNFKIEAGSNVCIVG 504
           FELTD   S+ +T G  + P +G IEFK+VSF+YPTRP++ IFK L   I  GSNVCIVG
Sbjct: 433 FELTDYKKSVPSTVGQTFVPRDGRIEFKDVSFSYPTRPTSQIFKKLRLTITPGSNVCIVG 492

Query: 505 PSGRGKSTVALLLEKYYKPSSGEILIDGQNINDLNSKSLRRHIGLVQQEPILMSGTIRDN 564
           PSGRGKST+A LL ++Y  +SG ILIDGQ+I+ +++KSLR+H+G+VQQEP+LMSGTIRDN
Sbjct: 493 PSGRGKSTIASLLLRFYDANSGTILIDGQDISKVSAKSLRKHLGVVQQEPVLMSGTIRDN 552

Query: 565 IVYGLTEMPTKDEIRQVAKQCFCHNFITRFQSSYDTVIGPHGTLLSGGQKQRIAIARALI 624
           I YGL+  P+ DEIR VAK+CFCHNFIT+F   YDTVIGP G LLSGGQ+QRIAIARALI
Sbjct: 553 ITYGLSYTPSMDEIRAVAKKCFCHNFITKFPDGYDTVIGPRGALLSGGQRQRIAIARALI 612

Query: 625 KKPRILILDEATSALDVESEGAINYTFGQLMKKKEMTIVSIAHRLSTIRRSENVIVLGHD 684
           KKP+ILILDEATSALDVESEGAINYT G+LM+ KE+TIVSIAHRLSTIRRSEN++VLG+D
Sbjct: 613 KKPKILILDEATSALDVESEGAINYTLGRLMRSKEITIVSIAHRLSTIRRSENIVVLGND 672

Query: 685 GSVVEMGKFKELWDDPTSELSQLLNEKST 713
           GSV+E GKF +L+ D  SEL +LLNE ++
Sbjct: 673 GSVIEAGKFADLYRDEDSELFKLLNEHAS 701

>KAFR0B06480 Chr2 complement(1344413..1346668) [2256 bp, 751 aa]
           {ON} Anc_6.5 YPL270W
          Length = 751

 Score =  758 bits (1957), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 389/611 (63%), Positives = 470/611 (76%), Gaps = 15/611 (2%)

Query: 113 NHSEFRDIVRLMLLVRRDWKLLLTAVGLLTISCSIGMTIPKVIGLILDQLKNALAANSVD 172
           N S +RD+ RL +L+++D KLL+ A+ LLTISCSIGM IPK+IG ILD L+N    N   
Sbjct: 79  NGSSWRDLKRLTVLIKKDIKLLVLAIVLLTISCSIGMAIPKIIGTILDTLRNNYE-NLTS 137

Query: 173 GQPVSIDKLPPIVFGLSFYEXXXXXXXXXXVGIAANYGRIILLRVLSERLVARLRATVIK 232
              + I  +P   F +               G  AN+GR+++LR++SERLV+RLR+ V+K
Sbjct: 138 LSQIKILNIPLSTFLMG-------VGITLIFGCFANFGRVVILRIISERLVSRLRSQVVK 190

Query: 233 KTIHQDAEFFDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGSVGIGMMXXXXXX 292
             IH+D EFFDT KVGDL+SR+G+DA+VVSRS+T KV+DG ++   G  GIG+M      
Sbjct: 191 NIIHKDLEFFDTFKVGDLMSRVGNDAFVVSRSITHKVADGVRSGFIGIFGIGLMLTLSRE 250

Query: 293 XXXXXXVFTPPVILSASVFGKQISTTSRELQEATGHLTKVAEEQLSGIKTVQSFVAEQRE 352
                    PP+I   SVFGKQI   S++LQ+ TG LT+V EEQ +GI+TVQ FVAE+ E
Sbjct: 251 LTGALFAILPPIIWCTSVFGKQIRMNSKKLQDVTGDLTRVTEEQFNGIRTVQGFVAERNE 310

Query: 353 INRYNFAIRDIFNIGKKAAVINAKFFSSTSAMGDLSFLTVLGFGSYLVLQNSLTIGDLTA 412
           I R+N  +R+IF +GK++A IN KFF+S S +GDL FL VL +GSYLV+  S++IGDLTA
Sbjct: 311 IKRFNNVLREIFQVGKESAFINGKFFTSASLIGDLGFLIVLTYGSYLVMHGSMSIGDLTA 370

Query: 413 FMMYTEYTGNSIFGLSTFYSEIMQGAGAASRLFELTDRVPSISTTKG-VKYKP----GNG 467
           FM+YTEYTGN+IFGLS+FYSE+MQG GAASR+FE+ D+ P I +T G  K+KP    G  
Sbjct: 371 FMLYTEYTGNAIFGLSSFYSELMQGVGAASRIFEINDKEPKIKSTTGEAKFKPLNEVGGC 430

Query: 468 EIEFKNVSFAYPTRPSNMIFKNLNFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPSSGE 527
           EIEFKNVSF YPTRP+N IFKNLNFK+ AGSNVCIVGPSGRGKST+A LL  +Y   SG+
Sbjct: 431 EIEFKNVSFFYPTRPTNQIFKNLNFKVPAGSNVCIVGPSGRGKSTIASLLLHHYNAVSGQ 490

Query: 528 ILIDGQNINDLNSKSLRRHIGLVQQEPILMSGTIRDNIVYGLTEMPTKDEIRQVAKQCFC 587
           ILIDGQ+I  LN+KSLRR IG+VQQEPILMSGTIRDNI YGLTE P+K+EIR VAKQCFC
Sbjct: 491 ILIDGQDIATLNTKSLRRKIGIVQQEPILMSGTIRDNITYGLTEEPSKEEIRLVAKQCFC 550

Query: 588 HNFITRFQSSYD--TVIGPHGTLLSGGQKQRIAIARALIKKPRILILDEATSALDVESEG 645
           HNFIT+F  +YD     G  GT LSGGQKQRIAIARALIKKP ILILDEATSALDVESEG
Sbjct: 551 HNFITKFPDTYDTTIGSGSSGTSLSGGQKQRIAIARALIKKPNILILDEATSALDVESEG 610

Query: 646 AINYTFGQLMKKKEMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELWDDPTSELS 705
           AINYTFGQ+MK K MTIVSIAHRLSTIRR E+VIVLG+DGSVVEMGKFKEL+D+PTSELS
Sbjct: 611 AINYTFGQIMKSKSMTIVSIAHRLSTIRRFEDVIVLGNDGSVVEMGKFKELYDNPTSELS 670

Query: 706 QLLNEKSTPHQ 716
           +LLNEKS+  +
Sbjct: 671 KLLNEKSSTKE 681

>NCAS0B08700 Chr2 (1674262..1676409) [2148 bp, 715 aa] {ON} Anc_1.67
          Length = 715

 Score =  526 bits (1356), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 282/600 (47%), Positives = 394/600 (65%), Gaps = 9/600 (1%)

Query: 117 FRDIVRLMLLVRRDWKLLLTAVGLLTISCSIGMTIPKVIGLILDQLKNALAANSVDGQPV 176
            +DI RL  L + + K +L A+  + IS S+ MTIP +IG +LD L  A   +       
Sbjct: 93  MKDIKRLFKLAKPEAKYILLALLFIVISSSVSMTIPTIIGKLLD-LAKADNDDEDGDNNA 151

Query: 177 SIDKLPPIVFGLSFYEXXXXXXXXXXVGIAANYGRIILLRVLSERLVARLRATVIKKTIH 236
             +KL  ++FGL+  +           G  AN  RI++L+V  ERLVARLR   +K  ++
Sbjct: 152 KKEKL--MIFGLTKPQFYTALGGLFLAGAIANASRIVILKVTGERLVARLRTRTMKAALY 209

Query: 237 QDAEFFDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGSVGIGMMXXXXXXXXXX 296
           QDA F DT++VGDLISRL SDA +V++++TQ VSDG +A+I G VG GMM          
Sbjct: 210 QDASFLDTNRVGDLISRLSSDASIVAKAVTQNVSDGSRAVIQGFVGFGMMSFISWKLTCV 269

Query: 297 XXVFTPPVILSASVFGKQISTTSRELQEATGHLTKVAEEQLSGIKTVQSFVAEQREINRY 356
             +  PP+ + A V+G++I T SR+LQ + G LTKVAEEQL+  +T+Q++  E  EI+RY
Sbjct: 270 MMIMVPPLGVMALVYGRKIRTLSRQLQASVGGLTKVAEEQLNATRTIQAYGGEALEIHRY 329

Query: 357 NFAIRDIFNIGKKAAVINAKFFSSTSAMGDLSFLTVLGFGSYLVLQNSLTIGDLTAFMMY 416
              +R +F++G K AV +  FF ST  +G+++ +++L  G+ ++   +LT+GDL++FMMY
Sbjct: 330 ATEVRKVFDVGLKEAVTSGLFFGSTGLVGNIAMISLLLVGTSMIQYGTLTVGDLSSFMMY 389

Query: 417 TEYTGNSIFGLSTFYSEIMQGAGAASRLFELTDRVPSISTTKGVKYKPGNGE-IEFKNVS 475
             YTG+S+FGLS FYSE+M+GAGAA+R+FEL DR P I  T G   K   G+ IEF+NVS
Sbjct: 390 AVYTGSSLFGLSGFYSELMKGAGAATRVFELNDRKPLIKPTIGYDPKSLLGKSIEFQNVS 449

Query: 476 FAYPTRPSNMIFKNLNFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPSSGEILIDGQNI 535
           FAYPTRP++ I  NL+  I+ G +VCIVGPSG GKSTV+ LL +YY  S+G I IDGQNI
Sbjct: 450 FAYPTRPTHSILNNLSISIQPGEHVCIVGPSGSGKSTVSSLLLRYYDVSTGSIKIDGQNI 509

Query: 536 NDLNSKSLRRHIGLVQQEPILMSGTIRDNIVYGLTEMPT----KDEIRQVAKQCFCHNFI 591
            + N +  RR +G+VQQEP+L +GTI DNI+Y +    T      ++++  +Q  C  F+
Sbjct: 510 KEFNLRKYRRLLGVVQQEPMLFNGTILDNILYAVLSKETLTANSPDVKRALEQANCTKFL 569

Query: 592 TRFQSSYDTVIGPHGTLLSGGQKQRIAIARALIKKPRILILDEATSALDVESEGAINYTF 651
             F    +T++GP GT LSGGQKQRIA+ARA +  P +LILDEATSALD +SE  +    
Sbjct: 570 KNFPEGVNTLVGPRGTQLSGGQKQRIALARAFLLHPALLILDEATSALDSQSEEIVAKNL 629

Query: 652 GQLMKKKEMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELWDDPTSELSQLLNEK 711
            + ++   +T +SIAHRLSTI+ S  VIVL   GSVVE G F+EL D   SEL+ LL+++
Sbjct: 630 SERVELG-LTTISIAHRLSTIKHSTRVIVLDKSGSVVETGPFEELVDYSRSELNMLLSQQ 688

>SAKL0C02244g Chr3 (201281..203419) [2139 bp, 712 aa] {ON} similar
           to uniprot|P33310 Saccharomyces cerevisiae YLR188W MDL1
           Half-type ATP-binding cassette (ABC) transporter of the
           inner mitochondrial membrane mediates export of peptides
           generated upon proteolysis of mitochondrial proteins
           plays a role in the regulation of cellular resistance to
           oxidative stress
          Length = 712

 Score =  526 bits (1354), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 287/609 (47%), Positives = 389/609 (63%), Gaps = 19/609 (3%)

Query: 115 SEFRDIVRLMLLVRRDWKLLLTAVGLLTISCSIGMTIPKVIGLILDQLKNALAA------ 168
           S F+DI RL LL + +   ++ A+  + IS ++ MTIP VIG +LD  K    A      
Sbjct: 100 SGFKDIKRLFLLAKPETNSMILALVFILISGAVSMTIPSVIGKLLDAAKEGHLAGVSASG 159

Query: 169 ------NSVDGQPVSIDKLPPIVFGLSFYEXXXXXXXXXXVGIAANYGRIILLRVLSERL 222
                 +S D Q  S D+L   ++GL+F +          VG  AN GRI+LL+V  E+L
Sbjct: 160 EGVGSSDSSDNQEDSSDRL---IYGLTFPQFYTALGTIFVVGAFANMGRIVLLKVTGEKL 216

Query: 223 VARLRATVIKKTIHQDAEFFDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGSVG 282
           VARLR   +K  + QDA F D ++VGDLISRL SDA +VS+S+TQ +SDG +A+I G+VG
Sbjct: 217 VARLRTRTMKAALQQDATFLDNNRVGDLISRLSSDASIVSKSVTQNLSDGARAVIQGAVG 276

Query: 283 IGMMXXXXXXXXXXXXVFTPPVILSASVFGKQISTTSRELQEATGHLTKVAEEQLSGIKT 342
            GMM            +  PP+ + A V+GK+I   SR+LQ + G LTKVAEEQLS  +T
Sbjct: 277 FGMMSFISWKLTCVMTLMAPPLAVMAMVYGKKIRNLSRQLQTSVGGLTKVAEEQLSAART 336

Query: 343 VQSFVAEQREINRYNFAIRDIFNIGKKAAVINAKFFSSTSAMGDLSFLTVLGFGSYLVLQ 402
           VQ++  E++EI RY   +R++FNIG K A+ +  FF  T  +G+++ L +L  G+ ++  
Sbjct: 337 VQAYGGEKQEIRRYAGEVRNVFNIGLKEALTSGVFFGVTGFVGNVALLALLLTGTSMIRS 396

Query: 403 NSLTIGDLTAFMMYTEYTGNSIFGLSTFYSEIMQGAGAASRLFELTDRVPSISTTKGVKY 462
            ++T+GDL++FMMY  YTG+S+FGLS+FYSE+M+GAGAA+R+FEL DR P I  TKGV  
Sbjct: 397 GAITVGDLSSFMMYAVYTGSSLFGLSSFYSELMKGAGAAARVFELNDRKPLIHPTKGVDP 456

Query: 463 KPGNGE-IEFKNVSFAYPTRPSNMIFKNLNFKIEAGSNVCIVGPSGRGKSTVALLLEKYY 521
               G+ IEF+NV+FAYPTR  N IF  L+  I+ G +VCIVGPSG GKST+A LL +YY
Sbjct: 457 VTLQGKTIEFRNVAFAYPTRRENRIFDGLSLDIQPGEHVCIVGPSGGGKSTIASLLLRYY 516

Query: 522 KPSSGEILIDGQNINDLNSKSLRRHIGLVQQEPILMSGTIRDNIVYGLTEMPTKDEIR-- 579
              +G I I GQ+I   N +  RR +G+VQQEP+L +GTI DNI Y +      D+ R  
Sbjct: 517 DVDAGRIAIGGQDIRRFNLRKYRRLLGVVQQEPLLFNGTILDNITYAVPGELAGDDSRVS 576

Query: 580 QVAKQCFCHNFITRFQSSYDTVIGPHGTLLSGGQKQRIAIARALIKKPRILILDEATSAL 639
           +   Q  C  F+  F    +T++GP G  +SGGQKQRIA+ARA +  P +LILDEATSAL
Sbjct: 577 RAIGQANCTKFLANFPDGLETLVGPRGAQMSGGQKQRIALARAFLLDPAVLILDEATSAL 636

Query: 640 DVESEGAINYTFGQLMKKKEMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELWDD 699
           D +SE  +  +  +   ++  T VSIAHRLSTI+ S  VIVL   G V E G F+EL  D
Sbjct: 637 DSQSEEVVAQSL-RSRSRRGKTTVSIAHRLSTIQHSSRVIVLDRHGGVGETGSFRELISD 695

Query: 700 PTSELSQLL 708
           P S L+QLL
Sbjct: 696 PDSHLTQLL 704

>Ecym_1072 Chr1 (137296..139347) [2052 bp, 683 aa] {ON} similar to
           Ashbya gossypii AFR683C
          Length = 683

 Score =  519 bits (1337), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 278/598 (46%), Positives = 383/598 (64%), Gaps = 10/598 (1%)

Query: 117 FRDIVRLMLLVRRDWKLLLTAVGLLTISCSIGMTIPKVIGLILDQLKNALAANSVDGQPV 176
           F+++ RL  L R + K L  A+ L+ IS ++ MTIP VIG +LD  K   A    D    
Sbjct: 80  FKNVRRLFQLARPEAKSLAFALLLIVISGAVSMTIPSVIGKLLDISKEKEAGGDGD---- 135

Query: 177 SIDKLPPIVFGLSFYEXXXXXXXXXXVGIAANYGRIILLRVLSERLVARLRATVIKKTIH 236
             ++    ++GL+  +          +G  AN GRI++L+V  E+LVARLR   +K  + 
Sbjct: 136 --EEQETRIYGLTEKQFYTALGGVFVIGACANVGRIVILKVTGEKLVARLRTKTMKAALQ 193

Query: 237 QDAEFFDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGSVGIGMMXXXXXXXXXX 296
           QDA F D ++VGDLISRL SDA +VS+S+TQ  SDG +A+I G VG GMM          
Sbjct: 194 QDAAFLDYNRVGDLISRLSSDASIVSKSITQNTSDGARAVIQGMVGFGMMGYISAQLTGV 253

Query: 297 XXVFTPPVILSASVFGKQISTTSRELQEATGHLTKVAEEQLSGIKTVQSFVAEQREINRY 356
             +  PP++L A V+G++I   +RELQ   G LTKVAEEQL+  +T+QS+  E++EI RY
Sbjct: 254 MLLLAPPLVLMAMVYGRRIRNLTRELQTRVGGLTKVAEEQLNATRTIQSYCGERKEIRRY 313

Query: 357 NFAIRDIFNIGKKAAVINAKFFSSTSAMGDLSFLTVLGFGSYLVLQNSLTIGDLTAFMMY 416
              +R +F +G + AV +  FF +T  MG+++ L +L  G+ ++   ++T+G+L++FMMY
Sbjct: 314 AEEVRSVFRVGLREAVTSGAFFGTTGLMGNMALLALLLTGTSMIRSGAITVGELSSFMMY 373

Query: 417 TEYTGNSIFGLSTFYSEIMQGAGAASRLFELTDRVPSISTTKGVK-YKPGNGEIEFKNVS 475
             YTG+S+FGLS+FYSE+M+GAGAASR+FEL DRVP I  TKG         EIEFKNV 
Sbjct: 374 AVYTGSSLFGLSSFYSELMKGAGAASRVFELNDRVPLIHPTKGKDPISLAAKEIEFKNVK 433

Query: 476 FAYPTRPSNMIFKNLNFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPSSGEILIDGQNI 535
           F+YP+R ++ +F  LN KI  G +VC+VGPSG GKST++ LL ++Y   SG I I GQNI
Sbjct: 434 FSYPSRSNHTVFTELNLKIIPGEHVCVVGPSGGGKSTISSLLLRFYDVDSGVITIGGQNI 493

Query: 536 NDLNSKSLRRHIGLVQQEPILMSGTIRDNIVYGLTE--MPTKDEIRQVAKQCFCHNFITR 593
            D N +  RR +G+VQQEP+L +G+I+DNI Y L    +  K  + +  +   C  FI+ 
Sbjct: 494 KDFNLRKYRRSLGIVQQEPLLFNGSIKDNICYALPPHIISDKHRVNRALEAANCTRFISN 553

Query: 594 FQSSYDTVIGPHGTLLSGGQKQRIAIARALIKKPRILILDEATSALDVESEGAINYTFGQ 653
           F    DT++GP GT LSGGQKQRIAIARA I  P ILILDEATSALD +SE  I      
Sbjct: 554 FPDGLDTMVGPRGTQLSGGQKQRIAIARAFILDPSILILDEATSALDSQSEDIIAQALRA 613

Query: 654 LMKKKEMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELWDDPTSELSQLLNEK 711
             +  ++TI SIAHR+STI  S  VIVL  +G V E G F +L + P S L++LL+++
Sbjct: 614 RSESGKITI-SIAHRISTIEHSNRVIVLSRNGGVSETGAFCDLINQPNSNLNKLLSKE 670

>TDEL0C06350 Chr3 complement(1159576..1161657) [2082 bp, 693 aa]
           {ON} Anc_1.67 YLR188W
          Length = 693

 Score =  518 bits (1334), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 285/611 (46%), Positives = 390/611 (63%), Gaps = 15/611 (2%)

Query: 113 NHSEFRDIVRLMLLVRRDWKLLLTAVGLLTISCSIGMTIPKVIGLILDQLKNALAANSVD 172
           N S F+DI RL  L + +   +  A+ L+ IS ++ MTIP ++G +LD     +A +  D
Sbjct: 86  NGSGFKDIKRLFRLAKPETLQIALALVLILISSAVSMTIPTIVGKLLD-----IAKDRKD 140

Query: 173 GQPVSIDKLPPIVFGLSFYEXXXXXXXXXXVGIAANYGRIILLRVLSERLVARLRATVIK 232
               + D   P +FG++  +          VG AAN GRI++L++  ERLVARLR   +K
Sbjct: 141 ADDTTEDDEGPKIFGMTTKQFCTALLAVFLVGAAANAGRIVILKITGERLVARLRTRTMK 200

Query: 233 KTIHQDAEFFDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGSVGIGMMXXXXXX 292
             + QDA F DT++VGDLIS L SDA +V++S+TQ VSDG +A+I G VG GMM      
Sbjct: 201 AALDQDATFLDTNRVGDLISCLSSDASIVAKSVTQNVSDGTRAVIQGFVGFGMMGYISWQ 260

Query: 293 XXXXXXVFTPPVILSASVFGKQISTTSRELQEATGHLTKVAEEQLSGIKTVQSFVAEQRE 352
                 +  PP+ + A V+G++I   SR+LQ + G LTKV+EEQL  +KT+QS+V E++E
Sbjct: 261 LTSVMILMIPPLGIMAVVYGRKIRNLSRQLQTSVGGLTKVSEEQLGAVKTIQSYVGEKKE 320

Query: 353 INRYNFAIRDIFNIGKKAAVINAKFFSSTSAMGDLSFLTVLGFGSYLVLQNSLTIGDLTA 412
           I+RY   +R++FNIG K A+ +  FF ST  +G++S L +L  G+ ++    +T+GDL++
Sbjct: 321 IHRYATEVRNVFNIGLKEALTSGVFFGSTGLVGNISLLALLMVGTNMIQNGLITVGDLSS 380

Query: 413 FMMYTEYTGNSIFGLSTFYSEIMQGAGAASRLFELTDRVPSISTTKGVK-YKPGNGEIEF 471
           FMMY  YTG+S+FGLS+FYSE+M+GAGAA+R+FEL DR P I  T G       N  I F
Sbjct: 381 FMMYAVYTGSSMFGLSSFYSELMKGAGAAARVFELKDRKPLIPPTIGQDPVTLANKTIRF 440

Query: 472 KNVSFAYPTRPSNMIFKNLNFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPSSGEILID 531
           +NVSF YPTR +  IF  L+  +E G +VCIVGPSG GKSTVA LL +YY  + G I+I 
Sbjct: 441 ENVSFTYPTRLNQKIFDGLDITVEPGEHVCIVGPSGSGKSTVASLLLRYYDTNEGRIMIG 500

Query: 532 GQNINDLNSKSLRRHIGLVQQEPILMSGTIRDNIVYGL-TEMPTKDEIRQVA-KQCFCHN 589
             NIN  N +  RR +G+VQQEP L +GTI DNI+Y +  E    D++   A  Q  C  
Sbjct: 501 DHNINSFNVRKYRRLLGIVQQEPQLFNGTILDNILYTVPPERADNDDLISTAIGQANCSK 560

Query: 590 FITRFQSSYDTVIGPHGTLLSGGQKQRIAIARALIKKPRILILDEATSALDVESEGAINY 649
           F+  F     T++GP G  LSGGQKQRIA+ARA +  P +LILDEATSALD +SE  +  
Sbjct: 561 FLANFPDGLQTLVGPRGAQLSGGQKQRIALARAFLLDPSLLILDEATSALDSQSEEIVAQ 620

Query: 650 TFGQLMKKKEMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELWDDPTSELSQLLN 709
           T  ++  ++ +T +SIAHRLSTI+    V+VLG  G VVE G F+EL  +P SELS LL+
Sbjct: 621 TL-RVRVQRGLTTISIAHRLSTIKNCTRVVVLGKCGQVVESGPFEELLRNPLSELSILLS 679

Query: 710 ------EKSTP 714
                 E STP
Sbjct: 680 QQQDEPETSTP 690

>NDAI0A00560 Chr1 complement(100930..103074) [2145 bp, 714 aa] {ON}
           Anc_1.67
          Length = 714

 Score =  518 bits (1335), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 280/604 (46%), Positives = 392/604 (64%), Gaps = 10/604 (1%)

Query: 115 SEFRDIVRLMLLVRRDWKLLLTAVGLLTISCSIGMTIPKVIGLILDQLKNALAANSVDGQ 174
           S F+DI RL  L R + + +  A+  + IS S+ MT+P +IG +LD  K     N  +  
Sbjct: 92  SGFKDIQRLFSLARPELRYIALALLFILISSSVSMTVPSIIGKLLDAAKKGQKENEEEDS 151

Query: 175 PVSIDKLPPIVF-GLSFYEXXXXXXXXXXVGIAANYGRIILLRVLSERLVARLRATVIKK 233
              +   P I F GL+  +          VG  AN GRII+L+V  ERLVARLR   +K 
Sbjct: 152 KTIV---PDITFFGLTRTQFYTALGVLFLVGAIANTGRIIILKVTGERLVARLRTRTMKA 208

Query: 234 TIHQDAEFFDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGSVGIGMMXXXXXXX 293
            + QDA F D ++VGDLISRL SDA +VS+++TQ VSDG +A+I G VG GMM       
Sbjct: 209 ALDQDATFLDANRVGDLISRLSSDAAIVSKAVTQNVSDGTRAIIQGFVGFGMMGYLSWKL 268

Query: 294 XXXXXVFTPPVILSASVFGKQISTTSRELQEATGHLTKVAEEQLSGIKTVQSFVAEQREI 353
                +  PP+ + A V+G++I   S++LQE+ G L+KVAEEQL+  KT+Q++V E+ EI
Sbjct: 269 TGVMMLMVPPLGIMALVYGRKIRNLSKQLQESVGGLSKVAEEQLNATKTIQAYVGERLEI 328

Query: 354 NRYNFAIRDIFNIGKKAAVINAKFFSSTSAMGDLSFLTVLGFGSYLVLQNSLTIGDLTAF 413
           +RY   +R++F IG K AV +  FF ST  +G+++ +++L  G+ ++   +LT+G+L++F
Sbjct: 329 HRYATEVRNVFRIGLKEAVTSGLFFGSTGLVGNIAMISLLLVGTNMIQSGTLTVGELSSF 388

Query: 414 MMYTEYTGNSIFGLSTFYSEIMQGAGAASRLFELTDRVPSISTTKGVKYKPGNGE-IEFK 472
           MMY  YTG+S+FGLS+FYSE+M+GAGAASR+FEL DR P I +T G+  K   G+ I+F+
Sbjct: 389 MMYAVYTGSSLFGLSSFYSELMKGAGAASRVFELNDRKPLIKSTVGIDPKTLFGKSIKFE 448

Query: 473 NVSFAYPTRPSNMIFKNLNFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPSSGEILIDG 532
           NVSF YP+RP++ IF NLN +I  G +VCIVG SG GKST+A LL +YY  ++G I I  
Sbjct: 449 NVSFTYPSRPNHKIFDNLNLEINPGEHVCIVGFSGSGKSTIASLLLRYYDVNNGSIRIGD 508

Query: 533 QNINDLNSKSLRRHIGLVQQEPILMSGTIRDNIVYG----LTEMPTKDEIRQVAKQCFCH 588
            +I + + +  RR IG VQQEP L +G+I DNI+Y     LT     + ++   KQ  C+
Sbjct: 509 NDIRNFSLRKYRRLIGTVQQEPSLFNGSILDNIIYAIPPELTSEKQHERVQLAIKQANCN 568

Query: 589 NFITRFQSSYDTVIGPHGTLLSGGQKQRIAIARALIKKPRILILDEATSALDVESEGAIN 648
            F+ +F     T++GP G  LSGGQKQRIA+ARA +  P +LILDE+TSALD  SE  + 
Sbjct: 569 IFLGKFPDGLQTLVGPRGAQLSGGQKQRIALARAFLLDPTLLILDESTSALDSLSEELVA 628

Query: 649 YTFGQLMKKKEMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELWDDPTSELSQLL 708
            T  Q    + +T +SIAHRLSTI+ S  VIV+G  GSVVE G F  L D+P SEL+ LL
Sbjct: 629 KTL-QARSARGLTTISIAHRLSTIKHSSRVIVIGKYGSVVESGPFDRLIDNPKSELNMLL 687

Query: 709 NEKS 712
           ++++
Sbjct: 688 SQQN 691

>TPHA0B04620 Chr2 complement(1085725..1087887) [2163 bp, 720 aa]
           {ON} Anc_1.67 YLR188W
          Length = 720

 Score =  518 bits (1334), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 276/609 (45%), Positives = 395/609 (64%), Gaps = 21/609 (3%)

Query: 117 FRDIVRLMLLVRRDWKLLLTAVGLLTISCSIGMTIPKVIGLILDQLKN--------ALAA 168
           F+D+ RL  L + +   ++ A+ L+ IS ++ M +P VIG +LD   N        A + 
Sbjct: 93  FKDVKRLFTLAKPETAYIVLALVLILISSTVSMVVPSVIGKLLDLSSNTSNDDTGDAKSK 152

Query: 169 NSVDGQPVSIDKLPPIVFGLSFYEXXXXXXXXXXVGIAANYGRIILLRVLSERLVARLRA 228
             VD +    D+    ++G +  +          +G  AN GRI++L+V  E+LVARLR 
Sbjct: 153 EKVDNKE---DRDNNTIYGFTHTQFFAGLGIVFVIGAIANTGRIVILKVTGEKLVARLRT 209

Query: 229 TVIKKTIHQDAEFFDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGSVGIGMMXX 288
             +K  + QDA F D+++VGDLISRL SDA +V++S+T  VSDG +A++ G VG  MM  
Sbjct: 210 RTMKAALDQDATFLDSNRVGDLISRLSSDASIVAKSVTMNVSDGTRAILQGFVGFSMMSY 269

Query: 289 XXXXXXXXXXVFTPPVILSASVFGKQISTTSRELQEATGHLTKVAEEQLSGIKTVQSFVA 348
                     +  PP+ + A V+GK+I   SR+LQ A G LTKVAEEQL+  KT+Q++  
Sbjct: 270 ISFKLTSVMVLLIPPLGIMALVYGKKIRNLSRQLQTAVGGLTKVAEEQLNATKTIQAYGG 329

Query: 349 EQREINRYNFAIRDIFNIGKKAAVINAKFFSSTSAMGDLSFLTVLGFGSYLVLQNSLTIG 408
           E++EI RY   +RD+F++G K A+ +  FF ST  +G+ + L++L  G+ ++   SLT+G
Sbjct: 330 EKKEIRRYASEVRDVFDVGLKEAITSGIFFGSTGLVGNAALLSLLLVGTNMISSGSLTVG 389

Query: 409 DLTAFMMYTEYTGNSIFGLSTFYSEIMQGAGAASRLFELTDRVPSISTTKGVKYKPGNGE 468
           DL++FMMY  YTG+S+FGLS+FYSE+M+GAGAA+R+FEL DR P I  T G       G+
Sbjct: 390 DLSSFMMYAVYTGSSLFGLSSFYSELMKGAGAAARVFELDDRKPLIKPTIGKDPVTLKGK 449

Query: 469 -IEFKNVSFAYPTRPSNMIFKNLNFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPSSGE 527
            I F++VSF YPTRP++ +F  ++FKIE G ++C VGPSG GKSTV+ LL +YY  + G 
Sbjct: 450 AIIFQDVSFHYPTRPNHRVFNKISFKIEPGEHICFVGPSGSGKSTVSQLLLRYYDATEGN 509

Query: 528 ILIDGQNINDLNSKSLRRHIGLVQQEPILMSGTIRDNIVYGLTE--MPTKDEIRQVAKQC 585
           ILI   NI  L+ +  R+ +G+VQQEP+L +GTI DNI+Y + +     K+++    K+ 
Sbjct: 510 ILIGEDNIKSLSLRKYRKLLGVVQQEPMLFNGTIIDNILYNVPDEIASQKNKVDLAIKKS 569

Query: 586 FCHNFITRFQSSYDTVIGPHGTLLSGGQKQRIAIARALIKKPRILILDEATSALDVESEG 645
            C  F+  F    +T++GP GT LSGGQKQRIAIAR+ +  P IL+LDEATSALD +SE 
Sbjct: 570 NCTKFLANFPDGLNTIVGPRGTQLSGGQKQRIAIARSFLLDPSILLLDEATSALDTQSED 629

Query: 646 AINYTFGQLMKKKE---MTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELWDDPTS 702
            I  T    +KK+E   +T +SIAHRLSTI+ S  V+VL  +GSVVE GKF EL  +PTS
Sbjct: 630 IIAMT----LKKREAEGLTTISIAHRLSTIKYSSRVVVLNKNGSVVETGKFTELIANPTS 685

Query: 703 ELSQLLNEK 711
           EL+ LL+++
Sbjct: 686 ELNLLLSKE 694

>Kpol_2000.79 s2000 complement(175048..177171) [2124 bp, 707 aa]
           {ON} complement(175048..177171) [2124 nt, 708 aa]
          Length = 707

 Score =  515 bits (1326), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 277/609 (45%), Positives = 397/609 (65%), Gaps = 12/609 (1%)

Query: 114 HSEFRDIVRLMLLVRRDWKLLLTAVGLLTISCSIGMTIPKVIGLILDQLKNALAANSVDG 173
            S F+D+ RL  L R +   +  A+ L+ IS ++ M +P VIG +LD  K   +A+  +G
Sbjct: 94  RSGFKDVKRLFELARPETFYISIALLLIFISSAVSMVVPSVIGKLLDIAKPP-SADEENG 152

Query: 174 QPVSIDKLP------PIVFGLSFYEXXXXXXXXXXVGIAANYGRIILLRVLSERLVARLR 227
           + VS +KL         ++GL+  +          VG  AN GRII+L+V  ERLVARLR
Sbjct: 153 KGVS-EKLKEKEDEDKKIYGLTALQFYTALGVVFTVGALANTGRIIILKVTGERLVARLR 211

Query: 228 ATVIKKTIHQDAEFFDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGSVGIGMMX 287
              +K  + Q+A F D++KVGDLISRL +DA +V++S+TQ VSDG +A++ G VG GMM 
Sbjct: 212 TRTMKAALEQEAAFLDSNKVGDLISRLSTDASIVAKSVTQNVSDGTRAILQGFVGFGMMS 271

Query: 288 XXXXXXXXXXXVFTPPVILSASVFGKQISTTSRELQEATGHLTKVAEEQLSGIKTVQSFV 347
                      +  PP+   A ++G++I   SR+LQ + G LTKVAEEQL+  +T+Q++ 
Sbjct: 272 YISWQLTSVMLLLIPPLGAMAIIYGRKIRNLSRQLQTSVGGLTKVAEEQLNATRTIQAYG 331

Query: 348 AEQREINRYNFAIRDIFNIGKKAAVINAKFFSSTSAMGDLSFLTVLGFGSYLVLQNSLTI 407
            E++EI+RY   +R++F+IG K AV +  FF ST  +G+ + L++L  G+ ++   +LT+
Sbjct: 332 GEKKEIHRYATEVRNVFDIGYKEAVTSGLFFGSTGLVGNTALLSLLVVGTNMISSGALTV 391

Query: 408 GDLTAFMMYTEYTGNSIFGLSTFYSEIMQGAGAASRLFELTDRVPSISTTKGVKYKPGNG 467
           G+L++FMMY  YTG+S+FGLSTFYSE+M+GAGAA+R+FEL+DR P+I  T G       G
Sbjct: 392 GELSSFMMYAVYTGSSLFGLSTFYSELMKGAGAAARVFELSDRKPAIKPTIGKDPITLFG 451

Query: 468 E-IEFKNVSFAYPTRPSNMIFKNLNFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPSSG 526
           + +EFKNVSF YPTRP   IF++ + KIE G +VC VGPSG GKSTV+ LL +YY  + G
Sbjct: 452 KTVEFKNVSFWYPTRPKQQIFQDFSIKIEPGEHVCFVGPSGSGKSTVSSLLLRYYDVAKG 511

Query: 527 EILIDGQNINDLNSKSLRRHIGLVQQEPILMSGTIRDNIVYGLTEMPTKD--EIRQVAKQ 584
            IL+ G++I + + +  RR +G+VQQEP+L +GTI +NI+Y + E    +   I +  + 
Sbjct: 512 SILVGGEDIKNFSLRKYRRLLGVVQQEPMLFNGTILENILYSVPEEIANEPGRIERAIES 571

Query: 585 CFCHNFITRFQSSYDTVIGPHGTLLSGGQKQRIAIARALIKKPRILILDEATSALDVESE 644
             C  F+  F    +T++GP GT LSGGQKQRIA+AR  +  P ILILDEATSALD +SE
Sbjct: 572 ANCSKFLNNFPDGLNTLVGPRGTQLSGGQKQRIALARTFLLDPSILILDEATSALDSQSE 631

Query: 645 GAINYTFGQLMKKKEMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELWDDPTSEL 704
             I     Q   +K  T +SIAHRLSTI+ S  V+VLG +G VVE G F+EL  +P+S L
Sbjct: 632 DIIAQNL-QARNEKGQTTISIAHRLSTIKHSSRVVVLGKNGCVVETGTFQELISNPSSGL 690

Query: 705 SQLLNEKST 713
           + LL ++ +
Sbjct: 691 NILLTQEES 699

>KLLA0C01991g Chr3 (160778..162898) [2121 bp, 706 aa] {ON} similar
           to uniprot|P33310 Saccharomyces cerevisiae YLR188W MDL1
           Half-type ATP-binding cassette (ABC) transporter of the
           inner mitochondrial membrane mediates export of peptides
           generated upon proteolysis of mitochondrial proteins
           plays a role in the regulation of cellular resistance to
           oxidative stress
          Length = 706

 Score =  504 bits (1297), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 276/599 (46%), Positives = 380/599 (63%), Gaps = 12/599 (2%)

Query: 115 SEFRDIVRLMLLVRRDWKLLLTAVGLLTISCSIGMTIPKVIGLILDQLKNALAANSVDGQ 174
           S ++DI RL LL + + + +  A+ L+ +S ++ M +P VIG +LD       A     Q
Sbjct: 81  SGWQDIKRLFLLAKPETRSMFIALILIILSSAVSMAVPTVIGKLLD------IAREEHEQ 134

Query: 175 PVSIDKLPPIVFGLSFYEXXXXXXXXXXVGIAANYGRIILLRVLSERLVARLRATVIKKT 234
           P +  +   ++FGL+  +          VG  AN GRI++L+V  ERLVARLR   +K  
Sbjct: 135 PETEKE--TMIFGLTSTQFYTALGGVFVVGALANVGRIVILKVTGERLVARLRTRTMKAA 192

Query: 235 IHQDAEFFDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGSVGIGMMXXXXXXXX 294
           + QDA F D ++VGDLISRL SDA +VS+S+TQ +SDG +A+I G VG GMM        
Sbjct: 193 LEQDATFLDHNRVGDLISRLSSDAGIVSKSVTQNLSDGTRAVIQGFVGFGMMSFISWKLT 252

Query: 295 XXXXVFTPPVILSASVFGKQISTTSRELQEATGHLTKVAEEQLSGIKTVQSFVAEQREIN 354
               +  PP+ + A V+GK+I   SR+LQ + G LTKV+EEQLS  KT+Q++  E++EI+
Sbjct: 253 CVMMLLAPPLGVMALVYGKRIRNLSRQLQTSVGELTKVSEEQLSATKTIQAYCGEKKEIH 312

Query: 355 RYNFAIRDIFNIGKKAAVINAKFFSSTSAMGDLSFLTVLGFGSYLVLQNSLTIGDLTAFM 414
           RY   +R +F++G K A+ +  FF  T  +G+++ L +L  G+ ++    +T+GDL++FM
Sbjct: 313 RYADEVRKVFHVGLKEALTSGAFFGVTGFVGNVALLALLLTGTSMIKTGLMTVGDLSSFM 372

Query: 415 MYTEYTGNSIFGLSTFYSEIMQGAGAASRLFELTDRVPSISTTKGVK-YKPGNGEIEFKN 473
           MY  YTG+S+FGLS+FYSE+M+GAGAA+R+FEL DR P I  T G       N  I F +
Sbjct: 373 MYAVYTGSSLFGLSSFYSELMKGAGAAARVFELNDRKPLIHPTIGKDPVTLENKSIHFNH 432

Query: 474 VSFAYPTRPSNMIFKNLNFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPSSGEILIDGQ 533
           V F+YPTRP + IF++LNF +  G +VCIVGPSG GKSTVA LL +YY   SGEI +   
Sbjct: 433 VKFSYPTRPQHHIFEDLNFTVRPGEHVCIVGPSGGGKSTVASLLLRYYDIGSGEIKLGND 492

Query: 534 NINDLNSKSLRRHIGLVQQEPILMSGTIRDNIVYGLTEMPTKDEIR--QVAKQCFCHNFI 591
           NI D N +  RR +G+VQQEP+L SGTI DNI Y + +    DE R  +   Q  C  F+
Sbjct: 493 NIRDFNLRKYRRLLGVVQQEPMLFSGTILDNITYAVPQELVNDETRISRAIGQANCTKFL 552

Query: 592 TRFQSSYDTVIGPHGTLLSGGQKQRIAIARALIKKPRILILDEATSALDVESEGAINYTF 651
             F     T +GP GT LSGGQKQRIA+ARA +  P ILILDEATSALD +SE  +  + 
Sbjct: 553 ANFPDGLQTTVGPRGTQLSGGQKQRIALARAFLLDPSILILDEATSALDSQSEEVVAQSL 612

Query: 652 GQLMKKKEMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELWDDPTSELSQLLNE 710
            Q   + + TI SIAHR+STI+ S  VIVL   G+V E G F +L   P S L++LL++
Sbjct: 613 QQRSARGKTTI-SIAHRVSTIQHSSRVIVLNRHGTVAETGSFDKLIAIPDSSLNKLLSK 670

>AFR683C Chr6 complement(1697786..1699819) [2034 bp, 677 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR188W
           (MDL1)
          Length = 677

 Score =  502 bits (1292), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 290/689 (42%), Positives = 411/689 (59%), Gaps = 29/689 (4%)

Query: 26  YLSLLARPPTRQIIHNTGAGYGVWVSHKVLTSSTIRRPFTAHRALNNEYNTTAGNASVKS 85
           +LSL  +   R +I     G   W     L   T R  F+A   +    N+TA       
Sbjct: 9   WLSLAVKQVPRPVI-----GMQRWPPFNHLHQRT-RFSFSASTRIQTRLNSTA-----NP 57

Query: 86  QSATKEKNEEDRXXXXXXXXXXXXXXXNHSEFRDIVRLMLLVRRDWKLLLTAVGLLTISC 145
           +++T+EK  ++R               N S  +D+ RL  L R + K L+ A+ L+ IS 
Sbjct: 58  RASTEEKPHQERLELSTATG-------NASGAKDVRRLFQLARPELKSLVCALVLIVISG 110

Query: 146 SIGMTIPKVIGLILDQLKNALAANSVDGQPVSIDKLPPIVFGLSFYEXXXXXXXXXXVGI 205
           ++ MTIP VIG +LD  +  +   S D +   +  LP   F L+             VG 
Sbjct: 111 AVSMTIPSVIGKLLDVAREDVEQESGDEEEAVLYGLPEKQFYLAL-------SGIFAVGA 163

Query: 206 AANYGRIILLRVLSERLVARLRATVIKKTIHQDAEFFDTHKVGDLISRLGSDAYVVSRSM 265
            AN GRI++L+   ERLVARLR   +K  + Q+  F D+++VGDLISRL SDA +VS+S+
Sbjct: 164 LANMGRIVVLKTTGERLVARLRTRTMKAALEQEGAFLDSNRVGDLISRLSSDASIVSKSI 223

Query: 266 TQKVSDGFKALICGSVGIGMMXXXXXXXXXXXXVFTPPVILSASVFGKQISTTSRELQEA 325
           TQ  SDG +A+I G+VG GMM            +  PP++L A+ +G+++   SRELQ  
Sbjct: 224 TQNTSDGARAVIQGAVGFGMMSYISWQLTAVMTLLAPPLVLMAAFYGRRVRNLSRELQTK 283

Query: 326 TGHLTKVAEEQLSGIKTVQSFVAEQREINRYNFAIRDIFNIGKKAAVINAKFFSSTSAMG 385
            G LTKVAEEQL+  +TVQ++  E+REI RY   +R++F++G K A+I+  FF +T  +G
Sbjct: 284 VGGLTKVAEEQLNATRTVQAYCGERREIRRYATEVRNVFDVGLKEALISGSFFGATGFVG 343

Query: 386 DLSFLTVLGFGSYLVLQNSLTIGDLTAFMMYTEYTGNSIFGLSTFYSEIMQGAGAASRLF 445
           + + L +L  G+ ++    +++G+L++FMMY  YTG+S+F LS+FYSE+M+GAGAA R+F
Sbjct: 344 NATLLALLLTGTSMIKGGGISVGELSSFMMYAVYTGSSLFNLSSFYSELMKGAGAAVRVF 403

Query: 446 ELTDRVPSISTTKGVKYKPGNGE-IEFKNVSFAYPTRPSNMIFKNLNFKIEAGSNVCIVG 504
           EL DR P I  T G       G+ I F +V+FAYPTRP + +F  ++  I  G +VCIVG
Sbjct: 404 ELNDRKPLIHPTIGKDPVSLTGKTIAFNSVNFAYPTRPHHQVFAGMDLSICPGEHVCIVG 463

Query: 505 PSGRGKSTVALLLEKYYKPSSGEILIDGQNINDLNSKSLRRHIGLVQQEPILMSGTIRDN 564
           PSG GKSTVA LL ++Y P SG I I G++I   N    RR +G+VQQEP+L + +I +N
Sbjct: 464 PSGGGKSTVASLLLRFYDPISGSITIGGEDIRLFNLSKYRRMMGIVQQEPVLFNASILEN 523

Query: 565 IVYGLTEMPTKDEIR--QVAKQCFCHNFITRFQSSYDTVIGPHGTLLSGGQKQRIAIARA 622
           I Y L    TKD  R  +  +   C  F+  F     T +GP GT LSGGQKQR+A+ARA
Sbjct: 524 ITYALPLHLTKDPARIDRALRLSNCSAFVGSFPEGLQTAVGPRGTQLSGGQKQRVALARA 583

Query: 623 LIKKPRILILDEATSALDVESEGAINYTFGQLMKKKEMTIVSIAHRLSTIRRSENVIVLG 682
            ++ P ILILDEATSALD +SE  +  T  Q  ++ ++TI SIAHR STI+ S  VIVL 
Sbjct: 584 FLQDPAILILDEATSALDSKSEDIVASTLLQRCQEAKITI-SIAHRKSTIQHSTRVIVLD 642

Query: 683 HDGSVVEMGKFKELWDDPTSELSQLLNEK 711
             G V+E G +++L  DP S LS LL+++
Sbjct: 643 KLGHVLETGTYQQLIGDPGSSLSGLLSKE 671

>ZYRO0F17050g Chr6 complement(1417445..1419589) [2145 bp, 714 aa]
           {ON} similar to uniprot|P33310 Saccharomyces cerevisiae
           YLR188W MDL1 Half-type ATP-binding cassette (ABC)
           transporter of the inner mitochondrial membrane mediates
           export of peptides generated upon proteolysis of
           mitochondrial proteins plays a role in the regulation of
           cellular resistance to oxidative stress
          Length = 714

 Score =  500 bits (1288), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 275/609 (45%), Positives = 383/609 (62%), Gaps = 17/609 (2%)

Query: 113 NHSEFRDIVRLMLLVRRDWKLLLTAVGLLTISCSIGMTIPKVIGLILDQLKNALAAN--- 169
           N S FRDI RL+ L R +   ++ A+ L+ IS ++ M +P VIG +LD  K++  +    
Sbjct: 86  NSSGFRDITRLLGLARPEVWYIMGALCLIVISSTVSMLLPSVIGKLLDLAKSSSPSENEK 145

Query: 170 --SVDGQPVSIDKLPPIVFGLSFYEXXXXXXXXXXVGIAANYGRIILLRVLSERLVARLR 227
             S DG     DK    ++G +  +           G  AN GRII+L+V  ERLVARLR
Sbjct: 146 QESGDGDDKDKDKEEGTIYGFTPKQFCVIMGGIFVAGAFANCGRIIILKVTGERLVARLR 205

Query: 228 ATVIKKTIHQDAEFFDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGSVGIGMMX 287
              +K  + QD+ F D ++VGDLISRL SD+ +V++S+TQ VSDG +A+I G VG GMM 
Sbjct: 206 TRTMKAALDQDSAFLDRNRVGDLISRLSSDSSIVAKSLTQNVSDGTRAVIQGFVGFGMMT 265

Query: 288 XXXXXXXXXXXVFTPPVILSASVFGKQISTTSRELQEATGHLTKVAEEQLSGIKTVQSFV 347
                      +  PP+   A ++GK+I   S++LQ + G LTKVAEEQL   KT+QS+V
Sbjct: 266 YISWQLTCVMGLMLPPIGAMAIIYGKKIRNLSKQLQTSVGGLTKVAEEQLGATKTIQSYV 325

Query: 348 AEQREINRYNFAIRDIFNIGKKAAVINAKFFSSTSAMGDLSFLTVLGFGSYLVLQNSLTI 407
            E++EI RY   +R +F+IG K A+ +  FF ST  +G++S L +L  G+ ++    +T+
Sbjct: 326 GEKKEIRRYAKEVRQVFDIGLKEALTSGMFFGSTGFVGNISLLALLMSGASMIQSGLITV 385

Query: 408 GDLTAFMMYTEYTGNSIFGLSTFYSEIMQGAGAASRLFELTDRVPSISTTKG-----VKY 462
           GDL++FMMY  YTG S+FGLS FYSE+M+GAGAA+R+FEL DR P+I+ T G     ++ 
Sbjct: 386 GDLSSFMMYAVYTGGSMFGLSNFYSELMKGAGAAARVFELNDRKPAIAPTLGKGPTSIRN 445

Query: 463 KPGNGEIEFKNVSFAYPTRPSNMIFKNLNFKIEAGSNVCIVGPSGRGKSTVALLLEKYYK 522
            P    I FK+VSF YPTR +  IF +LN  I+ G ++CI GPSG GKST+A LL +YY 
Sbjct: 446 LP----ISFKDVSFTYPTRLNKKIFNHLNLTIQPGEHICIAGPSGSGKSTIASLLVRYYD 501

Query: 523 PSSGEILIDGQNINDLNSKSLRRHIGLVQQEPILMSGTIRDNIVYGLTEMPTKDEIRQVA 582
              G I I   ++   N +  RR IG+V QEP+L +GTI +NI+Y +     +DE R  A
Sbjct: 502 VDQGGISIGDTDLRTFNLRKYRRLIGVVHQEPVLFNGTILENILYAVPPSVAQDERRVSA 561

Query: 583 K--QCFCHNFITRFQSSYDTVIGPHGTLLSGGQKQRIAIARALIKKPRILILDEATSALD 640
              +  C  F++ F    +T++GP G  LSGGQKQR+A+ARA +  P +L+LDEATSALD
Sbjct: 562 AIGKANCSKFLSNFPDGLETLVGPRGAQLSGGQKQRVALARAFLLDPALLVLDEATSALD 621

Query: 641 VESEGAINYTFGQLMKKKEMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELWDDP 700
            +SE  +  T  Q   ++ +T +SIAHR+STI  S  V+VLG DG VVE G F+EL D P
Sbjct: 622 SQSEEIVARTL-QERVRRGLTTISIAHRISTIAHSTRVVVLGRDGFVVESGPFQELIDRP 680

Query: 701 TSELSQLLN 709
            SEL+ LL+
Sbjct: 681 NSELNYLLS 689

>Kwal_33.13308 s33 (166479..168599) [2121 bp, 706 aa] {ON} YLR188W
           (MDL1) - ATP-binding cassette (ABC) transporter family
           member [contig 118] FULL
          Length = 706

 Score =  499 bits (1286), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 276/605 (45%), Positives = 385/605 (63%), Gaps = 9/605 (1%)

Query: 113 NHSEFRDIVRLMLLVRRDWKLLLTAVGLLTISCSIGMTIPKVIGLILDQLKNALAANSVD 172
           N S ++DI RL  L R + + +  A+ L+ IS S+ M +P VIG ++D  K+   A+ + 
Sbjct: 80  NSSSWKDIKRLFQLARPESRSMFFALALIIISSSVSMLVPGVIGKLMDAAKDDQQASKLV 139

Query: 173 GQPVSIDKLPPI---VFGLSFYEXXXXXXXXXXVGIAANYGRIILLRVLSERLVARLRAT 229
                          +FGL+  +          VG AAN GRI++L+V  E+LVARLR  
Sbjct: 140 ENDSDAAAPDADGRQIFGLTMPQFYGVLFSVFVVGAAANMGRIVILKVTGEKLVARLRTR 199

Query: 230 VIKKTIHQDAEFFDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGSVGIGMMXXX 289
            +K ++ QDA F D +KVGDLISRL SDA +VS+S+TQ +SDG ++LI G VG GMM   
Sbjct: 200 TLKASLQQDASFLDNNKVGDLISRLSSDASIVSKSLTQNMSDGTRSLIQGFVGFGMMSYI 259

Query: 290 XXXXXXXXXVFTPPVILSASVFGKQISTTSRELQEATGHLTKVAEEQLSGIKTVQSFVAE 349
                    +  PP+   A ++GK+I   SR LQ + G LTK AEEQLS  +T+Q++  E
Sbjct: 260 SWKLTCVMMLLAPPLAAMALIYGKRIRNLSRTLQASVGGLTKAAEEQLSATRTIQAYGGE 319

Query: 350 QREINRYNFAIRDIFNIGKKAAVINAKFFSSTSAMGDLSFLTVLGFGSYLVLQNSLTIGD 409
           +  I++Y   +R ++ +G K A+ +  FF  T  +G+++ L +L  G+ ++   ++T+GD
Sbjct: 320 KHAIHQYAKEVRQVYQVGLKEALTSGAFFGLTGLVGNVAVLALLLTGTSMIRTGAMTLGD 379

Query: 410 LTAFMMYTEYTGNSIFGLSTFYSEIMQGAGAASRLFELTDRVPSISTTKGVKYKPGNGE- 468
           L++FM+Y  YTG+S+FG+S+FYSE+M+GAGAA+R+FEL DR P+I  T+G+      G+ 
Sbjct: 380 LSSFMIYAVYTGSSLFGMSSFYSELMKGAGAAARVFELNDRRPAIHPTRGIDPVSLAGKP 439

Query: 469 IEFKNVSFAYPTRPSNMIFKNLNFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPSSGEI 528
           +EF+NV FAYPTR  + IF+NL F+I AG +VCIVGPSG GKSTVA LL ++Y   +G I
Sbjct: 440 VEFQNVKFAYPTRHQHTIFENLTFRINAGEHVCIVGPSGGGKSTVASLLLRFYDVDTGAI 499

Query: 529 LIDGQNINDLNSKSLRRHIGLVQQEPILMSGTIRDNIVYGLTEMPTKDEIRQVAK---QC 585
            I GQ+I   N +  RR +G+VQQEP+L +GTI DNIVY + +    DE R VA+   Q 
Sbjct: 500 TIGGQSIASFNLRKYRRMLGVVQQEPMLFNGTILDNIVYSVPQSLLNDENR-VARAIGQA 558

Query: 586 FCHNFITRFQSSYDTVIGPHGTLLSGGQKQRIAIARALIKKPRILILDEATSALDVESEG 645
            C  F++ F     T++GP GT LSGGQKQRIA+ARA +  P +LILDEATSALD  SE 
Sbjct: 559 NCSAFLSSFPDGLQTLVGPRGTQLSGGQKQRIALARAFLLDPDLLILDEATSALDSRSEE 618

Query: 646 AINYTFGQLMKKKEMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELWDDPTSELS 705
            +         + + TI SIAHR+STI+ S  VIVLG  G VVE G F EL  DP S+L+
Sbjct: 619 VVARALYSRSTRGKTTI-SIAHRVSTIQHSSRVIVLGRSGYVVETGTFDELISDPDSQLN 677

Query: 706 QLLNE 710
            LL +
Sbjct: 678 LLLRK 682

>KLTH0F02024g Chr6 (161423..163627) [2205 bp, 734 aa] {ON} similar
           to uniprot|P33310 Saccharomyces cerevisiae YLR188W MDL1
           Half-type ATP-binding cassette (ABC) transporter of the
           inner mitochondrial membrane mediates export of peptides
           generated upon proteolysis of mitochondrial proteins
           plays a role in the regulation of cellular resistance to
           oxidative stress
          Length = 734

 Score =  499 bits (1284), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 277/624 (44%), Positives = 391/624 (62%), Gaps = 25/624 (4%)

Query: 113 NHSEFRDIVRLMLLVRRDWKLLLTAVGLLTISCSIGMTIPKVIGLILDQLKN-------- 164
           N S ++DI RL  L R + K +  A+ L+ +S S+ M +P VIG ++D  K         
Sbjct: 80  NSSSWKDIKRLFQLARPESKSMFFALVLIILSSSVSMLVPGVIGKLMDVAKEDGTSSSEA 139

Query: 165 ----ALAANSVDGQPVSIDKLPPIVFGLSFYEXXXXXXXXXXVGIAANYGRIILLRVLSE 220
                 A +  DG   +      ++ GL+  +          VG AAN GRI++L+V  E
Sbjct: 140 DGKRGDATDKTDGSTAADTDSEKLILGLTLPQFYGGLFSLFVVGAAANMGRIVILKVTGE 199

Query: 221 RLVARLRATVIKKTIHQDAEFFDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGS 280
           +LVARLR   +K  + QDA F D +KVGDLISRL SDA +VS+S+TQ +SDG ++LI G 
Sbjct: 200 KLVARLRTRTLKAALQQDASFLDNNKVGDLISRLSSDASIVSKSLTQNMSDGTRSLIQGF 259

Query: 281 VGIGMMXXXXXXXXXXXXVFTPPVILSASVFGKQISTTSRELQEATGHLTKVAEEQLSGI 340
           VG GMM            +  PP+ + A V+G++I   SR LQ + G LTK AEEQLS  
Sbjct: 260 VGFGMMSYISWKLTCVMMLLAPPLAVMALVYGRKIRNLSRTLQASVGGLTKAAEEQLSAT 319

Query: 341 KTVQSFVAEQREINRYNFAIRDIFNIGKKAAVINAKFFSSTSAMGDLSFLTVLGFGSYLV 400
           +T+Q++  E++ I  Y   +R ++ +G K A+ +  FF  T  +G+ + L +L  G+ ++
Sbjct: 320 RTIQAYGGEKQAIRHYAKEVRQVYQVGLKEALTSGGFFGLTGLVGNSAVLALLLTGTSMI 379

Query: 401 LQNSLTIGDLTAFMMYTEYTGNSIFGLSTFYSEIMQGAGAASRLFELTDRVPSISTTKG- 459
              ++T+GDL++FM+Y  YTG+S+FG+S+FYSE+M+GAGAA+R+FEL DR P+I  TKG 
Sbjct: 380 STGAMTVGDLSSFMIYAVYTGSSLFGMSSFYSELMKGAGAAARVFELNDRKPAIHPTKGR 439

Query: 460 ----VKYKPGNGEIEFKNVSFAYPTRPSNMIFKNLNFKIEAGSNVCIVGPSGRGKSTVAL 515
               +  KP    +EFK V FAYPTR  ++IF++L+ +I+ G +VCIVGPSG GKSTVA 
Sbjct: 440 DPVSLARKP----VEFKKVHFAYPTRRQHVIFEDLSLRIDPGEHVCIVGPSGGGKSTVAS 495

Query: 516 LLEKYYKPSSGEILIDGQNINDLNSKSLRRHIGLVQQEPILMSGTIRDNIVYGLTEMPTK 575
           LL ++Y   +G ILI GQNI D N +  RR +G+VQQEP+L +GTI +NI+Y + +    
Sbjct: 496 LLLRFYDVDAGAILIGGQNIADFNLRKYRRLVGIVQQEPMLFNGTILENILYTVPQRLLN 555

Query: 576 DEIRQVAK---QCFCHNFITRFQSSYDTVIGPHGTLLSGGQKQRIAIARALIKKPRILIL 632
           +E  +VA+   Q  C  F++ F     T++GP GT LSGGQKQRIA+ARA +  P +LIL
Sbjct: 556 EEDGRVARAIGQANCSAFLSSFPDGLQTMVGPRGTQLSGGQKQRIALARAFLLDPDLLIL 615

Query: 633 DEATSALDVESEGAINYTFGQLMKKKEMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGK 692
           DEATSALD  SE  I  T      + + TI SIAHR+STI+ S  VIVLG +G VVE G 
Sbjct: 616 DEATSALDSRSEEVIARTLHSRTTRGKTTI-SIAHRVSTIQHSTRVIVLGRNGGVVETGT 674

Query: 693 FKELWDDPTSELSQLLNEKSTPHQ 716
           F EL  +  S+L++LL ++  P Q
Sbjct: 675 FDELASNTDSQLNKLLRKEEEPVQ 698

>Skud_12.253 Chr12 (474886..476964) [2079 bp, 692 aa] {ON} YLR188W
           (REAL)
          Length = 692

 Score =  496 bits (1278), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 277/604 (45%), Positives = 387/604 (64%), Gaps = 18/604 (2%)

Query: 115 SEFRDIVRLMLLVRRDWKLLLTAVGLLTISCSIGMTIPKVIGLILDQLKNALAANSVDGQ 174
           S F+DI RL +L R + K +  A+ L+ IS S+ M +P VIG +LD       A+  D +
Sbjct: 84  SGFKDIKRLFVLSRPESKYIGLALLLILISSSVSMAVPSVIGKLLD------VASESDDE 137

Query: 175 PVSIDKLPPIVFGLSFYEXXXXXXXXXXVGIAANYGRIILLRVLSERLVARLRATVIKKT 234
                     ++GL+  +          +G  AN  RII+L++  ERLVARLR   +K  
Sbjct: 138 EDEEKARDSKLYGLTKKQFFTALGLVFVIGAVANASRIIILKITGERLVARLRTRTMKAA 197

Query: 235 IHQDAEFFDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGSVGIGMMXXXXXXXX 294
           + QDA F DT++VGDLISRL SDA +V++S+TQ VSDG +A+I G VG GMM        
Sbjct: 198 LDQDATFLDTNRVGDLISRLSSDASIVAKSVTQNVSDGTRAIIQGFVGFGMMSFLSWKLT 257

Query: 295 XXXXVFTPPVILSASVFGKQISTTSRELQEATGHLTKVAEEQLSGIKTVQSFVAEQREIN 354
               +  PP+   A V+GK+I   SR+LQ + G LTKVAEEQL+  +T+Q++  E+ E++
Sbjct: 258 CVMMLLAPPLGAMALVYGKKIRNLSRQLQTSVGGLTKVAEEQLNATRTIQAYGGEKNEVH 317

Query: 355 RYNFAIRDIFNIGKKAAVINAKFFSSTSAMGDLSFLTVLGFGSYLVLQNSLTIGDLTAFM 414
           RY   +R++F+IG K AV +  FF ST  +G+ + L++L  G+ ++    +TIG+L++FM
Sbjct: 318 RYAKEVRNVFHIGLKEAVTSGLFFGSTGLVGNTAMLSLLLVGTNMIQSGVMTIGELSSFM 377

Query: 415 MYTEYTGNSIFGLSTFYSEIMQGAGAASRLFELTDRVPSISTTKG-----VKYKPGNGEI 469
           MY  YTG+S+FGLS+FYSE+M+GAGAA+R+FEL DR P I  T G     + +KP    +
Sbjct: 378 MYAVYTGSSLFGLSSFYSELMKGAGAAARVFELNDRKPLIHPTIGKDPISLAHKP----V 433

Query: 470 EFKNVSFAYPTRPSNMIFKNLNFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPSSGEIL 529
            FKNVSF YPTRP + IFK+LN  I+ G +VC VGPSG GKST+A LL +YY  +SG I 
Sbjct: 434 VFKNVSFTYPTRPKHQIFKDLNITIKPGEHVCAVGPSGSGKSTIASLLLRYYDVNSGSIE 493

Query: 530 IDGQNINDLNSKSLRRHIGLVQQEPILMSGTIRDNIVYGL-TEMPTK-DEIRQVAKQCFC 587
            D +++ + N +  RR IG VQQEP+L +GTI DNI+Y + +E+  + D + +  +Q  C
Sbjct: 494 FDDEDVRNFNLRKYRRLIGYVQQEPLLFNGTILDNILYCIPSEIAEREDRVARAIEQANC 553

Query: 588 HNFITRFQSSYDTVIGPHGTLLSGGQKQRIAIARALIKKPRILILDEATSALDVESEGAI 647
             F+  F     T++G  G  LSGGQKQRIA+ARA +  P +LILDEATSALD +SE  +
Sbjct: 554 TKFLANFPDGLQTMVGARGAQLSGGQKQRIALARAFLLDPALLILDEATSALDSQSEEIV 613

Query: 648 NYTFGQLMKKKEMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELWDDPTSELSQL 707
                Q   ++ +T +SIAHRLSTI+ S  +IVLG  GSVVE G F++L   P SEL+ L
Sbjct: 614 AKNL-QKRVERGLTTISIAHRLSTIKHSTRIIVLGKHGSVVETGSFRDLIAIPDSELNAL 672

Query: 708 LNEK 711
           L E+
Sbjct: 673 LAEQ 676

>YLR188W Chr12 (528300..530387) [2088 bp, 695 aa] {ON}
           MDL1Mitochondrial inner membrane half-type ATP-binding
           cassette (ABC) transporter, mediates export of peptides
           generated upon proteolysis of mitochondrial proteins,
           plays a role in the regulation of cellular resistance to
           oxidative stress
          Length = 695

 Score =  496 bits (1278), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 281/604 (46%), Positives = 387/604 (64%), Gaps = 19/604 (3%)

Query: 115 SEFRDIVRLMLLVRRDWKLLLTAVGLLTISCSIGMTIPKVIGLILDQLKNALAANSVDGQ 174
           S F+DI RL +L + + K +  A+ L+ IS S+ M +P VIG +LD     LA+ S DG+
Sbjct: 84  SGFKDIKRLFVLSKPESKYIGLALLLILISSSVSMAVPSVIGKLLD-----LASES-DGE 137

Query: 175 PVSIDKLPPIVFGLSFYEXXXXXXXXXXVGIAANYGRIILLRVLSERLVARLRATVIKKT 234
                K   + +G +  +          +G  AN  RII+L+V  ERLVARLR   +K  
Sbjct: 138 DEEGSKSNKL-YGFTKKQFFTALGAVFIIGAVANASRIIILKVTGERLVARLRTRTMKAA 196

Query: 235 IHQDAEFFDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGSVGIGMMXXXXXXXX 294
           + QDA F DT++VGDLISRL SDA +V++S+TQ VSDG +A+I G VG GMM        
Sbjct: 197 LDQDATFLDTNRVGDLISRLSSDASIVAKSVTQNVSDGTRAIIQGFVGFGMMSFLSWKLT 256

Query: 295 XXXXVFTPPVILSASVFGKQISTTSRELQEATGHLTKVAEEQLSGIKTVQSFVAEQREIN 354
               +  PP+   A ++G++I   SR+LQ + G LTKVAEEQL+  +T+Q++  E+ E+ 
Sbjct: 257 CVMMILAPPLGAMALIYGRKIRNLSRQLQTSVGGLTKVAEEQLNATRTIQAYGGEKNEVR 316

Query: 355 RYNFAIRDIFNIGKKAAVINAKFFSSTSAMGDLSFLTVLGFGSYLVLQNSLTIGDLTAFM 414
           RY   +R++F+IG K AV +  FF ST  +G+ + L++L  G+ ++   S+T+G+L++FM
Sbjct: 317 RYAKEVRNVFHIGLKEAVTSGLFFGSTGLVGNTAMLSLLLVGTSMIQSGSMTVGELSSFM 376

Query: 415 MYTEYTGNSIFGLSTFYSEIMQGAGAASRLFELTDRVPSISTTKG-----VKYKPGNGEI 469
           MY  YTG+S+FGLS+FYSE+M+GAGAA+R+FEL DR P I  T G     +  KP    I
Sbjct: 377 MYAVYTGSSLFGLSSFYSELMKGAGAAARVFELNDRKPLIRPTIGKDPVSLAQKP----I 432

Query: 470 EFKNVSFAYPTRPSNMIFKNLNFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPSSGEIL 529
            FKNVSF YPTRP + IFK+LN  I+ G +VC VGPSG GKST+A LL +YY  +SG I 
Sbjct: 433 VFKNVSFTYPTRPKHQIFKDLNITIKPGEHVCAVGPSGSGKSTIASLLLRYYDVNSGSIE 492

Query: 530 IDGQNINDLNSKSLRRHIGLVQQEPILMSGTIRDNIVYGL-TEMPTKDE-IRQVAKQCFC 587
              ++I + N +  RR IG VQQEP+L +GTI DNI+Y +  E+  +D+ IR+   +  C
Sbjct: 493 FGDEDIRNFNLRKYRRLIGYVQQEPLLFNGTILDNILYCIPPEIAEQDDRIRRAIGKANC 552

Query: 588 HNFITRFQSSYDTVIGPHGTLLSGGQKQRIAIARALIKKPRILILDEATSALDVESEGAI 647
             F+  F     T++G  G  LSGGQKQRIA+ARA +  P +LILDEATSALD +SE  +
Sbjct: 553 TKFLANFPDGLQTMVGARGAQLSGGQKQRIALARAFLLDPAVLILDEATSALDSQSEEIV 612

Query: 648 NYTFGQLMKKKEMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELWDDPTSELSQL 707
                Q   ++  T +SIAHRLSTI+ S  VIVLG  GSVVE G F++L   P SEL+ L
Sbjct: 613 AKNL-QRRVERGFTTISIAHRLSTIKHSTRVIVLGKHGSVVETGSFRDLIAIPNSELNAL 671

Query: 708 LNEK 711
           L E+
Sbjct: 672 LAEQ 675

>Smik_12.248 Chr12 (475233..477323) [2091 bp, 696 aa] {ON} YLR188W
           (REAL)
          Length = 696

 Score =  492 bits (1267), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 277/609 (45%), Positives = 379/609 (62%), Gaps = 18/609 (2%)

Query: 115 SEFRDIVRLMLLVRRDWKLLLTAVGLLTISCSIGMTIPKVIGLILDQLKNALAANSVDGQ 174
           S F+DI RL +L + + K +  A+ L+ IS S+ M +P VIG +LD       A+  + +
Sbjct: 84  SGFKDIKRLFVLSKPESKYIGLALLLILISSSVSMAVPSVIGKLLD------LASETEDE 137

Query: 175 PVSIDKLPPIVFGLSFYEXXXXXXXXXXVGIAANYGRIILLRVLSERLVARLRATVIKKT 234
                     ++GL+  +          +G  AN  RII+L+V  ERLVARLR   +K  
Sbjct: 138 EKEEKAKSNKLYGLTKRQFFTALGLVFIIGAVANASRIIILKVTGERLVARLRTRTMKAA 197

Query: 235 IHQDAEFFDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGSVGIGMMXXXXXXXX 294
           + QDA F DT++VGDLISRL SDA +V++S+TQ VSDG +A+I G VG GMM        
Sbjct: 198 LDQDATFLDTNRVGDLISRLSSDASIVAKSVTQNVSDGTRAIIQGFVGFGMMSFLSWKLT 257

Query: 295 XXXXVFTPPVILSASVFGKQISTTSRELQEATGHLTKVAEEQLSGIKTVQSFVAEQREIN 354
               V  PP+   A ++G++I   SR+LQ + G LTKVAEEQL+  +T+Q++  E+ E+ 
Sbjct: 258 CVMMVLAPPLGAMALIYGRKIRNLSRQLQTSVGGLTKVAEEQLNATRTIQAYGGEKNEVR 317

Query: 355 RYNFAIRDIFNIGKKAAVINAKFFSSTSAMGDLSFLTVLGFGSYLVLQNSLTIGDLTAFM 414
           RY   +R++F+IG K AV +  FF ST  +G+ + L++L  G+ ++   S+T+G+L++FM
Sbjct: 318 RYAKEVRNVFHIGLKEAVTSGLFFGSTGLVGNTAMLSLLLVGTSMIQSGSMTVGELSSFM 377

Query: 415 MYTEYTGNSIFGLSTFYSEIMQGAGAASRLFELTDRVPSISTTKG-----VKYKPGNGEI 469
           MY  YTG+S+FGLS+FYSE+M+GAGAA+R+FEL DR P I  T G     +  KP    I
Sbjct: 378 MYAVYTGSSLFGLSSFYSELMKGAGAAARVFELNDRKPLIRPTIGKDPVSLAQKP----I 433

Query: 470 EFKNVSFAYPTRPSNMIFKNLNFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPSSGEIL 529
            FKNVSF YPTRP + IFK+LN  I  G +VC VGPSG GKST+A LL +YY  +SG I 
Sbjct: 434 VFKNVSFTYPTRPKHQIFKDLNITINPGEHVCAVGPSGSGKSTIASLLLRYYDVNSGSIE 493

Query: 530 IDGQNINDLNSKSLRRHIGLVQQEPILMSGTIRDNIVYGLTE--MPTKDEIRQVAKQCFC 587
              ++I   N +  RR IG VQQEP+L +GTI DNI+Y +       +D I +   Q  C
Sbjct: 494 FGDEDIRSFNLRKYRRLIGYVQQEPLLFNGTILDNILYCIPPEIAEQEDRIGRAIGQANC 553

Query: 588 HNFITRFQSSYDTVIGPHGTLLSGGQKQRIAIARALIKKPRILILDEATSALDVESEGAI 647
             F+  F     T +G  G  LSGGQKQRIA+ARA +  P +LILDEATSALD +SE  +
Sbjct: 554 TKFLANFPDGLQTTVGARGAQLSGGQKQRIALARAFLLDPAVLILDEATSALDSQSEEIV 613

Query: 648 NYTFGQLMKKKEMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELWDDPTSELSQL 707
                Q   ++ +T +SIAHRLSTI+ S  V+VLG  GSVVE G F++L   P SEL+ L
Sbjct: 614 AKNL-QRRVERGLTTISIAHRLSTIKHSTRVVVLGKHGSVVETGSFQDLIAIPNSELNAL 672

Query: 708 LNEKSTPHQ 716
           L E+    Q
Sbjct: 673 LAEQQDEEQ 681

>Suva_10.284 Chr10 (500972..503053) [2082 bp, 693 aa] {ON} YLR188W
           (REAL)
          Length = 693

 Score =  487 bits (1254), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 276/604 (45%), Positives = 381/604 (63%), Gaps = 18/604 (2%)

Query: 115 SEFRDIVRLMLLVRRDWKLLLTAVGLLTISCSIGMTIPKVIGLILDQLKNALAANSVDGQ 174
           S F+DI RL +L R +   +  A+ L+ IS S+ M +P VIG +LD   +         +
Sbjct: 83  SGFKDIKRLFVLSRPESGYIGLALLLILISSSVSMAVPSVIGKLLDLASDDDDEEDA--K 140

Query: 175 PVSIDKLPPIVFGLSFYEXXXXXXXXXXVGIAANYGRIILLRVLSERLVARLRATVIKKT 234
               +KL    +GLS  +          +G  AN  RII+L+V  ERLVARLR   +K  
Sbjct: 141 ETKDNKL----YGLSKRQFFTALGAVFLIGAIANASRIIILKVTGERLVARLRTRTMKAA 196

Query: 235 IHQDAEFFDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGSVGIGMMXXXXXXXX 294
           + QDA F DT++VGDLISRL SDA +V++S+TQ VSDG +A+I G VG GMM        
Sbjct: 197 LDQDATFLDTNRVGDLISRLSSDASIVAKSVTQNVSDGTRAIIQGFVGFGMMSFLSWKLT 256

Query: 295 XXXXVFTPPVILSASVFGKQISTTSRELQEATGHLTKVAEEQLSGIKTVQSFVAEQREIN 354
               V  PP+   A ++G++I   SR+LQ + G LTKVAEEQL+  +T+Q++  E+ E+ 
Sbjct: 257 CVMMVLAPPLGAMALIYGRKIRNLSRQLQTSVGGLTKVAEEQLNATRTIQAYGGEKNEVR 316

Query: 355 RYNFAIRDIFNIGKKAAVINAKFFSSTSAMGDLSFLTVLGFGSYLVLQNSLTIGDLTAFM 414
           RY   +R++F++G K AV +  FF ST  +G+ + L++L  G+ ++   ++T+G+LT+FM
Sbjct: 317 RYAKEVRNVFHVGLKEAVTSGLFFGSTGLVGNAAMLSLLLVGTNMIQSGAMTVGELTSFM 376

Query: 415 MYTEYTGNSIFGLSTFYSEIMQGAGAASRLFELTDRVPSISTTKG-----VKYKPGNGEI 469
           MY  YTG+S+FGLS+FYSE+M+GAGAA+R+FEL DR P I  T G     + +KP    I
Sbjct: 377 MYAVYTGSSLFGLSSFYSELMKGAGAAARVFELNDRKPLIRPTIGKDPVSLAHKP----I 432

Query: 470 EFKNVSFAYPTRPSNMIFKNLNFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPSSGEIL 529
            FK+VSF YPTRP + IFK+LN  I+ G +VC VGPSG GKST+A LL +YY  S+G I 
Sbjct: 433 VFKDVSFTYPTRPKHQIFKDLNITIKPGEHVCAVGPSGSGKSTIASLLLRYYDTSAGSID 492

Query: 530 IDGQNINDLNSKSLRRHIGLVQQEPILMSGTIRDNIVYGLTE--MPTKDEIRQVAKQCFC 587
              ++I + N +  RR +G VQQEP+L +GTI DNI+Y +       +D + +   Q  C
Sbjct: 493 FGDEDIKNFNLRKYRRLMGYVQQEPLLFNGTILDNILYCIPPEIAEQEDRVARAIGQANC 552

Query: 588 HNFITRFQSSYDTVIGPHGTLLSGGQKQRIAIARALIKKPRILILDEATSALDVESEGAI 647
             F+  F     T++G  G  LSGGQKQRIA+ARA +  P +LILDEATSALD +SE  +
Sbjct: 553 TKFLANFPDGLQTMVGARGAQLSGGQKQRIALARAFLLDPAVLILDEATSALDSQSEEVV 612

Query: 648 NYTFGQLMKKKEMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELWDDPTSELSQL 707
                Q   K+ +T +SIAHRLSTI+ S  VIVLG  GSVVE G F++L   P SEL+ L
Sbjct: 613 AKNL-QRRVKRGLTTISIAHRLSTIKHSTRVIVLGKHGSVVETGSFQDLISIPGSELNAL 671

Query: 708 LNEK 711
           L E+
Sbjct: 672 LAEQ 675

>CAGL0E00385g Chr5 (31960..33786) [1827 bp, 608 aa] {ON} similar to
           uniprot|P33310 Saccharomyces cerevisiae YLR188w MDL1 or
           uniprot|P33311 Saccharomyces cerevisiae YPL270w MDL2
          Length = 608

 Score =  469 bits (1207), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 265/604 (43%), Positives = 374/604 (61%), Gaps = 30/604 (4%)

Query: 117 FRDIVRLMLLVRRDWKLLLTAVGLLTISCSIGMTIPKVIGLILDQLKNALAANSVDGQPV 176
           +  + +L+ L + + K +  AVGL+ +S ++ M++P VIG ++D       A++ D    
Sbjct: 31  WTQVKQLLRLAKPERKYIAGAVGLIAVSSAVSMSLPSVIGTLIDH------ASTPDA--- 81

Query: 177 SIDKLPPIVFGLSFYEXXXXXXXXXXVGIAANYGRIILLRVLSERLVARLRATVIKKTIH 236
                 PI +GL+  +          VG  AN GRII+L++  E+LVARLR   +K  + 
Sbjct: 82  ------PI-YGLTRNQFLLALGSVFVVGAIANSGRIIILKITGEKLVARLRTKTMKSMLS 134

Query: 237 QDAEFFDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGSVGIGMMXXXXXXXXXX 296
           QDA F D H+VGDLISRL SDA +VS+S+T  +SDG +A + G VGIGMM          
Sbjct: 135 QDATFLDKHRVGDLISRLSSDASIVSKSVTSNLSDGCRATLQGVVGIGMMTYISLKLTTV 194

Query: 297 XXVFTPPVILSASVFGKQISTTSRELQEATGHLTKVAEEQLSGIKTVQSFVAEQREINRY 356
             +  PP+ + A ++G +I   SR+LQ+  G L+K +EEQL+ +KTVQ++  E++E+ RY
Sbjct: 195 MTMMVPPLGILAMLYGGKIKKISRQLQDKVGQLSKTSEEQLNSLKTVQAYAGERKELQRY 254

Query: 357 NFAIRDIFNIGKKAAVINAKFFSSTSAMGDLSFLTVLGFGSYLVLQNSLTIGDLTAFMMY 416
           +  +R +FNIG K AV +A FF ST  +G+++ + +L  G+     +S+T+G+L++FMMY
Sbjct: 255 SNEVRSVFNIGVKEAVASALFFGSTGLIGNIAMIGLLLVGTA---DSSITLGELSSFMMY 311

Query: 417 TEYTGNSIFGLSTFYSEIMQGAGAASRLFELTDRVPSISTTKGVK-YKPGNG-EIEFKNV 474
             YTG+S+FGL+ FYSE+M+G GAA R+ EL +    IS TKG+   K   G  I F NV
Sbjct: 312 GVYTGSSVFGLTGFYSELMKGCGAAERVLELQNMKTKISPTKGISPPKTLKGLPITFNNV 371

Query: 475 SFAYPTRPSNMIFKNLNFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPSSGEILIDGQN 534
           SFAY    S  +   +NF+I  G +VC VG SG GKST++ LL +YY+  SG I I   +
Sbjct: 372 SFAYSNGKS--VLSEMNFQIHPGEHVCFVGGSGCGKSTISSLLLRYYRTGSGNISIGNYD 429

Query: 535 INDLNSKSLRRHIGLVQQEPILMSGTIRDNIVYGLTEMPTKDEIRQVAKQCFCHNFITRF 594
           I+  N +  RR +G+VQQEP+L +GTI DNI YGL +    D +    K   C  FI   
Sbjct: 430 ISAFNLRKYRRMLGVVQQEPLLFNGTILDNITYGLHDKSLTD-LNMALKAANCDQFIKES 488

Query: 595 QSSYDTVIGPHGTLLSGGQKQRIAIARALIKKPRILILDEATSALDVESEGAINYTFGQL 654
               DT++GP G  LSGGQ+QRIA+AR  ++ P ILILDEATSALD +SE  IN    +L
Sbjct: 489 HMGLDTLVGPRGAQLSGGQRQRIALARVFLQNPDILILDEATSALDTKSEDIINK---EL 545

Query: 655 MKKKE--MTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELWDDPTSELSQLLNEKS 712
            +++E  MT +SIAHRLSTIR S  VIV+  DG VVE G F +L     SEL++LL E  
Sbjct: 546 QRRQEAGMTTISIAHRLSTIRHSSRVIVI-EDGRVVESGSFDQLRSTRDSELNKLLKEGL 604

Query: 713 TPHQ 716
             H+
Sbjct: 605 EHHK 608

>TBLA0A05300 Chr1 (1297764..1299887) [2124 bp, 707 aa] {ON} Anc_1.67
           YLR188W
          Length = 707

 Score =  466 bits (1200), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 253/608 (41%), Positives = 380/608 (62%), Gaps = 23/608 (3%)

Query: 119 DIVRLMLLVRRDWKLLLTAVGLLTISCSIGMTIPKVIGLILDQLKNALAANSVDGQPVS- 177
           DI  L  L + +   ++ ++GL+ I+ ++ M +P VIG +LD       A++ D    S 
Sbjct: 98  DIYNLFKLAKPEKWYIIASMGLIFITSAVSMLVPSVIGKLLDISTGIEFASNKDENDESS 157

Query: 178 ----------IDKLPPIVFGLSFYEXXXXXXXXXXVGIAANYGRIILLRVLSERLVARLR 227
                      +    +++G +             VG  AN GRII+L++  ER+VARLR
Sbjct: 158 KEDKNENENENENKQTLIYGYTPLVFFSGLGVIFVVGAIANTGRIIILKLTGERIVARLR 217

Query: 228 ATVIKKTIHQDAEFFDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGSVGIGMMX 287
              +K  + QD +F D++KVGDLISRL SD+ +VS ++T+ VSDG +A+I G VG+GMM 
Sbjct: 218 TRTMKNILKQDGKFQDSNKVGDLISRLSSDSSIVSNAVTRNVSDGARAVIQGCVGVGMMS 277

Query: 288 XXXXXXXXXXXVFTPPVILSASVFGKQISTTSRELQEATGHLTKVAEEQLSGIKTVQSFV 347
                         PP+ + A ++G++I   S++LQE+ G LTK++EEQL+G +T+QS+V
Sbjct: 278 FISLKLSGVMLFMVPPIGVLAMIYGRKIRNISKKLQESVGSLTKISEEQLNGTRTIQSYV 337

Query: 348 AEQREINRYNFAIRDIFNIGKKAAVINAKFFSSTSAMGDLSFLTVLGFGSYLVLQNSLTI 407
            E+ EI++Y   +R ++++G   AV +  FF  T  +G+ + L++L  G  ++   +L+I
Sbjct: 338 GEKLEIHKYAKEVRKVYHVGLNEAVASGLFFGVTGLIGNGAMLSLLYVGCNMISNGTLSI 397

Query: 408 GDLTAFMMYTEYTGNSIFGLSTFYSEIMQGAGAASRLFELTDRVPSISTTKGV-----KY 462
           G L++FMMY  YTG+S+FGLS+FYSEIM+G+GAASR+FE+   VP I+ TKG+     + 
Sbjct: 398 GGLSSFMMYAVYTGSSLFGLSSFYSEIMKGSGAASRIFEINKYVPDINATKGIDPISFQD 457

Query: 463 KPGNGEIEFKNVSFAYPTRPSNMIFKNLNFKIEAGSNVCIVGPSGRGKSTVALLLEKYYK 522
           KP    IEF+++ FAYPTR  +MIF++LN KI  G +VCI+GPSG GKST++ LL +YY 
Sbjct: 458 KP----IEFEHIKFAYPTRSGHMIFQDLNIKINPGEHVCIIGPSGSGKSTISSLLLRYYD 513

Query: 523 PSSGEILIDGQNINDLNSKSLRRHIGLVQQEPILMSGTIRDNIVYGLTEMPTKDEIR--Q 580
           P +G I I G++I + + +  R+ +G+V QEP+L +GTI +NI+Y + E    D+ R   
Sbjct: 514 PLAGTISIGGKDIKEYSLRKYRKLMGVVHQEPVLFNGTILENILYNVPEEIANDKERLSN 573

Query: 581 VAKQCFCHNFITRFQSSYDTVIGPHGTLLSGGQKQRIAIARALIKKPRILILDEATSALD 640
             +   C+ F+       +T +GP GT LSGGQKQR+A+ARA + +P +L+LDEATSALD
Sbjct: 574 AIESSNCNKFLNTLPLGLETPVGPRGTQLSGGQKQRVALARAFLLEPTLLVLDEATSALD 633

Query: 641 VESEGAINYTFGQLMKKKEMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELWDDP 700
             SE  +  T  Q   K   T +SIAHR+STI+ S  V+VL   G VVE G ++EL    
Sbjct: 634 PRSESIVAQTLKQRCAKG-FTTISIAHRVSTIKHSSRVVVLDKVGHVVETGPYEELLGIK 692

Query: 701 TSELSQLL 708
            S L++LL
Sbjct: 693 DSALNKLL 700

>Kwal_26.9480 s26 complement(1236178..1238337) [2160 bp, 719 aa]
           {ON} YMR301C (ATM1) - mitochondrial ABC transporter
           protein [contig 73] FULL
          Length = 719

 Score =  202 bits (515), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 140/393 (35%), Positives = 204/393 (51%), Gaps = 16/393 (4%)

Query: 324 EATGHLTKVAEEQLSGIKTVQSFVAEQREINRYNFAI---RDI-FNIGKKAAVINA-KFF 378
           +A      VA + L   + V+ F  EQ   N+Y+ ++   RD    + +  A +N+ +  
Sbjct: 316 KADNKAASVAVDSLINFEAVKYFNNEQYLANKYHKSLAQYRDSQIKVAQSLAFLNSGQNL 375

Query: 379 SSTSAMGDLSFLTVLGFGSYLVLQNSLTIGDLTAFMMYTEYTGNSIFGLSTFYSEIMQGA 438
             TSA+  + ++   G     V+   L++GDL             +  L + Y E+ Q  
Sbjct: 376 IFTSALTAMMYMGCTG-----VMSGELSVGDLVLINQLVFQLSVPLNFLGSVYRELKQSL 430

Query: 439 GAASRLFELTDRVPSISTTKGVKYKPGN--GEIEFKNVSFAYPTRPSNMIFKNLNFKIEA 496
                LF+L     SI  +K     P N   EI FKNVSF Y   P  +I KN +F I  
Sbjct: 431 IDMESLFQLQRNKVSIQNSKKPLMLPPNVPSEIVFKNVSFGYD--PDRLILKNASFTIPT 488

Query: 497 GSNVCIVGPSGRGKSTVALLLEKYYKPSSGEILIDGQNINDLNSKSLRRHIGLVQQEPIL 556
           GS   IVGPSG GKST+  L+ ++Y P  G IL+DG+++ +L+ +SLRR IG+V Q+  L
Sbjct: 489 GSKTAIVGPSGSGKSTILKLVFRFYDPIEGRILLDGKDVRELDIESLRRSIGVVPQDTPL 548

Query: 557 MSGTIRDNIVYGLTEMPTKDEIRQVAKQCFCHNFITRFQSSYDTVIGPHGTLLSGGQKQR 616
            + +I DN+ +G  +  T  EI +   +      I +     DT++G  G ++SGG+KQR
Sbjct: 549 FNESIWDNVKFGRID-ATDQEIERAIDRAQLRALIRQLPKGRDTIVGERGLMISGGEKQR 607

Query: 617 IAIARALIKKPRILILDEATSALDVESEGAINYTFGQLMKKKEMTIVSIAHRLSTIRRSE 676
           +AIAR L+K   I+  DEATSALD  +E A+  T  +       T V IAHRL TI  ++
Sbjct: 608 LAIARVLLKDAPIMFFDEATSALDTHTEQALLRTIKENFTTGSKTSVYIAHRLRTIADAD 667

Query: 677 NVIVLGHDGSVVEMGKFKELWDDPTSELSQLLN 709
            +IVL H G V E GK  EL   P S  ++L N
Sbjct: 668 KIIVLEH-GRVKEEGKHAELLATPKSLYAELWN 699

>SAKL0H00968g Chr8 (107767..109869) [2103 bp, 700 aa] {ON} highly
           similar to uniprot|P40416 Saccharomyces cerevisiae
           YMR301C ATM1 Mitochondrial inner membrane transporter
           exports mitochondrially synthesized precursors of
           iron-sulfur (Fe/S) clusters to the cytosol member of the
           ATP-binding cassette (ABC) transporter family
          Length = 700

 Score =  199 bits (506), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 137/393 (34%), Positives = 203/393 (51%), Gaps = 8/393 (2%)

Query: 320 RELQEATGHLTKVAEEQLSGIKTVQSFVAEQREINRYNFAIRDIFNIGKKAAVINAKFFS 379
           R    A      VA + L   + V+ F  E+   ++Y+ ++ +  N   K A  +  F +
Sbjct: 292 RSANRADNKAASVALDSLINFEAVKYFNNERYLADKYHNSLTNYTNSQIKVAQ-SLAFLN 350

Query: 380 STSAMGDLSFLTVLGF-GSYLVLQNSLTIGDLTAFMMYTEYTGNSIFGLSTFYSEIMQGA 438
           S   +   S LT + + G   V+   L++GDL             +  L + Y E+ Q  
Sbjct: 351 SGQNLIFTSALTAMMYMGCTGVMSGDLSVGDLVLINQLVFQLSVPLNFLGSVYRELKQSL 410

Query: 439 GAASRLFELTDRVPSISTTKGVKYKPGN--GEIEFKNVSFAYPTRPSNMIFKNLNFKIEA 496
                LF+L     +I  +K     P +   EI+F+NV+F Y   P   I +N NF + A
Sbjct: 411 IDMESLFKLQKNKVNIQNSKTPLMLPKDKPCEIKFENVTFGY--HPDRKILENANFTLPA 468

Query: 497 GSNVCIVGPSGRGKSTVALLLEKYYKPSSGEILIDGQNINDLNSKSLRRHIGLVQQEPIL 556
           G    IVGPSG GKST+  L+ ++Y P  G ILIDG++I +L+ KSLRR IG+V Q+  L
Sbjct: 469 GWKTAIVGPSGSGKSTILKLVFRFYDPQEGRILIDGKDIRELDLKSLRRAIGVVPQDTPL 528

Query: 557 MSGTIRDNIVYGLTEMPTKDEIRQVAKQCFCHNFITRFQSSYDTVIGPHGTLLSGGQKQR 616
            + TI +N+ +G     T D+IR+   +      I       +T++G  G ++SGG+KQR
Sbjct: 529 FNDTIWENVKFGKI-TATDDDIRKAIDKAQLAPLIHSLPQGSETIVGERGLMISGGEKQR 587

Query: 617 IAIARALIKKPRILILDEATSALDVESEGAINYTFGQLMKKKEMTIVSIAHRLSTIRRSE 676
           +AIAR L+K   I+  DEATSALD  +E A+  T  +       T + IAHRL TI  ++
Sbjct: 588 LAIARVLLKDTPIMFFDEATSALDTHTEQALLRTIKENFAGNSRTSIYIAHRLRTIADAD 647

Query: 677 NVIVLGHDGSVVEMGKFKELWDDPTSELSQLLN 709
            ++VL  +G V E GK  EL   PTS  S+L N
Sbjct: 648 KIVVL-ENGRVKEEGKHAELLSKPTSLYSELWN 679

>YKL209C Chr11 complement(42423..46295) [3873 bp, 1290 aa] {ON}
            STE6Plasma membrane ATP-binding cassette (ABC)
            transporter required for the export of a-factor,
            catalyzes ATP hydrolysis coupled to a-factor transport;
            contains 12 transmembrane domains and two ATP binding
            domains; expressed only in MATa cells
          Length = 1290

 Score =  202 bits (513), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 159/540 (29%), Positives = 270/540 (50%), Gaps = 45/540 (8%)

Query: 203  VGIAA-----NYGRIILLRVLSERLVARLRATVIKKTIHQDAEFF--DTHKVGDLISRLG 255
            +G+AA     N+ +  LL   SE  V  LR  V++K   ++ ++F  + +K  ++ + + 
Sbjct: 767  LGVAAADGIFNFAKGFLLDCCSEYWVMDLRNEVMEKLTRKNMDWFSGENNKASEISALVL 826

Query: 256  SDAYVVSRSMTQKVSDGFKALI----CGSVGIGMMXXXXXXXXXXXXVFTPPVILSASVF 311
            +D     R +   VS+   A+       ++G+                  P +I+ ++++
Sbjct: 827  NDL----RDLRSLVSEFLSAMTSFVTVSTIGLIWALVSGWKLSLVCISMFPLIIIFSAIY 882

Query: 312  GKQISTTSRELQEATGHLTKVAEEQLSGIKTVQSFVAE-QREINRYNFAIRDIFNIGKKA 370
            G  +     + + +   L     + ++ IKT++   AE   ++  ++  I+ +  I  K 
Sbjct: 883  GGILQKCETDYKTSVAQLENCLYQIVTNIKTIKCLQAEFHFQLTYHDLKIK-MQQIASKR 941

Query: 371  AVINAKFFSSTSAMGDLSFLTVLGFGSYLVLQNSLTIGDLTAFMMYTEYTGNSIFGLSTF 430
            A+      S T+ +       +  +G  LV+ +  T  ++        +T  S   L + 
Sbjct: 942  AIATGFGISMTNMIVMCIQAIIYYYGLKLVMIHEYTSKEMFTTFTLLLFTIMSCTSLVSQ 1001

Query: 431  YSEIMQGAGAASRLFELTD-------------RVPSIS--TTKGVKYKPGNGEIEFKNVS 475
              +I +G  AAS ++ + D             R   I+  T  G + KP    +  +N++
Sbjct: 1002 IPDISRGQRAASWIYRILDEKHNTLEVENNNARTVGIAGHTYHGKEKKP---IVSIQNLT 1058

Query: 476  FAYPTRPSNMIFKNLNFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPSSGEILIDGQNI 535
            FAYP+ P+  ++KN+NF +  G  + I+G SG GKST+ LLL K Y    G+I IDG ++
Sbjct: 1059 FAYPSAPTAFVYKNMNFDMFCGQTLGIIGESGTGKSTLVLLLTKLYNCEVGKIKIDGTDV 1118

Query: 536  NDLNSKSLRRHIGLVQQEPILMSGTIRDNIVYGLTEMPTKDEIRQVAKQCFCHNFITRFQ 595
            ND N  SLR+ I +V+Q+P+L +GTIRDN+ YGL +   + E+    K    H+F+    
Sbjct: 1119 NDWNLTSLRKEISVVEQKPLLFNGTIRDNLTYGLQDEILEIEMYDALKYVGIHDFVISSP 1178

Query: 596  SSYDTVIGPHGTLLSGGQKQRIAIARALIKKPRILILDEATSALDVESEGAINYTFGQLM 655
               DT I    TLLSGGQ QR+ IARAL++K +ILILDE TSALD  S   IN    +++
Sbjct: 1179 QGLDTRIDT--TLLSGGQAQRLCIARALLRKSKILILDECTSALDSVSSSIIN----EIV 1232

Query: 656  KKKEMTIVS--IAHRLSTIRRSENVIVLGHDGSVVEMGKFKELWDDPTSELSQLLNEKST 713
            KK    +++  I H    +R   ++ VL  DG VVE G F  L+++   EL Q+++ +S+
Sbjct: 1233 KKGPPALLTMVITHSEQMMRSCNSIAVL-KDGKVVERGNFDTLYNNR-GELFQIVSNQSS 1290

 Score =  165 bits (418), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 141/528 (26%), Positives = 238/528 (45%), Gaps = 67/528 (12%)

Query: 218 LSERLVARLRATVIKKTIHQD-AEFFDTHK--VGDLISRLGSDAYVVSRSMTQKVSDGFK 274
           + ER   R+R+ +++  + +   E++D ++  +GD  +++      +  S  +  +  F+
Sbjct: 99  IGERQGFRIRSQILEAYLEEKPMEWYDNNEKLLGDF-TQINRCVEELRSSSAEASAITFQ 157

Query: 275 ALICGSVGIGMMXXXXXXXXXXXXVFTPPVILSASVFGKQISTTSRELQEATGHLTKVAE 334
            L+     +G                +P +   A VF + I   S +    T    ++  
Sbjct: 158 NLVAICALLGTSFYYSWSLTLIILCSSPIITFFAVVFSRMIHVYSEKENSETSKAAQLLT 217

Query: 335 EQLSGIKTVQSFVAEQREINRYNFAIRDIFNIGKKAAVINAKFFSSTSAMGDLSFLTV-- 392
             ++  + V+ +  ++ E  ++   I     +      I + FF + +A G L FLT+  
Sbjct: 218 WSMNAAQLVRLYCTQRLERKKFKEII-----LNCNTFFIKSCFFVAANA-GILRFLTLTM 271

Query: 393 ----LGFGSYLVLQNSLTIGDLTAFMMYTEYTGNSIFGLSTFYSEIMQGAGAASRLFELT 448
                 FGS ++ +  L I D+                ++ F+S IM G+   + L ++ 
Sbjct: 272 FVQGFWFGSAMIKKGKLNINDV----------------ITCFHSCIMLGSTLNNTLHQIV 315

Query: 449 ---------DRVPSISTTKGVKYKPGN-------------GEIEFKNVSFAYPTRPSNMI 486
                    +++ ++    G K  P N              ++ F NVSF+YP+RPS  +
Sbjct: 316 VLQKGGVAMEKIMTL-LKDGSKRNPLNKTVAHQFPLDYATSDLTFANVSFSYPSRPSEAV 374

Query: 487 FKNLNFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPSSGEILIDGQNINDLNSKSLRRH 546
            KN++    AG    IVG SG GKST++ LL ++Y   +G I I+G NI  ++ K L  +
Sbjct: 375 LKNVSLNFSAGQFTFIVGKSGSGKSTLSNLLLRFYDGYNGSISINGHNIQTIDQKLLIEN 434

Query: 547 IGLVQQEPILMSGTIRDNIVYGLTEM---------PTKDEIRQVAKQCFCHNFITRFQSS 597
           I +V+Q   L + T+R NI+ G T+            +  I+   +      FI      
Sbjct: 435 ITVVEQRCTLFNDTLRKNILLGSTDSVRNADCSTNENRHLIKDACQMALLDRFILDLPDG 494

Query: 598 YDTVIGPHGTLLSGGQKQRIAIARALIKKPRILILDEATSALDVESEGAINYTFGQLMKK 657
            +T+IG  G  LSGGQ+QR+AIARA I+   IL LDEA SALD+     +        K 
Sbjct: 495 LETLIGTGGVTLSGGQQQRVAIARAFIRDTPILFLDEAVSALDIVHRNLLMKAIRHWRKG 554

Query: 658 KEMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELWDDPTSELS 705
           K  T + + H LS I  S++ + L  +G VVE G   EL  DPT+  S
Sbjct: 555 K--TTIILTHELSQI-ESDDYLYLMKEGEVVESGTQSELLADPTTTFS 599

>KLTH0B09482g Chr2 complement(777282..779366) [2085 bp, 694 aa] {ON}
           similar to uniprot|P40416 Saccharomyces cerevisiae
           YMR301C ATM1 Mitochondrial inner membrane transporter
           exports mitochondrially synthesized precursors of iron-
           sulfur (Fe/S) clusters to the cytosol member of the ATP-
           binding cassette (ABC) transporter family
          Length = 694

 Score =  191 bits (484), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 135/397 (34%), Positives = 204/397 (51%), Gaps = 24/397 (6%)

Query: 324 EATGHLTKVAEEQLSGIKTVQSFVAEQREINRYNFAI---RDI-FNIGKKAAVINA-KFF 378
           +A      VA + L   + V+ F  EQ   N+Y+ ++   RD    + +  A +NA + F
Sbjct: 288 KADNKAATVAVDSLINFEAVKYFNNEQFLANKYHNSLAQYRDSQIKVAQSLAFLNAGQNF 347

Query: 379 SSTSAMGDLSFLTVLGFGSYLVLQNSLTIGDLTAFMMYTEYTGNSIFGLSTFYSEIMQGA 438
             TSA+  + ++   G     V+  +L++GDL             +  L + Y E+ Q  
Sbjct: 348 IFTSALTAMMYMGCTG-----VISGTLSVGDLVLINQLVFQLSVPLNFLGSVYRELKQSL 402

Query: 439 GAASRLFELTDRVPSISTTKGVKYKP------GNGEIEFKNVSFAYPTRPSNMIFKNLNF 492
                LF+L      I      K KP         +I F+NVSF Y   P  MI KN +F
Sbjct: 403 IDMESLFQLQRNKVKIQN----KEKPLMLSSQRPSKIVFENVSFGYD--PDRMILKNSSF 456

Query: 493 KIEAGSNVCIVGPSGRGKSTVALLLEKYYKPSSGEILIDGQNINDLNSKSLRRHIGLVQQ 552
            + AG    IVGPSG GKST+  L+ ++Y P  G IL+DG+++ +L+ +SLRR IG+V Q
Sbjct: 457 TMPAGWKTAIVGPSGSGKSTILKLVFRFYDPQEGRILVDGKDVRELDIESLRRAIGVVPQ 516

Query: 553 EPILMSGTIRDNIVYGLTEMPTKDEIRQVAKQCFCHNFITRFQSSYDTVIGPHGTLLSGG 612
           +  L + +I +N+ +G     + +EIR   ++    + + +     DT++G  G ++SGG
Sbjct: 517 DTPLFNDSIWENVRFGKIS-ASDEEIRLAVEKAQLESLVDQLPKGRDTIVGERGLMISGG 575

Query: 613 QKQRIAIARALIKKPRILILDEATSALDVESEGAINYTFGQLMKKKEMTIVSIAHRLSTI 672
           +KQR+AIAR L+K   I+  DEATSALD  +E A+  T          T V IAHRL TI
Sbjct: 576 EKQRLAIARVLLKDAPIMFFDEATSALDTHTEQALLRTIKDNFPTGSKTSVYIAHRLRTI 635

Query: 673 RRSENVIVLGHDGSVVEMGKFKELWDDPTSELSQLLN 709
             ++ +IV+   G V E GK  EL   P S  ++L N
Sbjct: 636 ADADKIIVI-QQGQVKEEGKHAELLAKPGSLYAELWN 671

>KAFR0I02580 Chr9 complement(520294..522423) [2130 bp, 709 aa] {ON}
           Anc_5.20 YMR301C
          Length = 709

 Score =  190 bits (483), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 134/398 (33%), Positives = 206/398 (51%), Gaps = 17/398 (4%)

Query: 320 RELQEATGHLTKVAEEQLSGIKTVQSFVAEQREINRYNFAIRDIFN----IGKKAAVINA 375
           R+  +A      +A + L   + V+ F  E    ++YN A+ D  N    I K  A +N+
Sbjct: 302 RDANKADNKGASIALDSLINFEAVKYFNNENYLSSKYNSALIDYRNSQIKISKSLAFLNS 361

Query: 376 -KFFSSTSAMGDLSFLTVLGFGSYLVLQNSLTIGDLTAFMMYTEYTGNSIFGLSTFYSEI 434
            +    T+A+  + +L   G     V+  +LT+GDL             +  L + Y E+
Sbjct: 362 GQNLIFTTALTGMMYLGCTG-----VIGGNLTVGDLVLINQLVFQLSVPLNFLGSVYREL 416

Query: 435 MQGAGAASRLFELTD---RVPSISTTKGVKYKPGNGEIEFKNVSFAYPTRPSNMIFKNLN 491
            Q       LF+L     ++ +I   K +  + G  EI F+NV+F Y       I KN +
Sbjct: 417 KQSLIDMESLFKLRKNEVKIHNIENPKIILKEDGPFEITFENVTFGY--HADRKILKNAS 474

Query: 492 FKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPSSGEILIDGQNINDLNSKSLRRHIGLVQ 551
           F I AG    IVGPSG GKST+  L+ ++Y P  G ILI+G ++ ++   SLR+ IG+V 
Sbjct: 475 FTIPAGWKTAIVGPSGSGKSTILKLVFRFYDPEEGRILINGIDVREIELDSLRKLIGVVP 534

Query: 552 QEPILMSGTIRDNIVYGLTEMPTKDEIRQVAKQCFCHNFITRFQSSYDTVIGPHGTLLSG 611
           Q+  L + +I +N+ +G  +     EI +V ++    + I +   SY+T++G  G ++SG
Sbjct: 535 QDTPLFNDSIWENVKFGRID-ALDSEIYEVIEKAQLDSLIRKLPQSYETIVGERGLMISG 593

Query: 612 GQKQRIAIARALIKKPRILILDEATSALDVESEGAINYTFGQLMKKKEMTIVSIAHRLST 671
           G+KQR+AIAR L+K   ++  DEATSALD  +E A+  T     K    T + IAHRL T
Sbjct: 594 GEKQRLAIARVLLKDASVMFFDEATSALDTHTEQALLKTIRANFKTGSRTSIYIAHRLRT 653

Query: 672 IRRSENVIVLGHDGSVVEMGKFKELWDDPTSELSQLLN 709
           I  ++ +IVL  DG+V E G   EL    TS   +L N
Sbjct: 654 IADADKIIVL-EDGTVREEGTHNELLAKSTSLYKELWN 690

>KNAG0E01320 Chr5 (261901..263988) [2088 bp, 695 aa] {ON} Anc_5.20
           YMR301C
          Length = 695

 Score =  190 bits (482), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 132/398 (33%), Positives = 201/398 (50%), Gaps = 28/398 (7%)

Query: 320 RELQEATGHLTKVAEEQLSGIKTVQSFVAEQREINRYNFAI---RDI-FNIGKKAAVINA 375
           R    A      +A + L   + V+ F  E    ++YN A+   RD    + +  A +N+
Sbjct: 275 RSANRADNKGASIALDSLINFEAVKYFNNESYLASKYNNALMTYRDAQIKVSQSLAFLNS 334

Query: 376 -KFFSSTSAMGDLSFLTVLGFGSYLVLQNSLTIGDLTAFMMYTEYTGNSIFGLSTFYSEI 434
            +    TSA+  + ++   G     +L  +LT+GDL             +  L + Y E+
Sbjct: 335 GQNLIFTSALTAMMYMGCTG-----ILGGNLTVGDLVLINQLVFQLSVPLNFLGSVYREL 389

Query: 435 MQGAGAASRLFELTDRVPSISTTKGVKYKPGNG---EIEFKNVSFAYPTRPSNMIFKNLN 491
            Q       LF+L      I   +  K  P +G   EI F+NV+F Y   P   I KN +
Sbjct: 390 KQSLIDMESLFKLRRNEVVIKNVEQPKMLPADGKPFEIRFENVTFGY--EPDRTILKNAS 447

Query: 492 FKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPSSGEILIDGQNINDLNSKSLRRHIGLVQ 551
           F I AG  + IVGPSG GKST+  L+ ++Y P  G ILI+G ++ +++  SLR+ IG+V 
Sbjct: 448 FVIAAGKKIAIVGPSGSGKSTILKLVFRFYDPQEGRILINGIDVKEIDLDSLRKVIGVVP 507

Query: 552 QEPILMSGTIRDNIVYGLTEMPTKDEIRQVAKQCFCHNFITRFQSSYDTVIGPHGTLLSG 611
           Q+  L + TI +N+ +G  +  T +E+    ++      I++     DT++G  G ++SG
Sbjct: 508 QDTPLFNDTIWENVRFGRID-ATDEEVWAAVEKAHLSPLISKLSRGTDTIVGERGLMISG 566

Query: 612 GQKQRIAIARALIKKPRILILDEATSALDVESEGAINYTFGQLMKKKEMTIVSIAHRLST 671
           G+KQR+AIAR L+K   I+  DEATSALD  +E  +  T     K    T + IAHRL T
Sbjct: 567 GEKQRLAIARVLLKNADIMFFDEATSALDTHTEQNLLKTIRANFKTGSKTSIYIAHRLRT 626

Query: 672 IRRSENVIVLGHDGSVVEMGK-----------FKELWD 698
           I  ++ +IVL  DGSV E G            +K+LWD
Sbjct: 627 IADADKIIVL-EDGSVKEEGTHTELLARDHSLYKDLWD 663

>KLLA0A10131g Chr1 complement(889688..891850) [2163 bp, 720 aa] {ON}
           similar to uniprot|P40416 Saccharomyces cerevisiae
           YMR301C ATM1 Mitochondrial inner membrane transporter
           exports mitochondrially synthesized precursors of iron-
           sulfur (Fe/S) clusters to the cytosol member of the ATP-
           binding cassette (ABC) transporter family
          Length = 720

 Score =  188 bits (478), Expect = 9e-50,   Method: Compositional matrix adjust.
 Identities = 133/397 (33%), Positives = 205/397 (51%), Gaps = 16/397 (4%)

Query: 320 RELQEATGHLTKVAEEQLSGIKTVQSFVAEQREINRYNFAI---RDI-FNIGKKAAVINA 375
           R    A      VA + L   + V+ F  E+   N+Y+ ++   RD    + +  A +NA
Sbjct: 305 RSANRADNKAASVALDSLINFEAVKYFNNEEYLANKYHQSLSKYRDSQIKVAQSLAFLNA 364

Query: 376 -KFFSSTSAMGDLSFLTVLGFGSYLVLQNSLTIGDLTAFMMYTEYTGNSIFGLSTFYSEI 434
            + F  TSA+  + ++     G+  V++ +LT+GDL             +  L + Y E+
Sbjct: 365 GQNFIFTSALTAMMYM-----GASGVMEGALTVGDLVLINQLVFQLSVPLNFLGSVYREL 419

Query: 435 MQGAGAASRLFELTDRVPSISTTKGVKYKPGN--GEIEFKNVSFAYPTRPSNMIFKNLNF 492
            Q       LF+L      I  T+     P +   EI+F+NV+F Y  +P   I KN  F
Sbjct: 420 KQSLIDMESLFKLQKNPILIKNTERPLMLPEHLPCEIKFENVTFGY--QPDRNILKNATF 477

Query: 493 KIEAGSNVCIVGPSGRGKSTVALLLEKYYKPSSGEILIDGQNINDLNSKSLRRHIGLVQQ 552
            I  G    IVGPSG GKST+  L+ ++Y P  G IL+DG++I +L+   LRR +G+V Q
Sbjct: 478 TIAPGKKTAIVGPSGSGKSTILRLVFRFYDPQQGRILLDGKDIRELDLDELRRIVGVVPQ 537

Query: 553 EPILMSGTIRDNIVYGLTEMPTKDEIRQVAKQCFCHNFITRFQSSYDTVIGPHGTLLSGG 612
           +  L + TI +N+ +G     T +EI    ++    + I +     +T++G  G ++SGG
Sbjct: 538 DTPLFNDTIWENVKFGRIN-ATDNEIVTAIEKAQLSDLIHKLPKGTETIVGERGLMISGG 596

Query: 613 QKQRIAIARALIKKPRILILDEATSALDVESEGAINYTFGQLMKKKEMTIVSIAHRLSTI 672
           +KQR+AIAR L+K   I+  DEATSALD  +E ++  T  +       T V IAHRL TI
Sbjct: 597 EKQRLAIARVLLKDTPIMFFDEATSALDTHTEQSLLKTIKENFSDVAKTSVYIAHRLRTI 656

Query: 673 RRSENVIVLGHDGSVVEMGKFKELWDDPTSELSQLLN 709
             ++ +IVL  +G+V E G    L  +P S  S+L N
Sbjct: 657 ADADKIIVL-ENGAVREEGTHNALLANPNSLYSELWN 692

>TPHA0L02270 Chr12 complement(473597..475732) [2136 bp, 711 aa] {ON}
           Anc_5.20 YMR301C
          Length = 711

 Score =  185 bits (470), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 129/394 (32%), Positives = 197/394 (50%), Gaps = 9/394 (2%)

Query: 320 RELQEATGHLTKVAEEQLSGIKTVQSFVAEQREINRYNFAIRDIFNIGKKAAVINAKFFS 379
           R+  +A      +A + L   + V+ F  EQ   ++YN +++       K A  +  F +
Sbjct: 302 RQANKADNKGASIALDSLINFEAVKYFNNEQYLASKYNTSLKSYTEAQVKVAQ-SLAFLN 360

Query: 380 STSAMGDLSFLTVLGF-GSYLVLQNSLTIGDLTAFMMYTEYTGNSIFGLSTFYSEIMQGA 438
           S   +   S LT + + G   +L  +L++GDL             +  L + Y ++ Q  
Sbjct: 361 SGQNLIFTSALTAMMYMGCTGILGGNLSVGDLVLINQLVFQLSVPLNFLGSVYRDLKQSL 420

Query: 439 GAASRLFELTDRVPSISTTKG---VKYKPGNGEIEFKNVSFAYPTRPSNMIFKNLNFKIE 495
                LF+L      I   K    +  K G   IEFKNV+F Y   P+  I +N +F I 
Sbjct: 421 IDMESLFKLRKNEVKILNNKNPAILSLKDGPFNIEFKNVTFGYD--PNRKILRNASFIIP 478

Query: 496 AGSNVCIVGPSGRGKSTVALLLEKYYKPSSGEILIDGQNINDLNSKSLRRHIGLVQQEPI 555
           AG    +VGPSG GKST+  L+ ++Y P  G +L++G ++ D +  SLRR IG+V Q+  
Sbjct: 479 AGVKTAVVGPSGSGKSTILKLVFRFYDPEEGRVLVNGIDVRDYDLDSLRRAIGVVPQDTP 538

Query: 556 LMSGTIRDNIVYGLTEMPTKDEIRQVAKQCFCHNFITRFQSSYDTVIGPHGTLLSGGQKQ 615
           L + TI +N+ +G     T ++I    ++      I +    Y+T++G  G ++SGG+KQ
Sbjct: 539 LFNDTIWENVKFG-DVTATDEQILNAVEKAQLGTLIEKLPKKYETIVGERGLMISGGEKQ 597

Query: 616 RIAIARALIKKPRILILDEATSALDVESEGAINYTFGQLMKKKEMTIVSIAHRLSTIRRS 675
           R+AIAR L+K   I+  DEATSALD  +E  +  T      K   T V IAHRL T+  S
Sbjct: 598 RLAIARVLLKNAPIMFFDEATSALDTHTEQELLKTIKNNFDKGSRTSVYIAHRLRTVADS 657

Query: 676 ENVIVLGHDGSVVEMGKFKELWDDPTSELSQLLN 709
           + +IVL  +GS+ E G    L   P S    L N
Sbjct: 658 DKIIVL-KEGSIFEEGTHLGLLSKPNSLYKDLWN 690

>Skud_11.11 Chr11 complement(25896..29783) [3888 bp, 1295 aa] {ON}
            YKL209C (REAL)
          Length = 1295

 Score =  188 bits (477), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 154/521 (29%), Positives = 249/521 (47%), Gaps = 34/521 (6%)

Query: 203  VGIAA-----NYGRIILLRVLSERLVARLRATVIKKTIHQDAEFF--DTHKVGDLISRLG 255
            +G+AA     N+ +  LL   SE  +  LR  +++K   ++  +F  + +K  ++ + + 
Sbjct: 768  LGVAAADGIFNFAKGFLLGYCSEYWIMDLRNEIMEKVTRKNINWFSGENNKAAEISALVM 827

Query: 256  SDAYVVSRSMTQKVSDGFKALICGSVGIGMMXXXXXXXXXXXXVFTPPVILSASVFGKQI 315
            +D   +   +++ +S     +   ++G+                  P +I+ + ++G  +
Sbjct: 828  NDLRDLRSLVSEFLSAMTSFITVSTIGLVWALISGWKLSLVCISMFPLIIIFSVIYGSSL 887

Query: 316  STTSRELQEATGHLTKVAEEQLSGIKTVQSFVAEQREINRYNFAIRDIFNIGKKAAVINA 375
             T   + + +   L     + ++ IKT++   AE      Y+     +  I  K A+   
Sbjct: 888  QTYETDYKSSVAQLENCLYQIVTSIKTIKCLQAEFHFQLTYHDMKTKMEGIASKRAIATG 947

Query: 376  KFFSSTSAMGDLSFLTVLGFGSYLVLQNSLTIGDLTAFMMYTEYTGNSIFGLSTFYSEIM 435
               S T+ +       +  +G  LV+ +  T   + A      +T  S   L     +I 
Sbjct: 948  FGVSMTNMIAMCIQAILYYYGLKLVMVHEYTSKKMFATFTLLLFTIMSCTTLVGQIPDIS 1007

Query: 436  QGAGAASRLFELTD-------------RVPSISTTKGVKYKPGNGEI-EFKNVSFAYPTR 481
            +G  AAS ++ + D             RV  IS   G  Y   N  I   +N++FAYP+ 
Sbjct: 1008 RGQRAASWIYRILDEAECTLEIEDNNGRVLGIS--GGTYYGNSNKPIVSIQNLTFAYPSA 1065

Query: 482  PSNMIFKNLNFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPSSGEILIDGQNINDLNSK 541
            P+  I+K ++  +  G  V IVG SG GKST+ LLL   Y    G I IDG ++ND N  
Sbjct: 1066 PNISIYKRMDLNMFCGQTVGIVGESGSGKSTLVLLLTGLYACKVGCIEIDGTDVNDWNLT 1125

Query: 542  SLRRHIGLVQQEPILMSGTIRDNIVYG-LTEMPTKDEIRQVAKQCFCHNFITRFQSSYDT 600
            SLRR I +V+Q+P L  G+IRDN+ YG L +MP   E+    K    ++F+     S DT
Sbjct: 1126 SLRREISVVEQKPSLFDGSIRDNLTYGCLGQMP-DFELYDALKYVGIYDFVASLPQSLDT 1184

Query: 601  VIGPHGTLLSGGQKQRIAIARALIKKPRILILDEATSALDVESEGAINYTFGQLMKKKEM 660
             I  +  LLSGGQ QR+ IARAL++K +ILILDE TSALD  S   IN     ++KK   
Sbjct: 1185 RIDTN--LLSGGQAQRLCIARALLRKSKILILDECTSALDSVSSRIIN----DIVKKGPP 1238

Query: 661  TIVS--IAHRLSTIRRSENVIVLGHDGSVVEMGKFKELWDD 699
             +++  I H    +R   +V+V   DG +VE G F  L++D
Sbjct: 1239 ALLTMVITHNEEMMRCCSSVVVF-KDGKIVEEGSFDTLYND 1278

 Score =  170 bits (430), Expect = 9e-43,   Method: Compositional matrix adjust.
 Identities = 140/518 (27%), Positives = 243/518 (46%), Gaps = 45/518 (8%)

Query: 218 LSERLVARLRATVIKKTIHQDA-EFFDTHK--VGDLISRLGSDAYVVSRSMTQKVSDGFK 274
           + ER   R+R+ +++  + +   E++D ++  +GD  +++      +  S  +  +  F+
Sbjct: 100 IGERQGFRIRSMLLEAYLKKKPIEWYDANETLLGDF-TQINRCVEELRSSSAEASAITFQ 158

Query: 275 ALICGSVGIGMMXXXXXXXXXXXXVFTPPVILSASVFGKQISTTSRELQEATGHLTKVAE 334
            L+     IG                +P + L A  F + I   +++    TG   ++  
Sbjct: 159 NLVAICALIGTSFFYSWSLTLIILCSSPIIALFAVAFCRMIHIYTKKENTETGKAAQLLT 218

Query: 335 EQLSGIKTVQSFVAEQREINRY--------NFAIRDIFNIGKKAAVINAKFFSSTSAMGD 386
             ++  + V+ +  +  E  ++         F I+  F +   A V+  +F + T     
Sbjct: 219 WSMNAAQLVRLYCTQPLERKKFEEIVSNCNTFFIKSCFYLAANAGVL--RFLTLTM---- 272

Query: 387 LSFLTVLGFGSYLVLQNSLTIGD-LTAF---MMYTEYTGNSIFGLSTFYSEIMQGAGAAS 442
             F+    FGS ++ +  L I D +T F   +M      N++  +      + +G  A  
Sbjct: 273 --FVQGFWFGSTMIRKGRLNINDVITCFHSCIMLGTTLNNTLHQIVV----LQKGEVALE 326

Query: 443 RLFELTDRVPSISTTKGVK-YKP----GNGEIEFKNVSFAYPTRPSNMIFKNLNFKIEAG 497
           ++  L +  P  +T+  ++ Y+P      G++ F+NVSFAYP+RP+  I +N   K   G
Sbjct: 327 KIMTLLENGPKRNTSNTIELYQPLIDYATGDLVFENVSFAYPSRPTETILQNAGIKFPGG 386

Query: 498 SNVCIVGPSGRGKSTVALLLEKYYKPSSGEILIDGQNINDLNSKSLRRHIGLVQQEPILM 557
               IVG SG GKST++ LL K+Y    G I I+G+NI  +  KSL  +I +V+Q   L 
Sbjct: 387 QFTFIVGKSGSGKSTISNLLLKFYDGYDGSISINGRNIQTIPQKSLIENITVVEQRCTLF 446

Query: 558 SGTIRDNIVYGLT---------EMPTKDEIRQVAKQCFCHNFITRFQSSYDTVIGPHGTL 608
           + T+++NI+ G T          +   + I++  +       I       +T+IG  G  
Sbjct: 447 NNTLKNNILLGSTGSIRNADSNTIDNNNLIKEACRMALLDRLILDLPDGLETIIGSGGIT 506

Query: 609 LSGGQKQRIAIARALIKKPRILILDEATSALDVESEGAINYTFGQLMKKKEMTIVSIAHR 668
           LSGGQ+QR+AIARA I+   IL LDEA SALD+     +        K K  T + + H+
Sbjct: 507 LSGGQQQRVAIARAFIRDTPILFLDEAISALDIVHRNLLMKAIRHWRKGK--TTIILTHQ 564

Query: 669 LSTIRRSENVIVLGHDGSVVEMGKFKELWDDPTSELSQ 706
           LS I  +++ + L  DG V+E G   EL  D T+  S+
Sbjct: 565 LSQI-EADDYLYLMQDGKVIESGIQSELLVDSTTTFSK 601

>TDEL0G00430 Chr7 (89431..91521) [2091 bp, 696 aa] {ON} Anc_5.20
           YMR301C
          Length = 696

 Score =  184 bits (466), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 129/398 (32%), Positives = 201/398 (50%), Gaps = 17/398 (4%)

Query: 320 RELQEATGHLTKVAEEQLSGIKTVQSFVAEQREINRYNFAI---RDI-FNIGKKAAVINA 375
           R+  +A      VA + L   + V+ F  E     +Y+ ++   RD    I +  A +NA
Sbjct: 281 RDANKADNKAASVALDSLINFEAVKHFNNENYLAGKYHNSLMKYRDSQVKIAQSLAFLNA 340

Query: 376 -KFFSSTSAMGDLSFLTVLGFGSYLVLQNSLTIGDLTAFMMYTEYTGNSIFGLSTFYSEI 434
            + F  TSA+  + ++   G     V+   LT+GDL             +  L + Y E+
Sbjct: 341 GQNFIFTSALSAMMYMGCTG-----VIGGDLTVGDLVLINQLVFQLSVPLNFLGSVYREL 395

Query: 435 MQGAGAASRLFELTDRVPSISTTKGVKYKPGNG---EIEFKNVSFAYPTRPSNMIFKNLN 491
            Q       LF L +    I         P N    EI+F+NV+F Y TR    I +N +
Sbjct: 396 KQSLIDMEALFNLRNNKIKIHNNDKPLMLPENAGPFEIKFENVTFGYDTR--RKILRNAS 453

Query: 492 FKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPSSGEILIDGQNINDLNSKSLRRHIGLVQ 551
           F I AG    IVGPSG GKST+  L+ ++Y P SG +L++G+++ + +  S R+ IG+V 
Sbjct: 454 FTIPAGVKTAIVGPSGSGKSTILKLVFRFYDPESGRVLVNGKDVREYDLDSFRKVIGVVP 513

Query: 552 QEPILMSGTIRDNIVYGLTEMPTKDEIRQVAKQCFCHNFITRFQSSYDTVIGPHGTLLSG 611
           Q+  L + TI +N+ +G  +  T DE+    ++      I +      T++G  G ++SG
Sbjct: 514 QDTPLFNDTIWENVKFGRID-ATDDEVTNAIEKAQLAPLIHKLPVGSATIVGERGLMISG 572

Query: 612 GQKQRIAIARALIKKPRILILDEATSALDVESEGAINYTFGQLMKKKEMTIVSIAHRLST 671
           G+KQR+AIAR L+K  +I+  DEATSALD  +E ++  T  +   +   T V +AHRL T
Sbjct: 573 GEKQRLAIARVLLKNSQIMFFDEATSALDTHTEQSLLKTIRENFDRGSRTSVYVAHRLRT 632

Query: 672 IRRSENVIVLGHDGSVVEMGKFKELWDDPTSELSQLLN 709
           I  ++ ++VL  +G V E G   EL   P S   QL +
Sbjct: 633 IADADKILVL-EEGCVREEGSHTELLSRPNSLYKQLWD 669

>Ecym_5649 Chr5 complement(1310682..1312772) [2091 bp, 696 aa] {ON}
           similar to Ashbya gossypii AGL335W
          Length = 696

 Score =  183 bits (464), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 130/397 (32%), Positives = 202/397 (50%), Gaps = 16/397 (4%)

Query: 320 RELQEATGHLTKVAEEQLSGIKTVQSFVAEQREINRYNFAI---RDI-FNIGKKAAVINA 375
           R+   A      VA + L   + V+ F  E+   N+Y+ ++   RD    + +  A +N+
Sbjct: 293 RDANSADNKAASVALDSLINFEAVKYFNNEEYLANKYHKSLLTYRDSQIKVQQSLAFLNS 352

Query: 376 -KFFSSTSAMGDLSFLTVLGFGSYLVLQNSLTIGDLTAFMMYTEYTGNSIFGLSTFYSEI 434
            +    TSA+  + ++   G     V++ SLT+GDL             +  L + Y E+
Sbjct: 353 GQNLIFTSALTAVMYMACSG-----VMEGSLTVGDLVLINQLIFQLSLPLNFLGSVYREL 407

Query: 435 MQGAGAASRLFELTDRVPSISTTKGVKYKPGN--GEIEFKNVSFAYPTRPSNMIFKNLNF 492
            Q       LF L     +I      +  P     +I F+NV+F Y   P   I KN  F
Sbjct: 408 KQSLIDMESLFRLQKNKITIKNVLNPQMLPEKLPSDIRFENVTFGYD--PERKILKNATF 465

Query: 493 KIEAGSNVCIVGPSGRGKSTVALLLEKYYKPSSGEILIDGQNINDLNSKSLRRHIGLVQQ 552
            I AG    IVGPSG GKST+  L+ ++Y+P  G ILIDG++I +++  SLR+ IG+V Q
Sbjct: 466 TIPAGKKTAIVGPSGSGKSTILRLVFRFYEPEQGRILIDGKDIREVDLDSLRKSIGVVPQ 525

Query: 553 EPILMSGTIRDNIVYGLTEMPTKDEIRQVAKQCFCHNFITRFQSSYDTVIGPHGTLLSGG 612
           +  L + TI +N+ +G  +   KD I    ++      I       +T++G  G ++SGG
Sbjct: 526 DTPLFNDTIWENVKFGRIDASDKD-ITNAIERAQLTKLIQNLPKGINTIVGERGLMISGG 584

Query: 613 QKQRIAIARALIKKPRILILDEATSALDVESEGAINYTFGQLMKKKEMTIVSIAHRLSTI 672
           +KQR+AI+R L+K   ++  DEATSALD  +E ++  T  +  + +  T V IAHRL TI
Sbjct: 585 EKQRLAISRVLLKDCPLMFFDEATSALDTHTEQSLLKTINENFEGQSKTSVYIAHRLRTI 644

Query: 673 RRSENVIVLGHDGSVVEMGKFKELWDDPTSELSQLLN 709
             ++ +IVL ++  V E G  K L   P S  S+L N
Sbjct: 645 ADADKIIVL-NNSRVHEEGDHKTLLKTPGSLYSELWN 680

>Suva_13.491 Chr13 complement(849300..851381) [2082 bp, 693 aa] {ON}
           YMR301C (REAL)
          Length = 693

 Score =  182 bits (463), Expect = 6e-48,   Method: Compositional matrix adjust.
 Identities = 132/404 (32%), Positives = 203/404 (50%), Gaps = 16/404 (3%)

Query: 320 RELQEATGHLTKVAEEQLSGIKTVQSFVAEQREINRYNFAI---RDI-FNIGKKAAVINA 375
           R+   A      VA + L   + V+ F  E+   ++YN ++   RD    + +  A +N+
Sbjct: 288 RDANRADNKAASVALDSLINFEAVKYFNNEKYLADKYNGSLINYRDSQIKVSQSLAFLNS 347

Query: 376 -KFFSSTSAMGDLSFLTVLGFGSYLVLQNSLTIGDLTAFMMYTEYTGNSIFGLSTFYSEI 434
            +    TSA+  + ++   G     V+   LT+GDL             +  L + Y E+
Sbjct: 348 GQNLIFTSALTAMMYMGCTG-----VIGGDLTVGDLVLINQLVFQLSVPLNFLGSVYREL 402

Query: 435 MQGAGAASRLFELTDRVPSISTTKGVKYKPGN--GEIEFKNVSFAYPTRPSNMIFKNLNF 492
            Q       LF+L      I   +     P +   +I F+NV+F Y   P   I KN +F
Sbjct: 403 KQSLIDMEALFKLRKNEIKIKNAERPLMLPEHVPYDITFQNVTFGY--HPDRKILKNASF 460

Query: 493 KIEAGSNVCIVGPSGRGKSTVALLLEKYYKPSSGEILIDGQNINDLNSKSLRRHIGLVQQ 552
            I AGS   IVG SG GKST+  L+ ++Y P SG ILI+G++I + +  +LR+ IG+V Q
Sbjct: 461 TIPAGSKTAIVGSSGSGKSTILKLVFRFYDPESGRILINGRDIKEYDIDALRKVIGVVPQ 520

Query: 553 EPILMSGTIRDNIVYGLTEMPTKDEIRQVAKQCFCHNFITRFQSSYDTVIGPHGTLLSGG 612
           +  L + TI +N+ +G  +  T +E+  V ++      I +    ++T++G  G ++SGG
Sbjct: 521 DTPLFNDTIWENVKFGRID-ATDEEVNTVVEKAQLAPLIKKLPQGFNTIVGERGLMISGG 579

Query: 613 QKQRIAIARALIKKPRILILDEATSALDVESEGAINYTFGQLMKKKEMTIVSIAHRLSTI 672
           +KQR+AIAR L+K  RI+  DEATSALD  +E A+  T          T V IAHRL TI
Sbjct: 580 EKQRLAIARVLLKNARIMFFDEATSALDTHTEQALLRTIRSNFPSGSRTSVYIAHRLRTI 639

Query: 673 RRSENVIVLGHDGSVVEMGKFKELWDDPTSELSQLLNEKSTPHQ 716
             ++ +IV   +G V E GK  EL   P S   +L   +   H 
Sbjct: 640 ADADKIIVF-DNGKVREEGKHLELLATPGSLYRELWTIQEDLHH 682

>Skud_13.475 Chr13 complement(841033..843108) [2076 bp, 691 aa] {ON}
           YMR301C (REAL)
          Length = 691

 Score =  182 bits (461), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 131/403 (32%), Positives = 202/403 (50%), Gaps = 16/403 (3%)

Query: 320 RELQEATGHLTKVAEEQLSGIKTVQSFVAEQREINRYNFAIRDIFNIGKKAAVINAKFFS 379
           R+   A      VA + L   + V+ F  E+   ++YN ++ +  +   K +   A   S
Sbjct: 286 RDANRADNKAASVALDSLINFEAVKYFNNEKYLSSKYNSSLMNYRDSQIKVSQSLAFLNS 345

Query: 380 STSAMGDLSFLTVLGFGSYLVLQNSLTIGDLTAFMMYTEYTGNSIFGLSTFYSEIMQGAG 439
             + +   +   ++  G   V+   LT+GDL             +  L + Y ++ Q   
Sbjct: 346 GQNLIFTTALTAMMYMGCTGVIGGDLTVGDLVLINQLVFQLSVPLNFLGSVYRDLKQSLI 405

Query: 440 AASRLFELTDRVPSISTTKGVKYKPGN--GEIEFKNVSFAYPTRPSNMIFKNLNFKIEAG 497
               LF+L      I + +     P +   EI F+NV+F Y   P   I KN +F I AG
Sbjct: 406 DMETLFKLRKNEVKIKSVERPLMLPEHVPYEITFENVTFGY--HPDRKILKNASFTIPAG 463

Query: 498 SNVCIVGPSGRGKSTVALLLEKYYKPSSGEILIDGQNINDLNSKSLRRHIGLVQQEPILM 557
               IVG SG GKST+  L+ ++Y P SG ILI+G++I + +  +LRR IG+V Q+  L 
Sbjct: 464 WKTAIVGSSGSGKSTILKLVFRFYDPESGRILINGRDIKEYDIDALRRVIGVVPQDTPLF 523

Query: 558 SGTIRDNIVYGLTEMPTKDEIRQVAKQCFCHNFITRFQSSYDTVIGPHGTLLSGGQKQRI 617
           + TI +N+ +G  +  T +E++   ++      I +    ++T++G  G ++SGG+KQR+
Sbjct: 524 NDTIWENVKFGRID-ATDEEVKTAVQKAQLAPLIKKLPQGFETIVGERGLMISGGEKQRL 582

Query: 618 AIARALIKKPRILILDEATSALDVESEGAINYTFGQLMKKKEMTIVSIAHRLSTIRRSEN 677
           AIAR L+K  RI+  DEATSALD  +E A+  T          T V IAHRL TI  ++ 
Sbjct: 583 AIARVLLKNARIMFFDEATSALDTHTEQALLRTIRSNFPSGSRTSVYIAHRLRTIADADK 642

Query: 678 VIVLGHDGSVVEMGKFKELWDDPTS----------ELSQLLNE 710
           +IVL  +G+V E GK  EL   P S          +LS L NE
Sbjct: 643 IIVL-DNGTVKEDGKHIELLATPGSLYRELWTIQEDLSHLENE 684

>YMR301C Chr13 complement(867555..869627) [2073 bp, 690 aa] {ON}
           ATM1Mitochondrial inner membrane ATP-binding cassette
           (ABC) transporter, exports mitochondrially synthesized
           precursors of iron-sulfur (Fe/S) clusters to the cytosol
          Length = 690

 Score =  181 bits (460), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 128/390 (32%), Positives = 198/390 (50%), Gaps = 6/390 (1%)

Query: 320 RELQEATGHLTKVAEEQLSGIKTVQSFVAEQREINRYNFAIRDIFNIGKKAAVINAKFFS 379
           R+  +A      VA + L   + V+ F  E+   ++YN ++ +  +   K +   A   S
Sbjct: 285 RDANKADNKAASVALDSLINFEAVKYFNNEKYLADKYNGSLMNYRDSQIKVSQSLAFLNS 344

Query: 380 STSAMGDLSFLTVLGFGSYLVLQNSLTIGDLTAFMMYTEYTGNSIFGLSTFYSEIMQGAG 439
             + +   +   ++  G   V+  +LT+GDL             +  L + Y ++ Q   
Sbjct: 345 GQNLIFTTALTAMMYMGCTGVIGGNLTVGDLVLINQLVFQLSVPLNFLGSVYRDLKQSLI 404

Query: 440 AASRLFELTDRVPSISTTKGVKYKPGN--GEIEFKNVSFAYPTRPSNMIFKNLNFKIEAG 497
               LF+L      I   +     P N   +I F+NV+F Y   P   I KN +F I AG
Sbjct: 405 DMETLFKLRKNEVKIKNAERPLMLPENVPYDITFENVTFGY--HPDRKILKNASFTIPAG 462

Query: 498 SNVCIVGPSGRGKSTVALLLEKYYKPSSGEILIDGQNINDLNSKSLRRHIGLVQQEPILM 557
               IVG SG GKST+  L+ ++Y P SG ILI+G++I + +  +LR+ IG+V Q+  L 
Sbjct: 463 WKTAIVGSSGSGKSTILKLVFRFYDPESGRILINGRDIKEYDIDALRKVIGVVPQDTPLF 522

Query: 558 SGTIRDNIVYGLTEMPTKDEIRQVAKQCFCHNFITRFQSSYDTVIGPHGTLLSGGQKQRI 617
           + TI +N+ +G  +  T +E+  V ++      I +    +DT++G  G ++SGG+KQR+
Sbjct: 523 NDTIWENVKFGRID-ATDEEVITVVEKAQLAPLIKKLPQGFDTIVGERGLMISGGEKQRL 581

Query: 618 AIARALIKKPRILILDEATSALDVESEGAINYTFGQLMKKKEMTIVSIAHRLSTIRRSEN 677
           AIAR L+K  RI+  DEATSALD  +E A+  T          T V IAHRL TI  ++ 
Sbjct: 582 AIARVLLKNARIMFFDEATSALDTHTEQALLRTIRDNFTSGSRTSVYIAHRLRTIADADK 641

Query: 678 VIVLGHDGSVVEMGKFKELWDDPTSELSQL 707
           +IVL  +G V E GK  EL   P S   +L
Sbjct: 642 IIVL-DNGRVREEGKHLELLAMPGSLYREL 670

>Smik_13.518 Chr13 complement(850174..852237) [2064 bp, 687 aa] {ON}
           YMR301C (REAL)
          Length = 687

 Score =  179 bits (455), Expect = 8e-47,   Method: Compositional matrix adjust.
 Identities = 129/395 (32%), Positives = 203/395 (51%), Gaps = 16/395 (4%)

Query: 320 RELQEATGHLTKVAEEQLSGIKTVQSFVAEQREINRYNFAI---RDI-FNIGKKAAVINA 375
           R+  +A      VA + L   + V+ F  E+   ++YN ++   RD    + +  A +N+
Sbjct: 285 RDANKADNKAASVALDSLINFEAVKYFNNEKYLSDKYNSSLISYRDSQIKVSQSLAFLNS 344

Query: 376 -KFFSSTSAMGDLSFLTVLGFGSYLVLQNSLTIGDLTAFMMYTEYTGNSIFGLSTFYSEI 434
            +    T+A+  + ++   G     V+  +LT+GDL             +  L + Y ++
Sbjct: 345 GQNLIFTTALTAMMYMGCTG-----VIGGNLTVGDLVLINQLVFQLSVPLNFLGSVYRDL 399

Query: 435 MQGAGAASRLFELTDRVPSISTTKGVKYKPGN--GEIEFKNVSFAYPTRPSNMIFKNLNF 492
            Q       LF+L      I   +     P +   +I F+NV+F Y   P   I KN +F
Sbjct: 400 KQSLIDMETLFKLRRNEVKIKNAERPLMLPEHVPYDITFENVTFGY--HPDRKILKNASF 457

Query: 493 KIEAGSNVCIVGPSGRGKSTVALLLEKYYKPSSGEILIDGQNINDLNSKSLRRHIGLVQQ 552
            I AG    IVG SG GKST+  L+ ++Y P SG ILI+G++I + +  +LR+ IG+V Q
Sbjct: 458 TIPAGWKTAIVGSSGSGKSTILKLVFRFYDPESGRILINGRDIREYDINALRKVIGVVPQ 517

Query: 553 EPILMSGTIRDNIVYGLTEMPTKDEIRQVAKQCFCHNFITRFQSSYDTVIGPHGTLLSGG 612
           +  L + TI +N+ +G  +  T +E+  V ++      I +    +DT++G  G ++SGG
Sbjct: 518 DTPLFNDTIWENVKFGRID-ATDEEVMTVVEKAQLAPLIKKLPQGFDTIVGERGLMISGG 576

Query: 613 QKQRIAIARALIKKPRILILDEATSALDVESEGAINYTFGQLMKKKEMTIVSIAHRLSTI 672
           +KQR+AIAR L+K  +I+  DEATSALD  +E A+  T          T V IAHRL TI
Sbjct: 577 EKQRLAIARVLLKNAKIMFFDEATSALDTHTEQALLRTIRSNFTSGSRTSVYIAHRLRTI 636

Query: 673 RRSENVIVLGHDGSVVEMGKFKELWDDPTSELSQL 707
             ++ +IVL  +G V E GK  EL   P S   +L
Sbjct: 637 ADADKIIVL-DNGRVREEGKHLELLATPNSLYREL 670

>TDEL0F00340 Chr6 complement(53876..57649) [3774 bp, 1257 aa] {ON}
            Anc_1.527 YKL209C
          Length = 1257

 Score =  182 bits (462), Expect = 9e-47,   Method: Compositional matrix adjust.
 Identities = 151/524 (28%), Positives = 250/524 (47%), Gaps = 66/524 (12%)

Query: 208  NYGRIILLRVLSERLVARLRATVIKKTIHQDAEFF--DTHKVGDLISR----------LG 255
            N+ +  L    SE  + +LR  V+++   ++ ++F  + HK  ++ +           L 
Sbjct: 750  NFLQYFLFGYCSEYWILQLRNQVMQRISFEELDWFQRERHKASEVSALLLNDLRDLRALA 809

Query: 256  SDAYVVSRSMTQKVSDGF-KALICGS----VGIGMMXXXXXXXXXXXXVFTPPVILSASV 310
            SD  +   S     S G   ALI G     V I M                P +++ ++V
Sbjct: 810  SDFLIAVSSFAVVSSVGIIWALIIGWKLSLVCISMF---------------PLIVIFSAV 854

Query: 311  FGKQISTTSRELQEATGHLTKVAEEQLSGIKTVQSFVAEQREINRYN--------FAIRD 362
            +G  +     + + A   L  +  E  +GIKT++    E   + +Y          A R 
Sbjct: 855  YGMALQRQETQYKSAVVDLENLLYEVATGIKTIRRLQLETNFLRQYKRLESHMRVIASRR 914

Query: 363  IFNIGKKAAVINAKFFSSTSAMGDLSFLTVLGFGSYLVLQNSLTIGDLTAFMMYTEYTGN 422
                G   AVI A   S  + +   +   V+  G Y     +  + +    +++T  T N
Sbjct: 915  AITTGLGVAVIEALAMSIQAILFYYALKLVID-GQY----TTKKMFETLTLLLFTIMTCN 969

Query: 423  SIFGLSTFYSEIMQGAGAASRLFELTDRVPSISTTKGVKYKPGNGE-------IEFKNVS 475
                L +   +I +G  AA+R+ ++ D           K +  +G        I  +NV+
Sbjct: 970  I---LISQVPDISRGQRAANRILQMLDEKLEREKPHQEKKQTTSGSVSESSAVISLQNVT 1026

Query: 476  FAYPTRPSNMIFKNLNFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPSSGEILIDGQNI 535
            FAYP+ PS  IF +L  ++  G    +VG SG GKST+  LL + Y+P+SG +L++ +++
Sbjct: 1027 FAYPSAPSIHIFDSLYLELPIGRTFALVGQSGSGKSTLVTLLTQLYRPTSGTVLVENKDV 1086

Query: 536  NDLNSKSLRRHIGLVQQEPILMSGTIRDNIVYGLTEMPTKDEIRQVAKQCFCHNFITRFQ 595
            N+ N + LRR + +V+Q P + SGT+R+N++YGL   P + E+  V +    H+FI++  
Sbjct: 1087 NEWNIRDLRRQMSVVEQTPTIFSGTVRENLLYGLHHDPLEVEMYDVLRYVGIHDFISKLP 1146

Query: 596  SSYDTVIGPHGTLLSGGQKQRIAIARALIKKPRILILDEATSALDVESEGAINYTFGQLM 655
               DT I     LLSGGQ QR+ IARA++K+P+ILILDE TSALD  S   IN     ++
Sbjct: 1147 LGLDTTIDID--LLSGGQLQRLCIARAILKRPKILILDECTSALDPFSSHVIN----NIV 1200

Query: 656  KK---KEMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKEL 696
            ++     +TI SI H +  ++  + +I L  +G V   G F  L
Sbjct: 1201 RRGCPAPLTI-SITHNVDMMKACDEIIFL-KNGRVAGTGSFDAL 1242

 Score =  138 bits (348), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 117/412 (28%), Positives = 212/412 (51%), Gaps = 14/412 (3%)

Query: 302 PPVILSASVFGKQISTTSRELQEATGHLTKVAEEQLSGIKTVQSFVAEQREINRYNFAIR 361
           P +I+    F +++   +    E T   +++ +  ++  + ++    E REI  +   ++
Sbjct: 170 PLIIMCGWFFSRKVQRYADLENEQTSKASQLLDWSMTAAQFIRLSGTELREIKSFKNCVQ 229

Query: 362 DIFNIGKKAAVINAKFFSSTSAMGDLSFLTVLGFGSYLVLQNSLTIGDLTAFMMYTEYTG 421
           +  N   K    ++   ++   +    F+    FGS ++ +  + IGD+          G
Sbjct: 230 NCTNNFVKMCQYSSINLATLKFLSLAMFVQAFWFGSTMIRKGKMNIGDVITCFHSCILLG 289

Query: 422 NSIFGLSTFYSEIMQGAGAASRL--FELTDRVPS--ISTTKGVKYKPGNGEIEFKNVSFA 477
           ++I G       I +G+ A + +  F   D+  +  I   + V +    G+I F+NV F+
Sbjct: 290 STISGTLQQLVIIQKGSVAVNIVSKFLADDKTATTDIRRWQDVPFPELKGDIRFQNVEFS 349

Query: 478 YPTRPSNMIFKNLNFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPSSGEILIDGQNIND 537
           YP+RP + + ++++    AG    ++G SG GKS+++ LL K+Y+  +G I +DG+NI  
Sbjct: 350 YPSRPDHNVLRSISLNFRAGKTTFLLGKSGSGKSSLSNLLLKFYENYTGVISVDGRNIKH 409

Query: 538 LNSKSLRRHIGLVQQEPILMSGTIRDNIVYGLT-----EMPTKDEIRQVAKQCFCHNFIT 592
           ++   L ++I +V+Q   + +GT+++NI+ G+      E+ TK  ++ V +     NFI 
Sbjct: 410 IDQSQLIKNITVVEQRCNVFNGTLKENIIIGIDGADEEEILTK--LKLVCRISLLENFIH 467

Query: 593 RFQSSYDTVIGPHGTLLSGGQKQRIAIARALIKKPRILILDEATSALDVESEGAINYTFG 652
                 +T+IG  G  LSGGQ+Q++AIARAL+K P+ILILDE+ SALDV   G I     
Sbjct: 468 DLSDGLNTLIGSGGISLSGGQQQKVAIARALMKDPQILILDESLSALDVLQRGLILRAIR 527

Query: 653 QLMKKKEMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELWDDPTSEL 704
               +KE T + + H L+ I  S +   L   G  +E G  + L +DP++  
Sbjct: 528 --THRKEKTTIILTHELNQI-GSNDFCYLIESGQCIEHGLEETLVNDPSTRF 576

>AGL335W Chr7 (82640..84715) [2076 bp, 691 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YMR301C (ATM1)
          Length = 691

 Score =  179 bits (454), Expect = 9e-47,   Method: Compositional matrix adjust.
 Identities = 127/397 (31%), Positives = 200/397 (50%), Gaps = 27/397 (6%)

Query: 320 RELQEATGHLTKVAEEQLSGIKTVQSFVAEQREINRYNFAI---RDI-FNIGKKAAVIN- 374
           R+  +A      VA + L   + V+ F  E+   ++Y+ ++   RD    + +  A +N 
Sbjct: 284 RDANKADNKAASVALDSLINFEAVKYFNNEKYLADKYHTSLMKYRDSQIKVSQSLAFLNT 343

Query: 375 AKFFSSTSAMGDLSFLTVLGFGSYLVLQNSLTIGDLTAFMMYTEYTGNSIFGLSTFYSEI 434
            +    T+A+  + ++   G     V+Q SLT+GDL             +  L + Y ++
Sbjct: 344 GQNLIFTTALTAMMYMACNG-----VMQGSLTVGDLVLINQLVFQLSVPLNFLGSVYRDL 398

Query: 435 MQGAGAASRLFELTDRVPSISTTKGVKYKPGNG--EIEFKNVSFAYPTRPSNMIFKNLNF 492
            Q       LF+L     +I  +   +  P +   +I F+NV+F Y   P   I  N++F
Sbjct: 399 KQSLIDMESLFKLQKNQVTIKNSPNAQNLPIHKPLDIRFENVTFGYD--PERRILNNVSF 456

Query: 493 KIEAGSNVCIVGPSGRGKSTVALLLEKYYKPSSGEILIDGQNINDLNSKSLRRHIGLVQQ 552
            I AG    IVGPSG GKST+  L+ ++Y+P  G IL+ G +I DL+  SLR+ IG+V Q
Sbjct: 457 TIPAGMKTAIVGPSGSGKSTILKLVFRFYEPEQGRILVGGTDIRDLDLLSLRKAIGVVPQ 516

Query: 553 EPILMSGTIRDNIVYGLTEMPTKDEIRQVAKQCFCHNFITRFQSSYDTVIGPHGTLLSGG 612
           +  L + TI +N+ +G     + DEI +  ++      +        TV+G  G ++SGG
Sbjct: 517 DTPLFNDTIWENVKFGNIS-SSDDEILRAIEKAQLTKLLQNLPKGASTVVGERGLMISGG 575

Query: 613 QKQRIAIARALIKKPRILILDEATSALDVESEGAINYTFGQLMKKKEMTIVSIAHRLSTI 672
           +KQR+AIAR L+K   ++  DEATSALD  +E A+ +T  Q       T V +AHRL TI
Sbjct: 576 EKQRLAIARVLLKDAPLMFFDEATSALDTHTEQALLHTIQQNFSSNSKTSVYVAHRLRTI 635

Query: 673 RRSENVIVLGHDGSVVEMGK-----------FKELWD 698
             ++ +IVL   GSV E G            ++ LWD
Sbjct: 636 ADADKIIVL-EQGSVREEGTHSSLLASQGSLYRGLWD 671

>NCAS0D02430 Chr4 (462683..464791) [2109 bp, 702 aa] {ON} Anc_5.20
          Length = 702

 Score =  179 bits (455), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 130/400 (32%), Positives = 203/400 (50%), Gaps = 21/400 (5%)

Query: 320 RELQEATGHLTKVAEEQLSGIKTVQSFVAEQREINRYNFAI---RDI-FNIGKKAAVINA 375
           R+  +A      VA + L   + V+ F  E+   ++Y+ ++   RD    + +  A +N+
Sbjct: 284 RDANKADNKGASVALDSLINFEAVKYFNNEKYLADKYHTSLIKYRDSQIKVSQSLAYLNS 343

Query: 376 -KFFSSTSAMGDLSFLTVLGFGSYLVLQNSLTIGDLTAFMMYTEYTGNSIFGLSTFYSEI 434
            +    TSA+  + ++   G     V+   LT+GDL             +  L + Y E+
Sbjct: 344 GQNLIFTSALTAMMYMGCTG-----VIGGDLTVGDLVLINQLVFQLSVPLNFLGSVYREL 398

Query: 435 MQGAGAASRLFELTDRVPSISTTKG-----VKYKPGNGEIEFKNVSFAYPTRPSNMIFKN 489
            Q       LF+L  R   I    G     +K   G  EI F+NV+F Y ++    I  N
Sbjct: 399 KQSLIDMESLFQL--RKNEIKIENGTNPIVLKASDGPFEITFENVTFGYDSK--RKILNN 454

Query: 490 LNFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPSSGEILIDGQNINDLNSKSLRRHIGL 549
            +F I  G    +VGPSG GKST+  L+ ++Y P  G ILI+G ++ + +  SLRR +G+
Sbjct: 455 ASFTIPGGLKTAVVGPSGSGKSTILKLVFRFYDPEQGRILINGVDVKEYDVDSLRRVMGV 514

Query: 550 VQQEPILMSGTIRDNIVYGLTEMPTKDEIRQVAKQCFCHNFITRFQSSYDTVIGPHGTLL 609
           V Q+  L + TI +N+ +G  +  T +E+  V ++      I +    Y+T++G  G ++
Sbjct: 515 VPQDTPLFNDTIWENVKFGRID-ATDEEVHTVIEKAQLAPLIKKLPQGYETIVGERGMMI 573

Query: 610 SGGQKQRIAIARALIKKPRILILDEATSALDVESEGAINYTFGQLMKKKEMTIVSIAHRL 669
           SGG+KQR+AIAR L+K  +I+  DEATSALD  +E A+  T     +    T V IAHRL
Sbjct: 574 SGGEKQRLAIARVLLKNAKIMFFDEATSALDTHTEQALLTTIRANFESGSRTSVYIAHRL 633

Query: 670 STIRRSENVIVLGHDGSVVEMGKFKELWDDPTSELSQLLN 709
            TI  ++ +IVL  DG+V E G    L   P S  + L N
Sbjct: 634 RTIADADKIIVL-EDGAVKEEGTHSGLLATPGSLYANLWN 672

>Kpol_513.23 s513 complement(65118..67244) [2127 bp, 708 aa] {ON}
           complement(65118..67244) [2127 nt, 709 aa]
          Length = 708

 Score =  179 bits (455), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 129/393 (32%), Positives = 193/393 (49%), Gaps = 7/393 (1%)

Query: 320 RELQEATGHLTKVAEEQLSGIKTVQSFVAEQREINRYNFAIRDIFNIGKKAAVINAKFFS 379
           R    A      +A + L   + V+ F  EQ   N+Y  ++ D  N   K A   A   S
Sbjct: 298 RAANRADNKGASIALDSLINFEAVKYFNNEQYLANKYYSSLVDYRNSQVKVAQSLAFLNS 357

Query: 380 STSAMGDLSFLTVLGFGSYLVLQNSLTIGDLTAFMMYTEYTGNSIFGLSTFYSEIMQGAG 439
             + +   +   ++  G   V+  +LT+GDL             +  L + Y E+ Q   
Sbjct: 358 GQNLIFTSALTAIMYLGCTGVIGGNLTVGDLVLINQLVFQLSVPLNFLGSVYRELKQSLI 417

Query: 440 AASRLFELTDRVPSISTTKGVKYKPGN---GEIEFKNVSFAYPTRPSNMIFKNLNFKIEA 496
               LF+L      I         P      EI+F+NV+F Y       I KN +F I A
Sbjct: 418 DMESLFKLRKNEIKIQNVHRPLMLPNELTPFEIKFENVTFGYD--KERKILKNASFTIPA 475

Query: 497 GSNVCIVGPSGRGKSTVALLLEKYYKPSSGEILIDGQNINDLNSKSLRRHIGLVQQEPIL 556
           G    +VGPSG GKST+  L+ ++Y P  G IL++G +I +++  SLR+ IG+V Q+  L
Sbjct: 476 GWKTAVVGPSGSGKSTILKLVFRFYDPEEGRILLNGTDIKEIDLASLRKVIGVVPQDTPL 535

Query: 557 MSGTIRDNIVYGLTEMPTKDEIRQVAKQCFCHNFITRFQSSYDTVIGPHGTLLSGGQKQR 616
            + TI +N+ +G  E  T +EI Q  ++      I +     +T++G  G ++SGG+KQR
Sbjct: 536 FNDTIWENVKFGRIE-ATDNEILQAIEKAQLAPLIKKLPKGRETIVGERGLMISGGEKQR 594

Query: 617 IAIARALIKKPRILILDEATSALDVESEGAINYTFGQLMKKKEMTIVSIAHRLSTIRRSE 676
           +AIAR L+K   I+  DEATSALD  +E ++  T  +       T V IAHRL TI  ++
Sbjct: 595 LAIARVLLKNSGIMFFDEATSALDTHTEQSLLRTIKENFDGSSRTSVYIAHRLRTIADAD 654

Query: 677 NVIVLGHDGSVVEMGKFKELWDDPTSELSQLLN 709
            +IVL  DG V E G  ++L     S  S+L N
Sbjct: 655 KIIVL-KDGQVEEEGTHRQLIAKKESLYSELWN 686

>NDAI0I02440 Chr9 complement(556154..558346) [2193 bp, 730 aa] {ON}
           Anc_5.20 YMR301C
          Length = 730

 Score =  179 bits (454), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 134/401 (33%), Positives = 200/401 (49%), Gaps = 20/401 (4%)

Query: 320 RELQEATGHLTKVAEEQLSGIKTVQSFVAEQREINRYNFAI---RD-IFNIGKKAAVINA 375
           R+  +A      VA + L   + V+ F  E    N+Y+ ++   RD    + +  A +N+
Sbjct: 316 RDANKADNKGASVALDSLINFEAVKYFNNETYLSNKYHDSLLQYRDSTIKVAQSLAFLNS 375

Query: 376 -KFFSSTSAMGDLSFLTVLGFGSYLVLQNSLTIGDLTAFMMYTEYTGNSIFGLSTFYSEI 434
            +    TSA+  + +L   G     V++ +LT+GDL             +  L + Y E+
Sbjct: 376 GQNLIFTSALTMMMYLGCTG-----VIEGNLTVGDLVLINQLVFQLSVPLNFLGSVYREL 430

Query: 435 MQGAGAASRLFELTDRVPSISTTKG------VKYKPGNGEIEFKNVSFAYPTRPSNMIFK 488
            Q       LF+L      I   K       +K   G  EI+F+NV+F Y T  +  I K
Sbjct: 431 KQSLIDMESLFQLRKNPIKIQNAKTGPAPIMLKSSDGPFEIKFENVTFGYDT--NRKILK 488

Query: 489 NLNFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPSSGEILIDGQNINDLNSKSLRRHIG 548
           N +F I AG    +VGPSG GKST+  L+ ++Y P  G +LI+G N+   +  SLRR +G
Sbjct: 489 NASFIIPAGLKTAVVGPSGSGKSTILKLVFRFYDPEEGRVLINGINVQRYDIDSLRRVMG 548

Query: 549 LVQQEPILMSGTIRDNIVYGLTEMPTKDEIRQVAKQCFCHNFITRFQSSYDTVIGPHGTL 608
           +V Q+  L + TI +N+ +G       +EI+QV ++      I +      T++G  G +
Sbjct: 549 VVPQDTPLFNDTIWENVKFGRIN-ANDEEIKQVIEKAQLAPLIEKLPQREKTIVGERGLM 607

Query: 609 LSGGQKQRIAIARALIKKPRILILDEATSALDVESEGAINYTFGQLMKKKEMTIVSIAHR 668
           +SGG+KQR+AIAR L+K   I+  DEATSALD  +E A+  T          T + IAHR
Sbjct: 608 ISGGEKQRLAIARVLLKDANIMFFDEATSALDTHTEQALLNTIRANFPSGTRTSIYIAHR 667

Query: 669 LSTIRRSENVIVLGHDGSVVEMGKFKELWDDPTSELSQLLN 709
           L TI  ++ +IVL  DG V E G   EL     S  S L N
Sbjct: 668 LRTIADADKIIVL-EDGKVKEEGSHNELLATKGSLYSNLWN 707

>KAFR0E00230 Chr5 complement(47473..51285) [3813 bp, 1270 aa] {ON}
            Anc_1.527 YKL209C
          Length = 1270

 Score =  181 bits (459), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 159/513 (30%), Positives = 248/513 (48%), Gaps = 34/513 (6%)

Query: 215  LRVLSERLVARLRATVIKKTIHQDAEFF--DTHKVGDLISRLGSDAYVVSRSMTQKVSDG 272
            L  +SE  +  LR   ++   +++ E+F  D +K  +L + + +D   +   +++ +S  
Sbjct: 769  LGFVSENWIMDLRNKAMESITNKELEWFYKDENKSSELAALVLNDLRDLRSLISEFISAM 828

Query: 273  FKALICGSVGIGMMXXXXXXXXXXXXVFTPPVILSASVFGKQISTTSRELQEATGHLTKV 332
               ++    G+                  P +IL ++++G  +       +     L   
Sbjct: 829  STFIVVSLAGLIWALTTGWKLSLVCIAMFPLIILFSAIYGSILQRYETTYKTTVADLENC 888

Query: 333  AEEQLSGIKTVQSFVAEQREINRYNFAIRDIFNIGKKAAVINAKFFSSTSAMGDLSFLTV 392
              E + GIKT++    EQ  I RY+     + +IG+K A+      + T+A+       +
Sbjct: 889  VYEIMLGIKTIRCLQLEQHFIQRYSVLEARMKHIGRKRAIATGFGIAITTALVMCIEAIL 948

Query: 393  LGFGSYLVLQNSLTIGDLTAFMMYTEYTGNSIFGLSTFYSEIMQ------GAGAASRLFE 446
              +G  LV      IG+ T   M+  +T   +F + T  S I Q      G  AASR+F 
Sbjct: 949  FYYGLKLVF-----IGEYTTMKMFKTFTL-LLFTIMTCTSLINQIPDVTRGQRAASRIFR 1002

Query: 447  L---TDRVPSISTTKG-VKYKPGNGEIE----FKNVSFAYPTRPSNMIFKNLNFKIEAGS 498
            +   +DR    S   G  +  P N  I+      N+ F YP+  S+ +F  LN +I    
Sbjct: 1003 ILDESDRFLEDSDEHGRTRGIPKNNSIKSIITINNLQFHYPSAESSNVFNRLNLQIADNQ 1062

Query: 499  NVCIVGPSGRGKSTVALLLEKYYKPSSGEILIDGQNINDLNSKSLRRHIGLVQQEPILMS 558
             V +V  SG GKST+  LL + YK     I IDG +IN+    SLR  I +V+Q+P L  
Sbjct: 1063 TVAVVAESGSGKSTLLYLLTRLYKVDFNSIFIDGTDINEWQLTSLRNLIAIVEQKPTLFE 1122

Query: 559  GTIRDNIVYGLTEMPTKD-EIRQVAKQCFCHNFITRFQSSYDTVIGPHGTLLSGGQKQRI 617
            G+IR N++YG  ++   D +I  V KQ    +F+T   +  DT +    +LLSGGQ QRI
Sbjct: 1123 GSIRKNLIYG-NKLEIMDMDIYDVLKQVGIFDFVTSLPNGIDTNVDT--SLLSGGQAQRI 1179

Query: 618  AIARALIKKPRILILDEATSALDVESEGAINYTFGQLMKKKEMTIVSIA--HRLSTIRRS 675
             IARAL++K +ILILDE TSALD ES   I      L+K     +++IA  H    +R  
Sbjct: 1180 CIARALLRKSKILILDECTSALDAESAFVIQ----NLVKSGLPGVLTIAITHSEPMMRAC 1235

Query: 676  ENVIVLGHDGSVVEMGKFKELWDDPTSELSQLL 708
             NVIVL  DG   + G F EL+  P +EL +++
Sbjct: 1236 GNVIVL-QDGETAQQGTFDELY-KPGNELHRIV 1266

 Score =  128 bits (321), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 130/524 (24%), Positives = 244/524 (46%), Gaps = 58/524 (11%)

Query: 225 RLRATVIKKTIHQDAEFFDTHK--VGDLIS--------RLGSDAYVVSRSMTQKVSDGFK 274
           R+R T++   + +  E+FD +   +GD +         R GS     + ++T +      
Sbjct: 103 RIRRTILLSYLKKPMEWFDENDQLLGDFVQMHRCVEEVRSGSAE---ASAITFQNFVAII 159

Query: 275 ALICGSVGIGMMXXXXXXXXXXXXVFTPPVILSASVFGKQISTTSRELQEATGHLTKVAE 334
           AL+C S                    +P +I+ A+ F + I   ++   + TG   +   
Sbjct: 160 ALVCTSFYYSWSLTLIILCS------SPLLIVLAAFFSRMIENFTKLENDETGIAAQSLT 213

Query: 335 EQLSGIKTVQSFVAEQREINRYN-FAIR--DIFNIGKKAAVINAKFFSS--TSAMGDLS- 388
             ++  + V+ +  +  EI ++    IR  D F        INA F+ S  TS +  LS 
Sbjct: 214 WSMNAAQLVKLYCTQDFEIKKFKEIVIRCNDYF--------INAWFYVSANTSILRFLSL 265

Query: 389 --FLTVLGFGSYLVLQNSLTIGDLTAFMMYTEYTGNSIFGLSTFYSEIMQGAGAA-SRLF 445
             F+    FGS ++ +N +++  +          G SI   +     ++Q A    +R+ 
Sbjct: 266 AMFVQGFWFGSTMIKKNKMSVDQVITCFSSCLMLG-SILNTTLPQIVLLQKAHVGLNRVQ 324

Query: 446 ELTDRVPSISTTK----GVKYKPGNGEIEFKNVSFAYPTRPSNMIFKNLNFKIEAGSNVC 501
           +  +    ++T +     +        I F  +SF YP+RP +M+ KN++   +      
Sbjct: 325 DFLEDKSEMATDRDRQTSINLDNVPISISFDAISFCYPSRPDDMVLKNISMNFDPNKTTF 384

Query: 502 IVGPSGRGKSTVALLLEKYYKPSSGEILIDGQNINDLNSKSLRRHIGLVQQEPILMSGTI 561
           IVG SG GKST++ LL K+Y   +G I ++G N+  ++   + +++ LV+Q+  L + T+
Sbjct: 385 IVGKSGSGKSTMSNLLLKFYNGYNGCIKVNGVNVQSIDRHWITKNVTLVEQKCTLFNDTL 444

Query: 562 RDNIVYGLTEMPTKDEI----RQVAKQCFCHNFITRFQSSYDTVIGPHGTLLSGGQKQRI 617
           R+N++ GL+ +   +++    ++  +     N I +  S  DT +G  G  LSGGQ+QR+
Sbjct: 445 RNNLLIGLSHISAAEDVDSRLQEACRFALLDNVIEKLPSGLDTKVGSGGVSLSGGQQQRV 504

Query: 618 AIARALIKKPRILILDEATSALDVESEGAINYTFGQLMKK-----KEMTIVSIAHRLSTI 672
           A+ARA ++   ++ILDEA SALD  +         QLM+      +  T + + H L+ I
Sbjct: 505 ALARAYLRDTPVVILDEAISALDARNR-------RQLMENIRIWTRSKTAIILTHELNQI 557

Query: 673 RRSENVIVLGHDGSVVEMGKFKELWDDPTSELSQLLNEKSTPHQ 716
             S+  + L  +G + E G   EL ++  S   +  + +++  +
Sbjct: 558 LPSD-FLYLMENGQIKEEGYQNELIENVESTFCKFFHLQNSNRE 600

>Suva_11.11 Chr11 complement(26032..29904) [3873 bp, 1290 aa] {ON}
            YKL209C (REAL)
          Length = 1290

 Score =  180 bits (457), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 153/542 (28%), Positives = 259/542 (47%), Gaps = 51/542 (9%)

Query: 203  VGIAA-----NYGRIILLRVLSERLVARLRATVIKKTIHQDAEFF--DTHKVGDLISRLG 255
            +G+AA     N+ +  LL   SE  +  LR  ++ K   ++  +F  +++K  ++ + + 
Sbjct: 768  LGVAAADGFFNFAKGFLLGYCSEYWIMDLRNKIMDKLTRKNINWFSGESNKASEITALVL 827

Query: 256  SDAYVVSRSMTQKVSDGFKALI----CGSVGIGMMXXXXXXXXXXXXVFTPPVILSASVF 311
            +D     R +   VS+   A+       ++G+                  P +++ ++++
Sbjct: 828  NDL----RDLRSLVSEFLSAMTSFVTVSTIGLVWALVSGWKLSLVCISMFPLIVIFSAIY 883

Query: 312  GKQISTTSRELQEATGHLTKVAEEQLSGIKTVQSFVAEQREINRYNFAIRDIFNIGKKAA 371
            G  +     + + +   L     + ++ IKT++   AE      Y+   + +  I  K A
Sbjct: 884  GGILQKYETDYKTSVAQLENCLYQIMTSIKTIKCLQAEFHFQLSYHDLKKKMEQIAYKRA 943

Query: 372  VINAKFFSSTSAMGDLSFLTVLGFGSYLVLQNSLT---IGDLTAFMMYTEYTGNSIFGLS 428
            +      S T+ +       +  +G  LVL +  T   + +    +++T  +  S+ G  
Sbjct: 944  IATGFGISVTNMIAMCIQAILYYYGLKLVLVHEYTSKKMFETFTLLLFTIMSCTSLVGQ- 1002

Query: 429  TFYSEIMQGAGAASRLFELTD-------------RVPSISTTKGVKYKPGNGE--IEFKN 473
                +I +G  AAS ++ + D             R   IS   G +Y        I  +N
Sbjct: 1003 --IPDISRGQRAASWIYRILDEEEDTLEIENNDARALDIS---GAEYYGDRNIPIISIRN 1057

Query: 474  VSFAYPTRPSNMIFKNLNFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPSSGEILIDGQ 533
            +SFAYP+ P+  IFK+++  +     + IVG SG GKST+ALLL + Y   +  I+IDG 
Sbjct: 1058 LSFAYPSAPNVPIFKHMDLDMFCEQTIGIVGESGSGKSTLALLLTRLYNCEANSIIIDGT 1117

Query: 534  NINDLNSKSLRRHIGLVQQEPILMSGTIRDNIVYGLTEMPTKDEIRQVAKQCFCHNFITR 593
            ++ND N  SLR+ I +V+Q+P    G+IRDN+ YG      + EI  V K    ++F+  
Sbjct: 1118 DVNDWNLTSLRKQISVVEQKPSFFDGSIRDNLTYGCLGEMLEVEIYDVLKYVGIYDFVAS 1177

Query: 594  FQSSYDTVIGPHGTLLSGGQKQRIAIARALIKKPRILILDEATSALDVESEGAINYTFGQ 653
                 DT +  +  LLSGGQ QR+ IARAL++K +ILILDE TSALD  S   IN     
Sbjct: 1178 LPQGLDTRVDTN--LLSGGQAQRLCIARALLRKSKILILDECTSALDSVSSRIIN----D 1231

Query: 654  LMKKKE---MTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELWDDPTSELSQLLNE 710
            +++K     +T+V I H    +R   ++ VL H G VVE G F  L++    EL +++  
Sbjct: 1232 IVRKGPPGLLTLV-ITHSEQMMRCCNSIAVLKH-GKVVEEGNFDNLYNKE-GELFRIVCN 1288

Query: 711  KS 712
            KS
Sbjct: 1289 KS 1290

 Score =  139 bits (349), Expect = 8e-33,   Method: Compositional matrix adjust.
 Identities = 120/430 (27%), Positives = 203/430 (47%), Gaps = 37/430 (8%)

Query: 301 TPPVILSASVFGKQISTTSRELQEATGHLTKVAEEQLSGIKTVQSFVAEQREINRYN--- 357
           +P + + A +F + I T +++    T +  ++    ++  + V+ +  +  E  ++    
Sbjct: 185 SPVITIFAVIFSRLIHTYTQKENTETSNAAQLFTWSMNAAQLVRLYCTQPLERQKFQEII 244

Query: 358 -----FAIRDIFNIGKKAAVINAKFFSSTSAMGDLSFLTVLGFGSYLVLQNSLTIGDLTA 412
                F I+    +   A ++  +F + T       F+    FGS ++ +  L I D+  
Sbjct: 245 LSCNTFFIKSCLYVAANAGIL--RFLTLTM------FVQGFWFGSTMIRKGKLNINDVIT 296

Query: 413 FMMYTEYTGNSIFGLSTFYSEIM--QGAGAASRLFELTDR--VPSISTTKGVKYKPGN-- 466
                   G+++   ST +  ++  +G  A  ++  L +     + S T+     P N  
Sbjct: 297 CFHSCIMLGSTLN--STLHQIVVLQKGEVALQKIMALLESGSKQNASNTREHLQPPLNFA 354

Query: 467 -GEIEFKNVSFAYPTRPSNMIFKNLNFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPSS 525
             ++ F+NVSFAYP+RPS  + +N+N K  +G    IVG SG GKST++ LL  +Y    
Sbjct: 355 TSDLVFENVSFAYPSRPSETVLQNVNLKFPSGQFTFIVGKSGSGKSTISNLLLNFYDNYD 414

Query: 526 GEILIDGQNINDLNSKSLRRHIGLVQQEPILMSGTIRDNIVYGLT---------EMPTKD 576
           G ILI+G+N   +  K L  +I +V+Q   L + T++ NI+ G T          +   +
Sbjct: 415 GSILINGRNTQSIQQKLLVSNITVVEQRCTLFNDTLKKNILLGSTGSIGNADTNTIGNNN 474

Query: 577 EIRQVAKQCFCHNFITRFQSSYDTVIGPHGTLLSGGQKQRIAIARALIKKPRILILDEAT 636
            I+   +       I       +T+IG  G  LSGGQ+QR+AIARA I+   IL LDEA 
Sbjct: 475 LIKDACRMALLDRLILDLPDGLETLIGSGGVSLSGGQQQRVAIARAFIRDTPILFLDEAV 534

Query: 637 SALDVESEGAINYTFGQLMKKKEMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKEL 696
           SALD+     +        K K  T + + H LS I   +++ V+  +G VVE G   EL
Sbjct: 535 SALDIVHRNLLMKAIRHWRKGK--TTIILTHELSQIESDDHLYVM-QEGRVVESGIQSEL 591

Query: 697 WDDPTSELSQ 706
             D  +  S+
Sbjct: 592 LADSATTFSK 601

>Kpol_1018.185 s1018 (464370..468200) [3831 bp, 1276 aa] {ON}
            (464370..468200) [3831 nt, 1277 aa]
          Length = 1276

 Score =  180 bits (456), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 143/519 (27%), Positives = 253/519 (48%), Gaps = 25/519 (4%)

Query: 206  AANYGRIILLRVLSERLVARLRATVIKKTIHQDAEFF--DTHKVGDLISRLGSDAYVVSR 263
             +N+ +  +L   SE  +  LR   +++   +  E+F  + +K  ++ + L +D   +  
Sbjct: 763  VSNFLKTFILGYCSEYWIMDLRNRAMEEIAQKKLEWFSREENKSPEIAALLMNDLRDLRS 822

Query: 264  SMTQKVSDGFKALICGSVGIGMMXXXXXXXXXXXXVFTPPVILSASVFGKQISTTSRELQ 323
             ++Q +S     L    VG+                  P +++ + ++G  +       +
Sbjct: 823  LVSQFLSVISTFLTVSLVGLIWAIATGWKLSLVCISMFPLIVIFSIIYGTVLKNYETTYK 882

Query: 324  EATGHLTKVAEEQLSGIKTVQSFVAEQREINRYNFAIRDIFNIGKKAAVINAKFFSSTSA 383
                +L  +  E ++G+KT++    +      Y+    ++  I +K A++     + T+A
Sbjct: 883  TKVANLENLEYEIITGVKTIKCLQLQNHFKKCYHKLKDEMGQIARKRAIVTGLGIAITTA 942

Query: 384  MGDLSFLTVLGFGSYLVLQ---NSLTIGDLTAFMMYTEYTGNSIFGLSTFYSEIMQGAGA 440
            +       +  +G  LV+    ++ T+      +++T  T NS   L +   +I +G  A
Sbjct: 943  IATTIQSILYYYGLKLVMDGEYSTRTMFQTFTLLLFTVMTCNS---LISQIPDISRGQRA 999

Query: 441  AS---RLFELTDRVPSISTTKGVKYKPGNGE--------IEFKNVSFAYPTRPSNMIFKN 489
            AS   R+ E ++     + T G   +   GE        +   N+ FAYPT     I+ N
Sbjct: 1000 ASWIYRIIEESEDTKEQTITDGRFDEIHCGEKVDKTQPLVSIHNLEFAYPTALDVNIYDN 1059

Query: 490  LNFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPSSGEILIDGQNINDLNSKSLRRHIGL 549
            L+  +  G  V IVG SG GKST+  LL K Y+ +   I IDG ++N+ ++++LRR I +
Sbjct: 1060 LSLDLNVGQTVAIVGESGSGKSTLVYLLTKLYQVADNCIDIDGTDVNEWDNETLRRQISV 1119

Query: 550  VQQEPILMSGTIRDNIVYGLTEMPTKDEIRQVAKQCFCHNFITRFQSSYDTVIGPHGTLL 609
            V+Q+P+L  GT+R+N++YGL   P + +I  + K    ++FI       +T +    +L+
Sbjct: 1120 VEQKPVLFPGTVRENLIYGLYFSPLEIDIIDILKYVGVYDFIESLPEGLETSVDT--SLI 1177

Query: 610  SGGQKQRIAIARALIKKPRILILDEATSALDVESEGAINYTFGQLMKKKEMTIVSIAHRL 669
            SGGQ QR+ IARAL++KP+ILILDE TSALD  S   IN    +      +  +SI H  
Sbjct: 1178 SGGQAQRLCIARALLRKPKILILDECTSALDANSSKIINDIVAK--GPPSLLTISITHNE 1235

Query: 670  STIRRSENVIVLGHDGSVVEMGKFKELWDDPTSELSQLL 708
              +R    V VL  DG + E G F +L+  P +EL +++
Sbjct: 1236 QMMRSCNTVAVL-KDGKICETGPFNKLF-KPGNELYKVV 1272

 Score =  131 bits (329), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 106/417 (25%), Positives = 197/417 (47%), Gaps = 17/417 (4%)

Query: 301 TPPVILSASVFGKQISTTSRELQEATGHLTKVAEEQLSGIKTVQSFVAEQREINRYNFAI 360
           TP +I+ A +F + I   +      +G    +    ++  + ++    + +EI  +    
Sbjct: 184 TPLLIILAFIFSRSIQKYAALENTESGLAADLLAWSMNSAQMIKLSCTQLKEIESFEELT 243

Query: 361 RDIFNIGKKAAVINAKFFSSTSAMGDLSFLTVLGFGSYLVLQNSLTIGD-LTAF--MMYT 417
               +   K ++  A   S+   +    F+    FG+  + + +L I D +T F   +  
Sbjct: 244 LKCNDYFIKLSLYVAANISTLRFLSLAMFVQGFWFGNTEIRKGNLNISDVITCFSSCLML 303

Query: 418 EYTGNSIFGLSTFYSEIMQGAGAASRLFE--LTDRVPSISTTKGVKYKPGNGEIEFKNVS 475
             T N+  G   F    +Q    A R  +  L D    I  +   +      +I F++VS
Sbjct: 304 GSTLNTTLGYLIF----LQKGQVALRKIQSFLNDNKVEIDESALKQIDISKADISFRHVS 359

Query: 476 FAYPTRPSNMIFKNLNFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPSSGEILIDGQNI 535
           F+YP+RP++ +  +++    +G    IVG SG GKST++ LL K Y    G I I   +I
Sbjct: 360 FSYPSRPADDVLNDISIDFLSGKTTFIVGRSGSGKSTLSNLLLKLYDEYDGYISIGSTHI 419

Query: 536 NDLNSKSLRRHIGLVQQEPILMSGTIRDNIVYGLTEMP-----TKDEIRQVAKQCFCHNF 590
            +++ + L ++I +V+Q   L + T+ +NI+ G  +        + ++++  K     + 
Sbjct: 420 REIDQQVLIKNITVVEQRCTLFNDTLVNNILLGSQDEDKSSPVVQKKLKEAIKMACLESV 479

Query: 591 ITRFQSSYDTVIGPHGTLLSGGQKQRIAIARALIKKPRILILDEATSALDVESEGAINYT 650
           I    +  DT++G  G  LSGGQ+QR+A+ARA ++   +LILDEA SALD+     +   
Sbjct: 480 IDSLSNGLDTILGTGGISLSGGQQQRVALARAYMRDTEVLILDEAVSALDIVHREQLMSN 539

Query: 651 FGQLMKKKEMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELWDDPTSELSQL 707
             +  + +  T + + H LS I   + + V+  +G ++E G   +L  DP S   ++
Sbjct: 540 ITKWRQGR--TTIILTHELSQISIQDYLYVV-EEGRIIESGFQGQLMYDPDSAFCRM 593

>KNAG0G00190 Chr7 complement(20457..24284) [3828 bp, 1275 aa] {ON}
            Anc_1.527 YKL209C
          Length = 1275

 Score =  179 bits (455), Expect = 7e-46,   Method: Compositional matrix adjust.
 Identities = 136/521 (26%), Positives = 253/521 (48%), Gaps = 31/521 (5%)

Query: 207  ANYGRIILLRVLSERLVARLRATVIKKTIHQDAEFFD--THKVGDLISRLGSDAYVVSRS 264
              + +  ++   SE  +  LR  V++   +   E+F    +K  ++ +   +D   +   
Sbjct: 766  CTFSKTFIMGYCSEYWIMDLRKKVMRTITYNKFEWFQLAENKPSEVSALALNDLRDLRTL 825

Query: 265  MTQKVSDGFKALICGSVGIGMMXXXXXXXXXXXXVFTPPVILSASVFGKQISTTSRELQE 324
            +T+ ++     L+  + G+                  P +I+ + V+G  +     + + 
Sbjct: 826  VTEFLATASTFLVVSTCGLIWALVAGWKLSLVSISMFPLIIVFSGVYGAALQKCETDYKS 885

Query: 325  ATGHLTKVAEEQLSGIKTVQSFVAEQREINRYNFAIRDIFNIGKKAAVINAKFFSSTSAM 384
            A   L     E +  +KT++    +    NRY+   + + ++G++ +VI     + T  +
Sbjct: 886  AVAQLENCLYEVVVSMKTIRCLQLQTHFQNRYDRRKQRMLSLGRRRSVITGCGIAITHTL 945

Query: 385  GDLSFLTVLGFGSYLVLQNSLT---IGDLTAFMMYTEYTGNSIFG----------LSTFY 431
                   +  +G  LV+    T   + ++   +++T  T  ++             +T+ 
Sbjct: 946  TLCIQAILYYYGIKLVIDGKYTSKKMFEVFTLILFTIMTCTNLINQIPEVTRGQRAATYI 1005

Query: 432  SEIMQGAGAASRLFELTDRVPSISTTKGVKYKPGNGEIEFKNVSFAYPTRPSNMIFKNLN 491
              I++ A A     ++ +R   IS T        +  +  K+++FAYP  PS  ++++LN
Sbjct: 1006 YRILKEAAATREHQDMHNRTLPISNTS-----EKDTMVLVKDLTFAYPATPSKHVYEHLN 1060

Query: 492  FKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPSSGEILIDGQNINDLNSKSLRRHIGLVQ 551
              +++ ++V +VG SG GKST+  LL K Y      I +DG ++++ ++ SLR  I +V+
Sbjct: 1061 LNLKSDTSVALVGESGSGKSTIISLLTKLYDVPEKHIYVDGTDLSEWDTNSLRNQISVVE 1120

Query: 552  QEPILMSGTIRDNIVYGLTEMPTKD-EIRQVAKQCFCHNFITRFQSSYDTVIGPHGTLLS 610
            Q   L++GTIR+N+ YGL E  T + ++  + K    ++F++R  +  DT++     LLS
Sbjct: 1121 QSANLLNGTIRENLTYGLPEEDTTEVDLIGILKLVSIYDFVSRLPNGIDTIVDRD--LLS 1178

Query: 611  GGQKQRIAIARALIKKPRILILDEATSALDVESEGAINYTFGQLMKK--KEMTIVSIAHR 668
            GGQ QR+ IARAL+K  RILILDE TSALD  S   I      +++K      I++I H 
Sbjct: 1179 GGQAQRLCIARALVKPHRILILDECTSALDALSTNII----IDIVRKGIPNTLIIAITHD 1234

Query: 669  LSTIRRSENVIVLGHDGSVVEMGKFKELWDDPTSELSQLLN 709
               +R  E+V++L  +G++VE G F EL     SE  + LN
Sbjct: 1235 EHMMRSCESVLLL-KNGAIVEQGSFVELMQQD-SEFKKCLN 1273

 Score =  157 bits (398), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 117/425 (27%), Positives = 209/425 (49%), Gaps = 16/425 (3%)

Query: 301 TPPVILSASVFGKQISTTSRELQ-EATGHLTKVAEEQLSGIKTVQSFVAEQREINRYNFA 359
           + P+I + +++  +++    +L+ + T +  ++    +     V+ + A+  EI++++ +
Sbjct: 172 STPIITAIAIYFAKLTNKYTDLENKETSYAAELLTWSMRFNDMVKFYTAQNEEISKFDTS 231

Query: 360 IRDIFNIGKKAAVINAKFFSSTSAMGDLSFLTVLGFGSYLVLQNSLTIGDLTAFMMYTEY 419
           +    ++  KA + +A   S    +    F+    FG+ ++ +N L I D+         
Sbjct: 232 VTRCNSLFIKACLYSALNSSIIRFLTLCMFVQGFWFGATMIRRNKLDINDVITCFHSCLM 291

Query: 420 TGNSIFGLSTFYSEIMQGAGAASRLFELTDRVPSISTTKGVKYKP-GNG-EIEFKNVSFA 477
            G ++    +  + I +G  A  +L    +          +K  P GN   I F N+SF 
Sbjct: 292 LGATVSEAMSQVTVIQKGHVANKKLEGFLELEGKTIMQAALKCPPKGNSLSITFNNISFK 351

Query: 478 YPTRPSNMIFKNLNFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPSSGEILIDGQNIND 537
           YP R SN   +N++ ++E+G    I+G SG GKST+A LL ++Y+  SG I +D  +I D
Sbjct: 352 YPCRTSNSAVENVSLRLESGKMTFIIGKSGSGKSTLAKLLLRFYEEYSGSITVDNISICD 411

Query: 538 LNSKSLRRHIGLVQQEPILMSGTIRDNIVYGLTEM--PTKDEI-----RQVAKQC---FC 587
           LN + L  +I +V+Q   L + T+R+NI+ G      P + E      R++ K C     
Sbjct: 412 LNQEWLLSNITVVEQNCTLFNDTLRNNILLGSENQSEPARMESIEERERKLRKACNFALL 471

Query: 588 HNFITRFQSSYDTVIGPHGTLLSGGQKQRIAIARALIKKPRILILDEATSALDVESEGAI 647
           +  +       DTVIG  G  LSGGQ+QR+A+ARA ++   I+I DE+ SALDV     +
Sbjct: 472 NEMLADLTDGLDTVIGSGGVELSGGQRQRVALARAFLRNTPIMIFDESVSALDVAHRKLL 531

Query: 648 NYTFGQLMKKKEMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELWDDPTSELSQL 707
                   + K  T + + H LS I  ++ + ++ H G V E G  ++L    TS  S+ 
Sbjct: 532 MKAIRSWRQGK--TTIVLTHELSQINPTDFIYIMEH-GRVCEYGYQEDLLKSETSYFSRF 588

Query: 708 LNEKS 712
              ++
Sbjct: 589 YQHQA 593

>TBLA0C07000 Chr3 complement(1688965..1691142) [2178 bp, 725 aa]
           {ON} Anc_5.20 YMR301C
          Length = 725

 Score =  176 bits (447), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 129/395 (32%), Positives = 198/395 (50%), Gaps = 21/395 (5%)

Query: 320 RELQEATGHLTKVAEEQLSGIKTVQSFVAEQREINRYNFAIRDIFNIGKKAAVINAKFFS 379
           R+  +A      +A + L   + V+ F  E+    +Y+  +    +   K A  +  F +
Sbjct: 305 RQANKADNKGASIALDSLINFEAVKYFNNEEYLAQKYHKTLSQYRDSQIKVAQ-SLAFLN 363

Query: 380 STSAMGDLSFLTVLGF-GSYLVLQNSLTIGDLTAFMMYTEYTGNSIFGLSTFYSEIMQGA 438
           S   +   S LTV+ + G   ++  +LT+GDL             +  L + Y E+ Q  
Sbjct: 364 SGQNLIFTSALTVMMYMGCTGIIGGNLTVGDLVLINQLVFQLSVPLNFLGSVYRELKQSL 423

Query: 439 GAASRLFELTDRVPSISTTKGVKYKPGNGE----IEFKNVSFAYPTRPSNMIFKNLNFKI 494
                LF+L      I   +        G     I F+NV+F Y  +    I KN +F+I
Sbjct: 424 IDMEYLFQLKKNPIIIKNVEKPLMLAEKGHMPMTIRFENVTFGYDKQ--RKILKNASFQI 481

Query: 495 EAGSNVCIVGPSGRGKSTVALLLEKYYKPSSGEILIDGQNINDLNSKSLRRHIGLVQQEP 554
           E+G    IVGPSG GKST+  LL ++Y P  G IL++G +  + +  SLR+ IG+V Q+ 
Sbjct: 482 ESGQKTAIVGPSGSGKSTILKLLFRFYDPEEGRILVNGVDAREYDIDSLRKVIGVVPQDT 541

Query: 555 ILMSGTIRDNIVYGLTEMPTKDEIRQVAKQCFCHNFITRFQSSYDTVIGPHGTLLSGGQK 614
            L + TI +N+ +G     + DEI QV  +      + +     +T++G  G ++SGG+K
Sbjct: 542 PLFNDTIWENVRFGRIG-ASDDEITQVINKAQLGPLLVKLPQGRETIVGERGLMISGGEK 600

Query: 615 QRIAIARALIKKPRILILDEATSALDVESEGAINYTFGQLMKKKEMTIVSIAHRLSTIRR 674
           QR+AIAR L+K   I+  DEATSALD  +E A+  T  +  KK   T V IAHRL TI  
Sbjct: 601 QRLAIARVLLKDADIMFFDEATSALDTHTEQALLKTINENFKKGSRTSVYIAHRLRTIAD 660

Query: 675 SENVIVLGHDGSVVEMGK-----------FKELWD 698
           ++ +IVL  +G+V E GK           +KELW+
Sbjct: 661 ADKIIVL-QEGTVREEGKHSELLARSGSLYKELWN 694

>CAGL0M13739g Chr13 complement(1347781..1349964) [2184 bp, 727 aa]
           {ON} similar to uniprot|P40416 Saccharomyces cerevisiae
           YMR301c ATM1
          Length = 727

 Score =  176 bits (447), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 123/380 (32%), Positives = 193/380 (50%), Gaps = 7/380 (1%)

Query: 320 RELQEATGHLTKVAEEQLSGIKTVQSFVAEQREINRYNFAIRDIFNIGKKAAVINAKFFS 379
           +E  +A      VA + L   + V+ F  E    N+Y+ ++    +   K A   A   S
Sbjct: 313 KEANKADNKGASVALDSLINFEAVKYFNNESYLANKYHNSLIKYRDSQVKVAQSLAFLNS 372

Query: 380 STSAMGDLSFLTVLGFGSYLVLQNSLTIGDLTAFMMYTEYTGNSIFGLSTFYSEIMQGAG 439
             S +   +   ++  G   V+   LT+GDL             +  L + Y E+ Q   
Sbjct: 373 GQSLIFTTALTGMMYMGCTGVIGGDLTVGDLVLINQLVFQLSVPLNFLGSVYRELKQSLI 432

Query: 440 AASRLFELTD---RVPSISTTKGVKYKPGNGEIEFKNVSFAYPTRPSNMIFKNLNFKIEA 496
               LF+L     ++ + S  K +    G  EI+F+NV+F Y  +    I KN +F I A
Sbjct: 433 DMESLFKLRKNQVKIQNCSQPKSISKSDGPFEIKFENVTFGYDGQRK--ILKNASFTIPA 490

Query: 497 GSNVCIVGPSGRGKSTVALLLEKYYKPSSGEILIDGQNINDLNSKSLRRHIGLVQQEPIL 556
           G    I GPSG GKSTV  L+ ++Y P  G +L++G ++ + +   LR+ IG+V Q+  L
Sbjct: 491 GMKTAIAGPSGSGKSTVLKLVFRFYDPEEGRVLVNGVDVREYDIDQLRKAIGVVPQDTPL 550

Query: 557 MSGTIRDNIVYGLTEMPTKDEIRQVAKQCFCHNFITRFQSSYDTVIGPHGTLLSGGQKQR 616
            + TI +N+ +G  E  + +EI +V  +    + I +      T++G  G ++SGG+KQR
Sbjct: 551 FNDTIWENVKFGRIE-ASDEEITRVIDKAQLSDLIAKLPQGSSTIVGERGLMISGGEKQR 609

Query: 617 IAIARALIKKPRILILDEATSALDVESEGAINYTFGQLMKKKEMTIVSIAHRLSTIRRSE 676
           +AIAR L+K   I+  DEATSALD  +E ++  T  +     E T V IAHRL TI  ++
Sbjct: 610 LAIARVLLKDADIMFFDEATSALDTHTEQSLLRTIRRNFNSGEKTSVYIAHRLRTIADAD 669

Query: 677 NVIVLGHDGSVVEMGKFKEL 696
            +IVL  +G+V E G  +EL
Sbjct: 670 KIIVL-EEGTVREEGTHQEL 688

>ZYRO0D07106g Chr4 (616125..618254) [2130 bp, 709 aa] {ON} similar
           to uniprot|P40416 Saccharomyces cerevisiae YMR301C ATM1
           Mitochondrial inner membrane transporter exports
           mitochondrially synthesized precursors of iron- sulfur
           (Fe/S) clusters to the cytosol member of the ATP-
           binding cassette (ABC) transporter family
          Length = 709

 Score =  175 bits (444), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 127/397 (31%), Positives = 194/397 (48%), Gaps = 15/397 (3%)

Query: 320 RELQEATGHLTKVAEEQLSGIKTVQSFVAEQREINRYNFAIRDIFNIGKKAAVINAKFFS 379
           RE  +A      VA + L   + V++F  E+    +Y  ++       + + V  A+  +
Sbjct: 280 REANKADNKAASVALDSLINFEAVKNFNNEKYLAEKYETSLLKY----RDSQVRVAQSLA 335

Query: 380 STSAMGDLSFLTVLGFGSYL----VLQNSLTIGDLTAFMMYTEYTGNSIFGLSTFYSEIM 435
             ++  +L F T L    Y+    ++  SLT+GDL             +  L + Y E+ 
Sbjct: 336 FLNSGQNLIFTTALTAMMYMGCTGIIGGSLTVGDLVLINQLVFQLSVPLNFLGSVYRELK 395

Query: 436 QGAGAASRLFELTDRVPSISTTKGVKYKPGNG---EIEFKNVSFAYPTRPSNMIFKNLNF 492
           Q       LF L +    I      K  P N    +I F+NV+F Y   P   I +N +F
Sbjct: 396 QSLIDMESLFNLRNNPILIDNPSKPKMLPANAGPFDIVFENVTFGYD--PRRKILQNASF 453

Query: 493 KIEAGSNVCIVGPSGRGKSTVALLLEKYYKPSSGEILIDGQNINDLNSKSLRRHIGLVQQ 552
            I AG    +VGPSG GKST+  L+ ++Y P  G IL++G +I + +  SLRR IG+V Q
Sbjct: 454 VIPAGWKTAVVGPSGSGKSTLLKLVFRFYDPQEGRILVNGIDIREYDLDSLRRAIGVVPQ 513

Query: 553 EPILMSGTIRDNIVYGLTEMPTKDEIRQVAKQCFCHNFITRFQSSYDTVIGPHGTLLSGG 612
           +  L + TI +N+ +G  +   ++  R + K       + R     +T++G  G ++SGG
Sbjct: 514 DTPLFNDTIWENVKFGRIDADDQEVTRSIEKAHLAP-LVYRLPGGLNTIVGERGLMISGG 572

Query: 613 QKQRIAIARALIKKPRILILDEATSALDVESEGAINYTFGQLMKKKEMTIVSIAHRLSTI 672
           +KQR+AIAR L+K   I+  DEATSALD  +E A+  T      +   T V IAHRL TI
Sbjct: 573 EKQRLAIARVLLKNSSIMFFDEATSALDTHTEQALLRTIRANFDRGSKTSVYIAHRLRTI 632

Query: 673 RRSENVIVLGHDGSVVEMGKFKELWDDPTSELSQLLN 709
             ++ +IVL  +G   E G   EL     S   +L N
Sbjct: 633 ADADKIIVL-EEGRPREEGTHHELLQKEDSLYRELWN 668

>SAKL0A10208g Chr1 (894334..898266) [3933 bp, 1310 aa] {ON} similar to
            uniprot|P12866 Saccharomyces cerevisiae YKL209C STE6
            ATP-binding cassette (ABC) transporter required for the
            export of a-factor catalyzes ATP hydrolysis coupled to
            a-factor transport contains 12 transmembrane domains and
            two ATP binding domains expressed only in MATa cells
          Length = 1310

 Score =  174 bits (440), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 144/496 (29%), Positives = 238/496 (47%), Gaps = 23/496 (4%)

Query: 214  LLRVLSERLVARLRATVIKKTIHQDAEFF--DTHKVGDLISRLGSDAYVVSRSMTQKVSD 271
             L   SE  +  LR   I+K   QD  +F  D +K  ++ + + +D   +   +++ +S 
Sbjct: 813  FLGYCSEYWIRDLRMLAIRKITAQDLHWFSLDMNKSSEISALVLNDLRDLRSLVSEFLSS 872

Query: 272  GFKALICGSVGIGMMXXXXXXXXXXXXVFTPPVILSASVFGKQISTTSRELQEATGHLTK 331
                +I  SVGI                  P  IL +  +G  +     + +     L  
Sbjct: 873  ISTLIIVSSVGIVWAFISGWKLSLVCISLFPIFILFSCFYGGLLQRYETDYKTKVAELEN 932

Query: 332  VAEEQLSGIKTVQSFVAEQREINRYNFAIRDIFNIGKKAAVINAKFFSSTSAMGDLSFLT 391
               E   GI T++    E + + +Y    + +    KK A I   F  + S    L+   
Sbjct: 933  QLHEIFRGITTIRYLKLEYQFLEKYYNLEKKMRRASKKRA-ITIGFGVAASNTLTLAVQA 991

Query: 392  VLGF-GSYLVLQNSLT---IGDLTAFMMYTEYTGNSIFGLSTFYSEIMQGAGAASRLFEL 447
            +L + G  LV   S +   + +    +++T  T  S+ G      +I +G  AA+ +F +
Sbjct: 992  ILFYYGIKLVTTGSYSTEKMFETFTLLLFTVMTCVSLIGQ---IPDISRGQRAATYIFRI 1048

Query: 448  TD-RVPSISTTKG--VKYKPGNGE-IEFKNVSFAYPTRPSNMIFKNLNFKIEAGSNVCIV 503
             D + P+    K     YK  +   I  KN+SF+YP+ PS  I+K L   + +G  + +V
Sbjct: 1049 IDNQSPAAKDEKKKIASYKFTHDPLISVKNLSFSYPSAPSTAIYKGLKLDVFSGETIAVV 1108

Query: 504  GPSGRGKSTVALLLEKYYKPSSGEILIDGQNINDLNSKSLRRHIGLVQQEPILMSGTIRD 563
            G SG GKST+ LL+   Y+  +G I IDG +IN  ++  LR  I +V+Q+P    GT+ +
Sbjct: 1109 GESGSGKSTLTLLISALYEVPNGSIEIDGIDINRWDTNKLRTIISVVEQKPQFFDGTVGE 1168

Query: 564  NIVYGLTEMPTKDEIRQVAKQCFCHNFITRFQSSYDTVIGPHGTLLSGGQKQRIAIARAL 623
            N++YG++   T+ ++++        +F+       DT I    +L+SGGQ QR++IARA+
Sbjct: 1169 NLLYGISGRVTQIQVKEALCLAGVQDFVFSLPEGLDTRIDT--SLISGGQAQRLSIARAM 1226

Query: 624  IKKPRILILDEATSALDVESEGAINYTFGQLMKKK--EMTIVSIAHRLSTIRRSENVIVL 681
            ++KP+IL LDE TSALD  +  AI      L+KK    +T + I H    +R  E + VL
Sbjct: 1227 LRKPKILFLDECTSALDTSNTHAI----ANLIKKHFCGITTIVITHNEQMMRACERIAVL 1282

Query: 682  GHDGSVVEMGKFKELW 697
              +G V E G F +L+
Sbjct: 1283 -QNGKVAEDGSFDDLY 1297

 Score =  136 bits (343), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 113/421 (26%), Positives = 193/421 (45%), Gaps = 19/421 (4%)

Query: 302 PPVILSASVFGKQISTTSRELQEATGHLTKVAEEQLSGIKTVQSFVAEQREINRYNFAIR 361
           P +I+ + +  K I   +R     +    ++        + ++ F  +Q EI ++  +++
Sbjct: 189 PIIIVFSVILSKLIERFTRLENMESSRAAQMVSWSFDAAEMIRLFCTQQFEIEKFELSVK 248

Query: 362 DIFNIGKKAAVINAKFFSSTSAMGDLSFLTVLGFGSYLVLQNSLTIGDLTAFMMYTEYTG 421
                  + ++ ++  ++         F+    FG+ ++ Q  LT GD+          G
Sbjct: 249 KCTKYFIRISLFSSASYAMLRFFTLCMFIQGFWFGNKMIRQGVLTTGDVITCFSSCLLLG 308

Query: 422 NSIFGLSTFYSEIMQGAGAASRLFELT---DRVPS-----------ISTTKGVKYKPGNG 467
           N++         + +G  A  ++   T   +  P            ++     K++ G G
Sbjct: 309 NTLNNTLQQVITMQKGKVALGKILMFTSEENDFPDHRNEIISDAFILNHINANKFRCG-G 367

Query: 468 EIEFKNVSFAYPTRPSNMIFKNLNFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPSSGE 527
           EI FKNVSF+YPTRP+  + KN++          IVG SG GKST+  LL K Y   +G 
Sbjct: 368 EISFKNVSFSYPTRPNYHVLKNVSLNFPKNKTTFIVGKSGSGKSTIGKLLLKSYGGYTGA 427

Query: 528 ILIDGQNINDLNSKSLRRHIGLVQQEPILMSGTIRDNIVYGLTEMPTKDE-IRQVAKQCF 586
           I +DG +I  + +  L  +I LV+Q   L + TI++NI+ G       D  +R+  +   
Sbjct: 428 IEVDGIDIQHIKTSWLAENITLVEQSCTLFNDTIKNNILLGCKGKAYGDSLVREACQMAL 487

Query: 587 CHNFITRFQSSYDTVIGPHGTLLSGGQKQRIAIARALIKKPRILILDEATSALDVESEGA 646
               I    +  DTV+G  G  LSGGQKQR+A+ARA ++   ILILDEA S +D+     
Sbjct: 488 LDRLIFDLPNGLDTVLGSGGVSLSGGQKQRVALARARVRDSPILILDEAISGMDIIHRDL 547

Query: 647 INYTFGQLMKKKEMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELWDDPTSELSQ 706
           +     +   +K MT V + H L+ I   E+ +    +G + E G    L  +  S  ++
Sbjct: 548 LVEAIKKW--RKGMTTVIVTHELTQI-SDEDYLYFMEEGQIRESGFKCNLEKNENSHFNR 604

Query: 707 L 707
           L
Sbjct: 605 L 605

>TBLA0B10070 Chr2 (2422767..2426657) [3891 bp, 1296 aa] {ON}
           Anc_1.527 YKL209C
          Length = 1296

 Score =  172 bits (436), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 111/331 (33%), Positives = 173/331 (52%), Gaps = 12/331 (3%)

Query: 387 LSFLTVLGFGSYLVLQNSLTIGDLTAFMMYTEYTGNSIFGLSTFYSEIMQGAGAASRLFE 446
           L F+    FGS ++ +  L I ++          G+ I         + +G  A  ++ +
Sbjct: 276 LMFVQGFWFGSTMIRKGHLKIDEVITCFSSCLLLGSIISNTLHQIVVLQKGEVALQKIVD 335

Query: 447 LTDRVPSISTTKGVKYKPGNGEIEFKNVSFAYPTRPSNMIFKNLNFKIEAGSNVCIVGPS 506
             D                N  I F+N+SFAYP+RP+  I   +N   +  +   IVG S
Sbjct: 336 FLDEADDPLEINSAPITLINSNISFQNISFAYPSRPNENILNQINLYFQNSATTFIVGKS 395

Query: 507 GRGKSTVALLLEKYYKPSSGEILIDGQNINDLNSKSLRRHIGLVQQEPILMSGTIRDNIV 566
           G GKST++ LL K+Y+   G+ILID  NI +LN K+L  +I +V+Q+  L + TIR+NI+
Sbjct: 396 GSGKSTLSNLLLKFYETYKGDILIDNINIKNLNQKNLLDNIMIVEQKCTLFNDTIRNNIL 455

Query: 567 YGLTEM--------PTKDE-IRQVAKQCFCHNFITRFQSSYDTVIGPHGTLLSGGQKQRI 617
           +G++          P  +E ++         +F+    +  DTVIG  G  LSGGQ+QR+
Sbjct: 456 FGVSNFTNQYASNRPNLNERLKNACTFALLDHFLIDLPNGIDTVIGTGGITLSGGQQQRV 515

Query: 618 AIARALIKKPRILILDEATSALDVESEGAINYTFGQLMKKKEMTIVSIAHRLSTIRRSEN 677
           A+ARA ++ P ILILDEA SALDV     +     +L +  + TI+ + H L+ I   + 
Sbjct: 516 ALARAYMRDPPILILDEAVSALDVNIRELLMKAI-KLWRSNKTTII-LTHDLTQIDNDDF 573

Query: 678 VIVLGHDGSVVEMGKFKELWDDPTSELSQLL 708
           + V+ H G ++E GK KEL  DP +E  +L+
Sbjct: 574 LYVIKH-GRIIEHGKRKELITDPNTEFHKLV 603

 Score =  170 bits (431), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 138/515 (26%), Positives = 250/515 (48%), Gaps = 18/515 (3%)

Query: 207  ANYGRIILLRVLSERLVARLRATVIKKTIHQDAEFF--DTHKVGDLISRLGSDAYVVSRS 264
            +N+ +  LL + SE  +  LR   +K+ + +  ++F  + ++  ++ + + +D   + RS
Sbjct: 785  SNFFKGFLLGICSEYWIMDLRDKFMKEILRKKIQWFSDEKYQTAEMSALILNDLRDL-RS 843

Query: 265  MTQKVSDGFKALICGSV-GIGMMXXXXXXXXXXXXVFTPPVILSASVFGKQISTTSRELQ 323
            +  +        I  S+ G+                  P +I+ ++++G  +  +  + +
Sbjct: 844  LVSEFMSAMATFIVVSLFGLIWALVTGWKLALVCIAMFPLIIIFSAIYGAVLQKSETDYK 903

Query: 324  EATGHLTKVAEEQLSGIKTVQSFVAEQREINRYNFAIRDIFNIGKKAAVINAKFFSSTSA 383
             +  +L  +  + +S IKT++S   E    + Y  A   + N+  K ++      S T+ 
Sbjct: 904  SSVANLENIEFDIVSNIKTIKSLQLEGHFYHNYKVAETKLKNVATKRSIYTGLGISITNT 963

Query: 384  MGDLSFLTVLGFGSYLVLQNSLTIGDLTAFMMYTEYTGNSIFGLSTFYSEIMQGAGAASR 443
            +       +  +G  L++    T+  +        +T  +   L     ++ +G  AAS 
Sbjct: 964  ITMCIQAILYYYGFKLIMDGEYTVKQMFTTFTLLLFTVMTCNSLVNQIPDMSRGQRAASW 1023

Query: 444  LFEL---TDRVPSISTTKGVKYKPGNGEIEF-----KNVSFAYPTRPSNMIFKNLNFKIE 495
            ++ +   +D    ++    +         +F     KN++FAY + PS  +   L  K+ 
Sbjct: 1024 VYSILQQSDDTKEVNDPNSIIVDNNTISNDFPILDIKNLTFAYESTPSIKVLDGLTLKLF 1083

Query: 496  AGSNVCIVGPSGRGKSTVALLLEKYYKPSSGEILIDGQNINDLNSKSLRRHIGLVQQEPI 555
             G  + I G SG GK+T+  LL K+Y     +I  +G++I +   +SLR  I +V+Q+P 
Sbjct: 1084 PGDKLAIAGESGCGKTTLLSLLVKFYDVDPNQIYFNGKDILNYEFESLRDAIVIVEQKPS 1143

Query: 556  LMSGTIRDNIVYGLTEMPTKDEIRQVAKQCFCHNFITRFQSSYDTVIGPHGTLLSGGQKQ 615
            ++SG+IRDN++     + +  E+  V K     +FI    S  DT+I    TLLSGGQ Q
Sbjct: 1144 VLSGSIRDNLLGNNKRLISDYELYDVLKLTGIFDFIETLPSGIDTIIDT--TLLSGGQAQ 1201

Query: 616  RIAIARALIKKPRILILDEATSALDVESEGAINYTFGQLMKKKEMTIVSIAHRLSTIRRS 675
            RI IARAL++KP+ILILDE TSALD  S   IN    + +    +TI+SI H  S +   
Sbjct: 1202 RICIARALLRKPKILILDECTSALDAMSADIINNLVSKELNG--VTIISITHSESMMTSC 1259

Query: 676  ENVIVLGHDGSVVEMGKFKELWDDPTSELSQLLNE 710
            +NV VL  +G +VE+G +  L    +S L +LL++
Sbjct: 1260 QNVAVL-KNGKIVEVGTYDSL-ATSSSHLGKLLSK 1292

>CAGL0K00363g Chr11 complement(38281..41964) [3684 bp, 1227 aa] {ON}
            similar to uniprot|P12866 Saccharomyces cerevisiae
            YKL209c STE6
          Length = 1227

 Score =  169 bits (429), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 128/416 (30%), Positives = 210/416 (50%), Gaps = 15/416 (3%)

Query: 302  PPVILSASVFGKQISTTSRELQEATGHLTKVAEEQLSGIKTVQSFVAEQREINRYNFAIR 361
            P V++   ++G  +  T    + +  +L  +  E + G+KT+QS   +Q    ++N  I+
Sbjct: 818  PLVVVLTGLYGTILIKTENRYKTSVANLESIVYEAIIGMKTIQSLCLQQYITKKFNCKIK 877

Query: 362  DIFNIGKKAAVINAKFFSSTSAMGDLSFLTVLGFGSYLVLQNSLTIGDLTAFMMYTEYTG 421
             +   G   AV      + T+ +  L    +  +G  LVL    T   L   +    +T 
Sbjct: 878  LLEKNGTYRAVATGLGIALTNMLVLLFQSILFYYGFKLVLTGEYTHSKLFETIALLLFTI 937

Query: 422  NSIFGLSTFYSEIMQGAGAASRLFEL-------TDRVPS-ISTTKGVKYKPGNGEIEFKN 473
             ++  L T   +I +G  + S + ++       T   PS +STTKG+ + P    IE  N
Sbjct: 938  VTVASLVTQLPDITRGQRSISWIDQILKGDNQQTIEPPSNLSTTKGI-WNPNQPVIEVSN 996

Query: 474  VSFAYPTRPSNMIFKNLNFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPSSGEILIDGQ 533
            +SF Y    +     N+N ++ +     IVG SG GKST+  L+   Y  S G I I   
Sbjct: 997  LSFTYAQVHNKKTLTNINMQLYSNQIYGIVGKSGSGKSTLINLICGLYSLSEGSINICSC 1056

Query: 534  NINDLNSKSLRRHIGLVQQEPILMSGTIRDNIVYGLTEMPTKDEIRQVAKQCFCHNFITR 593
            +IN  ++K L + + L+QQ P+L   TIR+N++YGLTE    + +  V +     +FI  
Sbjct: 1057 DINKWSTKELHKTVALLQQNPVLQFDTIRNNLLYGLTETVGDEHLLNVLEYVGLKSFIIS 1116

Query: 594  FQSSYDTVIGPHGTLLSGGQKQRIAIARALIKKPRILILDEATSALDVESEGAINYTFGQ 653
              +  D+ +    +LLSGGQ QR+ +AR +++ P++LILDE TSALDV S   IN   G 
Sbjct: 1117 LNNGLDSKLDD--SLLSGGQSQRLCMAREMLRNPKVLILDECTSALDVTSAKKINDIIGS 1174

Query: 654  LMKKKEMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELWDDPTSELSQLLN 709
                  +TI+ ++H+  TI+  + +  L  DG+V  MG ++EL ++   E  +LLN
Sbjct: 1175 -RSLAPVTII-VSHQKETIKLCDKIFFLV-DGTVAMMGTYEELMEN-NWEFRKLLN 1226

 Score =  154 bits (389), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 129/419 (30%), Positives = 193/419 (46%), Gaps = 26/419 (6%)

Query: 301 TPPVILSASVFGKQI-STTSRELQEATGHLTKVAEEQLSGIKTVQSFVAEQREINRYNFA 359
           TP +I+ A +F K I   T +E  E+     ++A   L  I+ V+    +  EI+ Y   
Sbjct: 183 TPFIIICAVIFSKYIHKYTEKENTESECAAERLAW-MLKNIEFVRLHNGDDFEISMYTHY 241

Query: 360 IRDIFNIGKKAAVINAKFFSSTSAMGDLSFLTVLGFGSYLVLQNSLTIGDLTAFMMYTEY 419
           I        KA++  +   S    +  L F+    FGS ++ Q  L I  +         
Sbjct: 242 IAQANEYYIKASLFISANISILRLLSLLMFVQGFWFGSSMIKQGKLNIDSVITSFHCCLM 301

Query: 420 TG---NSIFGLSTFYSEIMQGAGAASRLFELTDRVPS-----ISTTKGVKYKPGNGEIEF 471
            G   NS  G +     + +G  A  RL ++ DR P      I    G+   P    I F
Sbjct: 302 LGSIINSALGQAVV---LQKGDVAMKRLLKMIDRTPRESLAFIDAISGIDLLP----IVF 354

Query: 472 KNVSFAYPTRPSNMIFKNLNFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPSSGEILID 531
            NVSF YP R ++ +F  +NF I+      ++GPSG GKST+  L+  +Y    G I++ 
Sbjct: 355 NNVSFCYPERKTDKVFDKMNFIIKPNKMTYVIGPSGSGKSTLFDLILLHYDNYHGSIMLG 414

Query: 532 GQNINDLNSKSLRRHIGLVQQEPILMSGTIRDNIVY--GLTEMPTKDEIRQVAKQCFCHN 589
             +I  +N   +  +I LV Q P L + TIR+NI+     T +P+K E+  + K     N
Sbjct: 415 DLDIRSINRNIILENITLVSQTPTLFNDTIRNNILACSNWTNLPSKLEMECICKFALLEN 474

Query: 590 FITRFQSSYDTVIGPHGTLLSGGQKQRIAIARALIKKPRILILDEATSALDVESEGAINY 649
            I       DT IG  G  LSGGQ Q++A+ARA  +   IL+LDE  SA+D+     +  
Sbjct: 475 LIAELPDGLDTRIGSGGIKLSGGQAQKVALARAFARNTSILLLDEPLSAVDMRQRIVLME 534

Query: 650 TFGQLMKKKEMTIVSIAHRLSTIRRSENVIVLGHD---GSVVEMGKFKEL-WDDP-TSE 703
              +    K  T V I H L  IR ++N++ +       S +   K +E  WDD  TSE
Sbjct: 535 NIKRWRNGK--TTVIITHDLEFIRNTDNILNISERKILSSALNTEKTQEFKWDDHLTSE 591

>TPHA0O00160 Chr15 complement(16002..19763) [3762 bp, 1253 aa] {ON}
            Anc_1.527 YKL209C
          Length = 1253

 Score =  168 bits (425), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 121/410 (29%), Positives = 201/410 (49%), Gaps = 21/410 (5%)

Query: 302  PPVILSASVFGKQISTTSRELQEATGHLTKVAEEQLSGIKTVQSFVAEQREINRYNFAIR 361
            P +I+ + ++G  +       + A   L  +  E ++ IKT++        +  Y+   +
Sbjct: 835  PLIIIFSMIYGTVLQNYETSYKSAVADLENLQYEMITSIKTIKCLRLNDHFLGLYSELEK 894

Query: 362  DIFNIGKKAAVINAKFFSSTSAMGDLSFLTVLGFGSYLVLQ---NSLTIGDLTAFMMYTE 418
             +  I KK  ++     S  + +       +  +G  LVL     S T+      +++T 
Sbjct: 895  KMKRIAKKRTIVTGLGLSMLTTITTCIQSILYYYGLKLVLTGEYTSKTMFQTFTLVLFTV 954

Query: 419  YTGNSIFGLSTFYSEIMQGAGAASRLFELTDRVPSISTTKGVKYKPGNGE--------IE 470
             T NS   L +   ++ +G  AAS +  + D         G   +    E        IE
Sbjct: 955  TTCNS---LVSQIPDVSRGQRAASWVLRIIDENEYTKEVNGEDCRVETIEHENDSDPLIE 1011

Query: 471  FKNVSFAYPTRPSNMIFKNLNFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPSSGEILI 530
             +N++F YP  P   ++++LN KI +G  + +VG SG GKST+  LL K Y      ILI
Sbjct: 1012 IENLNFHYPNTPGVNVYQDLNLKINSGETIGLVGQSGSGKSTLMYLLTKLYDVQDNRILI 1071

Query: 531  DGQNINDLNSKSLRRHIGLVQQEPILMSGTIRDNIVYGLTEMP--TKDEIRQVAKQCFCH 588
            +G +IND +   LR  I +V+Q+P L  GTIR+NI YG++E    ++ E++++ +    H
Sbjct: 1072 NGTDINDWSYDILRAEICVVEQKPNLFHGTIRENITYGVSEKNPVSETEVQELLQLVDMH 1131

Query: 589  NFITRFQSSYDTVIGPHGTLLSGGQKQRIAIARALIKKPRILILDEATSALDVESEGAIN 648
             F+     + DTV+     LLSGGQ QR+ I R L++KP++LILDE TS+LD ++   + 
Sbjct: 1132 EFVEALPKALDTVVDIG--LLSGGQAQRLCIVRTLLRKPKVLILDECTSSLDAQTTQIVI 1189

Query: 649  YTFGQLMKKKEMTIVSIA--HRLSTIRRSENVIVLGHDGSVVEMGKFKEL 696
                 L  K    I++I   H    ++    ++VL   G VVE G+F +L
Sbjct: 1190 ALIKDLNTKLGWDILTIVITHNRQMMQCCSRLVVLDV-GRVVEDGQFDDL 1238

 Score =  144 bits (362), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 134/534 (25%), Positives = 241/534 (45%), Gaps = 53/534 (9%)

Query: 204 GIAANYGRIILLRVLSERLVARLRATVIKKTIHQDAEFFDTHKVGDLISRLGSDAYVVSR 263
           GI + +  I     L ER   R+R+ ++++ + +  E++D      L   L  D   ++R
Sbjct: 79  GIPSMWMSISSWMALGERQGFRVRSKLLEEYLEKPMEWYD------LKENLAGDFTQLNR 132

Query: 264 SM-------------TQKVSDGFKALICGSVGIGMMXXXXXXXXXXXXVFTPPVILSASV 310
            M             T +      ALIC S                    +P +I+ A+ 
Sbjct: 133 CMEELRSGSAEASAVTYQNCVAIIALICVSFYYSWQLTLIILCT------SPFIIVCAAC 186

Query: 311 FGKQISTTSRELQEATGHLTKVAEEQLSGIKTVQSFVAEQREINRYNFAIRDIFNIGKKA 370
           F + I   +    + T     +    +   +TV+    + +EI ++   +    +   + 
Sbjct: 187 FSRFIQKYASFENKETAAAADLLMWTMDSSQTVKLSCTQSKEIKKFETLVSKCNDYFIRT 246

Query: 371 AVINAKFFSSTSAMGDLSFLTV------LGFGSYLVLQNSLTIGD-LTAFMMYTEYTGNS 423
           ++  A      + +G L FLT+        FGS ++ +  L I D +T F  Y+     S
Sbjct: 247 SLFTA------ANIGILRFLTLSMFVQGFWFGSTMIRKGKLNISDVITCF--YSCLMLGS 298

Query: 424 IFGLSTFYSEIMQ-GAGAASRLFELTDRVPSIS----TTKGVKYKPGNGEIEFKNVSFAY 478
           I   +  +   +Q G  A +++ +  +  P +     T+ G+ Y   + +I   N++FAY
Sbjct: 299 ILNTTLHHVIFIQKGQVALAKIQKFINESPELPSKTLTSSGLVY--SHVDISIDNLTFAY 356

Query: 479 PTRPSNMIFKNLNFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPSSGEILIDGQNINDL 538
           P+RP+  + KN++ KI++     IVG SG GKST+  L+ K+Y+   G I++  ++I  +
Sbjct: 357 PSRPTENVLKNVSLKIKSARTTFIVGKSGSGKSTITNLIMKFYEDYKGNIIVGDKDIRSV 416

Query: 539 NSKSLRRHIGLVQQEPILMSGTIRDNIVYG--LTEMPTKDEIRQVAKQCFC-HNFITRFQ 595
               L ++I LV+Q   L + T+++NI+ G   T     D +        C  + I+   
Sbjct: 417 PIDELLQNITLVEQRCTLFNDTLKNNILLGSKYTSQTINDGLLSSICSLACLDSVISSLP 476

Query: 596 SSYDTVIGPHGTLLSGGQKQRIAIARALIKKPRILILDEATSALDVESEGAINYTFGQLM 655
              +T +G  G  LSGGQ+QR+A+ARA ++   ILILDEA SALD+     +     ++ 
Sbjct: 477 DGIETRLGTDGITLSGGQQQRVALARAFLRDTDILILDEAVSALDIMQREILMRNISKVR 536

Query: 656 KKKEMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELWDDPTSELSQLLN 709
           + K  T + + H L+ I  ++  I L  +  + E G  K L +D  +    + N
Sbjct: 537 QNK--TTIILTHDLNQINDND-YIYLFENNEIKENGFKKTLMNDENTLFYNMYN 587

>ZYRO0G02244g Chr7 (169369..173190) [3822 bp, 1273 aa] {ON} similar to
            uniprot|P12866 Saccharomyces cerevisiae YKL209C STE6
            ATP-binding cassette (ABC) transporter required for the
            export of a-factor catalyzes ATP hydrolysis coupled to
            a-factor transport contains 12 transmembrane domains and
            two ATP binding domains expressed only in MATa cells
          Length = 1273

 Score =  167 bits (422), Expect = 9e-42,   Method: Compositional matrix adjust.
 Identities = 123/407 (30%), Positives = 206/407 (50%), Gaps = 22/407 (5%)

Query: 302  PPVILSASVFGKQISTTSRELQEATGHLTKVAEEQLSGIKTVQSFVAEQREINRYNFAIR 361
            P +++ + ++G  +     E +     L  V  E ++G+KT++    E     ++N   +
Sbjct: 861  PLLVIFSMIYGILLKKYETEYKNTIAKLENVQYEVVTGMKTIRCLQIEDHFKAKFNVLKQ 920

Query: 362  DIFNIGKKAAVINAKFFSSTSAMGDLSFLTVLGFGSY-LVLQNSLTIGDLT---AFMMYT 417
                +G++ A++   F  + S    +S   +L + +  LV+    T   +      +++T
Sbjct: 921  TAKLMGQRRAIVTG-FGVAVSNGLTMSIQGILYYYAIKLVIHGEYTTKKMFETFTLLLFT 979

Query: 418  EYTGNSIFGLSTFYSEIMQGAGAASRLFELTDRVPSIST--TKG-----VKYKPGNGEIE 470
              T N+   L     +I +G  AAS+++ + + +       T+G     +   P    I 
Sbjct: 980  IMTCNN---LVNQIPDIRRGQRAASKIYRILEGIDESECFETEGHRIVPIVENPTGPIIR 1036

Query: 471  FKNVSFAYPTRPSNMIFKNLNFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPSSGEILI 530
            F ++SFAYPT P+  I K+L+ +I +G  + IVG SG GKST+  ++ + Y+  S  + +
Sbjct: 1037 FNDLSFAYPTAPTVKILKHLSMEIYSGDRIAIVGESGCGKSTLVNIITRLYECPSNSLFV 1096

Query: 531  DGQNINDLNSKSLRRHIGLVQQEPILMSGTIRDNIVYGLTEMPTKD-EIRQVAKQCFCHN 589
            D  ++ND     LR  I +V+Q+P L  GTIR+N+VYG + + T D ++  + K    ++
Sbjct: 1097 DNTDVNDWALPKLREQIAVVEQKPTLFKGTIRENLVYG-SPLGTADVDVFNMLKYVGIYD 1155

Query: 590  FITRFQSSYDTVIGPHGTLLSGGQKQRIAIARALIKKPRILILDEATSALDVESEGAINY 649
            F        +T I     LLSGGQ QR+ IARAL+++P+ILILDE TSALD  S   IN 
Sbjct: 1156 FFATLPEGLETKI--DSGLLSGGQNQRLCIARALLQRPKILILDECTSALDTMSSHIINE 1213

Query: 650  TFGQLMKKKEMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKEL 696
               +      M  +SI H    +R    V VL   G +VEMG  ++L
Sbjct: 1214 IIRE--GPPTMLTISITHDEQMVRACNKVAVLDQ-GHIVEMGNREDL 1257

 Score =  151 bits (381), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 121/411 (29%), Positives = 196/411 (47%), Gaps = 27/411 (6%)

Query: 302 PPVILSASVFGKQISTTSRELQEATGHLTKVAEEQLSGIKTVQSFVAEQREINRYNFAIR 361
           P ++L A  F + I   S +    T   +++    +   + V+    +  E+  +  A++
Sbjct: 174 PVIVLCAIFFSRLIHIYSEKENSHTAISSQLLSWSMEAAQLVRLSCMQLVEVQNFQLAVK 233

Query: 362 DIFNIGKKAAVINAKFFSSTSAMGDLSFLTV------LGFGSYLVLQNSLTIGDLTAFMM 415
                  K  +    + S+ +A+  L FLT+        FGS ++ ++ L I D+     
Sbjct: 234 KCSKNFMKMCL----YASANTAI--LKFLTLTIFVQAFWFGSTMIRKHKLRIEDVITCFQ 287

Query: 416 YTEYTGNSIFGLSTFYSEIMQGAGAASRL----FELTDRVPSISTTKGVKYKPGNG---E 468
                G +I G  T +  ++   G    +    F   D           ++    G   +
Sbjct: 288 SCVLLGATING--TLHQIVILQKGKVGVINVNEFLKKDEYLKEDFKNNRRFYLDGGISEK 345

Query: 469 IEFKNVSFAYPTRPSNMIFKNLNFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPSSGEI 528
           IE +NV F YP+RP+    KN++  +  G    +VG SG GKS++  LL K Y   +G I
Sbjct: 346 IELRNVQFNYPSRPTVPALKNVSLTLPVGKITYVVGKSGSGKSSLGNLLLKLYDDYNGSI 405

Query: 529 LIDGQNINDLNSKSLRRHIGLVQQEPILMSGTIRDNIVYGLTEMP--TKDE-IRQVAKQC 585
            IDG +I  ++ KS+ ++I LV+Q   L + T+R+NI++G  E     +DE ++   +  
Sbjct: 406 SIDGIDIKGIDQKSILKNITLVEQRCTLFNDTLRNNILFGSKETDELVRDESLKAACRIS 465

Query: 586 FCHNFITRFQSSYDTVIGPHGTLLSGGQKQRIAIARALIKKPRILILDEATSALDVESEG 645
              NFI       DT+IG  G   SGGQ+QRIAIARA ++   IL+LDEA SALD+   G
Sbjct: 466 LLDNFIYDLPEGLDTLIGTGGITPSGGQQQRIAIARAYMRDTPILVLDEAVSALDIIHRG 525

Query: 646 AINYTFGQLMKKKEMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKEL 696
            +         + E T + + H LS I   +++I L  DG VVE G+ + L
Sbjct: 526 LLMNAIRNW--RSEKTTIILTHDLSEI-GPDDMIYLLEDGEVVEQGQQRNL 573

>NDAI0D01540 Chr4 (369687..373568) [3882 bp, 1293 aa] {ON} Anc_1.527
            YKL209C
          Length = 1293

 Score =  166 bits (421), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 132/422 (31%), Positives = 204/422 (48%), Gaps = 21/422 (4%)

Query: 302  PPVILSASVFGKQISTTSRELQEATGHLTKVAEEQLSGIKTVQSFVAEQREINRYNFAIR 361
            P +IL + ++G  +       + A   L     E ++ IKT++   A +  I  Y     
Sbjct: 878  PLIILVSGIYGSTLQRYETMYKTAVAELENHEYEIMTKIKTIRYLQASKYFIKNYKVLEN 937

Query: 362  DIFNIGKKAAVINAKFFSSTSAMGDLSFLTVLGFGSYLVLQNSLTIGDLTAFMMYTEYTG 421
            ++  I  K ++      S T+ +       +  +G  LV +   +   +        +T 
Sbjct: 938  NLKKIAHKRSIATGFGISITNTIAVCIQSILYYYGLRLVFKGEYSSKKMFETFTLLLFTI 997

Query: 422  NSIFGLSTFYSEIMQGAGAASRLFELTDR-------VPSISTTKGVKYKPGNGE----IE 470
             S   L +   +I +G  AAS L+ + D        V S S +  +    GN      I 
Sbjct: 998  ISCTSLVSQIPDISRGQRAASWLYRILDESDDNKESVDSGSRSADIII-SGNTNSVPLIS 1056

Query: 471  FKNVSFAYPTRPSNMIFKNLNFKIEAGS-NVCIVGPSGRGKSTVALLLEKYYKPSSGEIL 529
             KN+ F+YP+  +  I+KN+   + +    + IVG SG GKST+  LL K YK  +  I 
Sbjct: 1057 IKNLRFSYPSAQTVEIYKNITLHVTSSQKTIGIVGESGSGKSTLMYLLTKLYKTPANSIY 1116

Query: 530  IDGQNINDLNSKSLRRHIGLVQQEPILMSGTIRDNIVYGLTEMPTKDEIRQVAKQCFCHN 589
            IDG ++N+ ++  LR+ I +V+Q P L  GT+RDN+VYG     ++ EI  V K    + 
Sbjct: 1117 IDGTDVNEWDTLKLRKQISVVEQNPTLFEGTVRDNLVYGTLNDISEIEIYDVLKYLGIYE 1176

Query: 590  FITRFQSSYDTVIGPHGTLLSGGQKQRIAIARALIKKPRILILDEATSALDVESEGAINY 649
            FI       D+ I     L+SGGQ QR+ IARAL++KP ILILDE TSALD  S   IN 
Sbjct: 1177 FIENLPMGLDSRIDTK--LVSGGQAQRLCIARALLRKPTILILDECTSALDAASAHLIN- 1233

Query: 650  TFGQLMKKKEMTIVSIAHRLS-TIRRSENVIVLGHDGSVVEMGKFKELWDDPTSELSQLL 708
                L+K    T+++I    S  +  + N + +  DG + E G F EL  +  SEL +++
Sbjct: 1234 ---NLVKNGLPTVLTIVITHSKQMMEACNSLAVIKDGRLAEQGNFAELMKN-NSELRRII 1289

Query: 709  NE 710
            NE
Sbjct: 1290 NE 1291

 Score =  162 bits (410), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 138/520 (26%), Positives = 230/520 (44%), Gaps = 34/520 (6%)

Query: 218 LSERLVARLRATVIKKTIHQDAEFFDTHK--VGDLISRLGSDAYVVSRSMTQKVSDGFKA 275
           L ER    +R  ++ + + +  E++D H   +GD  +++      +  S  +  +  F+ 
Sbjct: 100 LGERQGFAIRKRLLNEYLVKPMEWYDCHDKLLGDF-TQVNRCVEELRSSSAEASAITFQN 158

Query: 276 LICGSVGIGMMXXXXXXXXXXXXVFTPPVILSASVFGKQISTTSRELQEATGHLTKVAEE 335
            +     IG                 P +IL A +F   I   +      TG   ++   
Sbjct: 159 FVAMLALIGTSFYYSWSLTLIILCSAPLIILFAILFSHMIHKYTELENSETGKAAQLLNW 218

Query: 336 QLSGIKTVQSFVAEQREINRYNFAI---RDIFNIGKKAAVINAKFFSS--TSAMGDLS-- 388
            ++  + V+ +  +  EI+ +   +    D+F        I + F+ S  TS +  LS  
Sbjct: 219 SMNSAQLVKLYCTQAYEIHSFKELVGQCNDLF--------IKSCFYVSANTSILRFLSLS 270

Query: 389 -FLTVLGFGSYLVLQNSLTIGDLTAFMMYTEYTGNSIFGLSTFYSEIMQGAGAASRLFEL 447
            F+    FG+ +V +  L+I D+          G+++         + +G  A  ++ + 
Sbjct: 271 MFVQGFWFGAIMVKKGKLSIKDVITCFHSCLMLGSTLNNTLQQIVVLQKGDVALKKILDF 330

Query: 448 ---TDRVPSISTTKGVKYKPGNGEIEFKNVSFAYPTRPSNMIFKNLNFKIEAGSNVCIVG 504
              + R PS+           NGEI F+N+SFAYPTRP   + K+++   + G +  I+G
Sbjct: 331 ISFSQRSPSLEPPYEPSVPISNGEISFQNISFAYPTRPHQTVLKDVSITFQPGRSTFIIG 390

Query: 505 PSGRGKSTVALLLEKYYKPSSGEILIDGQNINDLNSKSLRRHIGLVQQEPILMSGTIRDN 564
            SG GKST+A LL K+Y    G I I   N+  +N   L  +I +V+Q   L + T+R+N
Sbjct: 391 KSGSGKSTLANLLLKFYNDYQGSIKIGNTNVKKINKNWLFENITVVEQRCTLFNDTLRNN 450

Query: 565 IVYGLTEMPTKDE---------IRQVAKQCFCHNFITRFQSSYDTVIGPHGTLLSGGQKQ 615
           ++ G++    K E         ++   +       I       DT+IG  G  LSGGQ+Q
Sbjct: 451 LLLGISNSNQKVEQDDIEISQRLKDACRIAMLEELIRELPDGLDTIIGAGGVSLSGGQQQ 510

Query: 616 RIAIARALIKKPRILILDEATSALDVESEGAINYTFGQLMKKKEMTIVSIAHRLSTIRRS 675
           R+AIARA IK   +LILDEA SALD+     I          K  T + + H LS +   
Sbjct: 511 RVAIARAYIKDSSVLILDEAVSALDIIHRELIMKAIKNWRSGK--TTIILTHDLSQLDYD 568

Query: 676 ENVIVLGHDGSVVEMGKFKELWDDPTSELSQLLNEKSTPH 715
           + + V   DG V E G  + L  D  +  S+L + +   H
Sbjct: 569 DFLYVF-EDGEVKESGYQQALLQDEKTIFSKLYDIQMRKH 607

>KLLA0B14256g Chr2 (1248654..1252469) [3816 bp, 1271 aa] {ON}
           similar to uniprot|P12866 Saccharomyces cerevisiae
           YKL209C STE6 ATP-binding cassette (ABC) transporter
           required for the export of a-factor catalyzes ATP
           hydrolysis coupled to a-factor transport contains 12
           transmembrane domains and two ATP binding domains
           expressed only in MATa cells
          Length = 1271

 Score =  166 bits (420), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 94/251 (37%), Positives = 150/251 (59%), Gaps = 4/251 (1%)

Query: 466 NGEIEFKNVSFAYPTRPSNMIFKNLNFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPSS 525
           +G+IEF++VSFAYPTRP + + KN++ KI++G+   IVG SG GKST+A LL K Y   +
Sbjct: 354 DGDIEFRDVSFAYPTRPDDYVLKNVSIKIKSGATCFIVGKSGSGKSTLASLLLKMYGEYT 413

Query: 526 GEILIDGQNINDLNSKSLRRHIGLVQQEPILMSGTIRDNIVYGLTEMPTKDEIRQVAKQC 585
           GEI      I+ L+   L  +I LV+Q   L +GT++DN+   + +  +  E++Q  +  
Sbjct: 414 GEIKFGEYEIDSLDDSWLVENITLVEQRCTLFNGTLKDNLTI-VNKYASCTEVKQACQFA 472

Query: 586 FCHNFITRFQSSYDTVIGPHGTLLSGGQKQRIAIARALIKKPRILILDEATSALDVESEG 645
             +  +    +  DT++G HG  LSGGQ+QR+A+ARA ++   +LILDE+ SALD+ S  
Sbjct: 473 LLNTVLLNLPNGIDTLLGRHGVTLSGGQQQRVALARAYLRNTPVLILDESLSALDIMSRE 532

Query: 646 AINYTFGQLMKKKEMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELWDDPTSELS 705
            I        K K  T + + H  + I+  E V ++  +G+VVE G   +L ++P S  +
Sbjct: 533 LIVEAIRHWRKGK--TTIILTHEYTQIKDDEYVYLMS-EGTVVESGFKYDLLENPDSYFA 589

Query: 706 QLLNEKSTPHQ 716
           QL + + T ++
Sbjct: 590 QLNSLQETRYE 600

 Score =  165 bits (418), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 138/497 (27%), Positives = 240/497 (48%), Gaps = 19/497 (3%)

Query: 214  LLRVLSERLVARLRATVIKKTIHQDAEFFD--THKVGDLISRLGSDAYVVSRSMTQKVSD 271
            +L   SE  + RLR   + K   +  ++F   T+   +L S + +D   +    ++ +S 
Sbjct: 768  ILGYCSEVWIERLRVDAMAKISSKSLDWFKLPTNNSSELNSLMMNDLRDLRGLASEFLSA 827

Query: 272  GFKALICGSVGIGMMXXXXXXXXXXXXVFTPPVILSASVFGKQISTTSRELQEATGHLTK 331
                +   S+G+                  P  IL + ++G  +       +     L  
Sbjct: 828  ITTLVFVASIGLIWALVSGWKLSLVCISLFPAFILFSGIYGSLLQVYETAYKTEIAELET 887

Query: 332  VAEEQLSGIKTVQSFVAEQREINRYNFAIRDIFNIGKKAAVINAKFFSSTSAMGDLSFLT 391
               E +  +KT++    +Q     +   +  +  + KK +V      + T+A+  +    
Sbjct: 888  RVHELVISMKTIKLLQLQQHFEGSFKTQLAKVRIVCKKRSVAVGFGIAVTNALAMVVQAI 947

Query: 392  VLGFGSYLVLQNSLTIGDLTAFMMYTEYTGNSIFGLSTFYSEIMQGAGAASRLFELTDRV 451
            +  FG  LV+Q   ++  +        ++  +   L     EI +G  AA+ +F++ +  
Sbjct: 948  LFFFGIKLVIQGEYSVAQMFETFTLLLFSIMTCVSLINQVPEISRGQRAATYIFKVLEDS 1007

Query: 452  PSISTTK-------GVKYKPGNGE-IEFKNVSFAYPTRPSNMIFKNLNFKIEAGSNVCIV 503
             S+ T+K             GN E I+  N+SFA+ + P N IF +L+ +I     V IV
Sbjct: 1008 GSVDTSKPDPSQNQSFFSTAGNRETIKISNLSFAFSSAPMNKIFNSLSCEICLNETVGIV 1067

Query: 504  GPSGRGKSTVALLLEKYYKPSSGEILIDGQNINDLNSKSLRRHIGLVQQEPILMSGTIRD 563
            G SG GKST++LLL + Y   SG++ I G +IN  +  +LRR I +V+Q+P    GT+R+
Sbjct: 1068 GESGSGKSTLSLLLTRLYPVPSGKVYIGGIDINKWDEYALRRTISIVEQKPKFFDGTVRE 1127

Query: 564  NIVYGLTEMPTKDEIRQVAKQCFCHNFITRFQSSYDTVIGPHGTLLSGGQKQRIAIARAL 623
            N+VYGL    +  E+R V K     +F+    +  +T +  H  L+SGGQ QR++IAR L
Sbjct: 1128 NLVYGLKRNVSNSELRSVLKSVDLLSFVQTLPNDLNTRV--HDGLMSGGQAQRLSIARTL 1185

Query: 624  IKKPRILILDEATSALDVESEGAINYTFGQLMKK--KEMTIVSIAHRLSTIRRSENVIVL 681
            +++P+I+ILDE TSALD  +  AI     +L++   K +T++ I H    ++  + V+VL
Sbjct: 1186 LRQPKIIILDECTSALDAANSFAI----AELIRTVLKNVTVIVITHSEQLMQICDRVLVL 1241

Query: 682  GHDGSVVEMGKFKELWD 698
               G V E G + EL++
Sbjct: 1242 -KKGKVKEEGSYAELFE 1257

>NCAS0G03510 Chr7 (652949..656815) [3867 bp, 1288 aa] {ON} Anc_1.527
          Length = 1288

 Score =  164 bits (416), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 145/511 (28%), Positives = 248/511 (48%), Gaps = 33/511 (6%)

Query: 207  ANYGRIILLRVLSERLVARLRATVIKKTIHQDAEFF--DTHKVGDLISRLGSDAYVVSRS 264
            +N+ +  +L   SE  +  LR   ++  +++D  +F  DT+K  +L + L +D   +   
Sbjct: 774  SNFLKAYILGYCSENWIMDLRNEAMESILNKDLFWFSKDTNKSSELSALLLNDLRDLRSL 833

Query: 265  MTQKVSDGFKALICGSVGIGMMXXXXXXXXXXXXVFTPPVILSASVFGKQISTTSRELQE 324
            +++ +S     ++   +G+                  P +I  ++V+G  +       + 
Sbjct: 834  VSEFLSAMTTFMVVSLIGLIWALVSGWKLSLVCLSMFPLIIAFSAVYGTMLQKYETTYKT 893

Query: 325  ATGHLTKVAEEQLSGIKTVQSFVAEQREINRYNFAIRDIFNIGKKAAVINAKFFSSTSAM 384
            +   L     E ++GIKT++S  AE   I  Y+    ++  I  K ++    F  S + M
Sbjct: 894  SVAALENQEYEIMTGIKTIRSLQAESHFIKNYSGLEHNMRAIAHKRSIATG-FGISVTNM 952

Query: 385  GDLSFLTVLGF-GSYLVLQ---NSLTIGDLTAFMMYTEYTGNSIFGL----------STF 430
              +   ++L + G  LV +   +S  + +    +++T  T  S+             +TF
Sbjct: 953  ITICIQSILYYYGIKLVFEGEYSSKKMFETFTLLLFTIMTCTSLVNQIPDISRGQRSATF 1012

Query: 431  YSEIM-QGAGAASRLFELTDRVPSISTTKGVKYKPGNGEIEFKNVSFAYPTRPSNMIFKN 489
               I+ +G  +    FE T R   I   K  +    N  I+ +N++FAYP+  +  ++++
Sbjct: 1013 LYRILDEGLASDESEFE-THRKAEIVAPK--QESKSNPLIKIQNLTFAYPSETNVNVYED 1069

Query: 490  LNFKIEAGS-NVCIVGPSGRGKSTVALLLEKYYKPSSGEILIDGQNINDLNSKSLRRHIG 548
            LN ++ A    + +VG SG GKST+  LL K Y+ +   I +DG ++ND    +LR  I 
Sbjct: 1070 LNLEMHASEKTIGLVGESGSGKSTLMYLLTKLYQVAPHSIYLDGTDVNDWGLMNLRTQIS 1129

Query: 549  LVQQEPILMSGTIRDNIVYGLTEMPTKDEIRQVAKQCFCHNFITRFQSSYDTVIGPHGTL 608
            +V+Q+P L  GT+R+N+ YG++      E+  + K    + F+       DT I     L
Sbjct: 1130 VVEQKPTLFDGTVRENLSYGISTDILDMELFDMLKYVGIYEFVESLPFGLDTRIDTK--L 1187

Query: 609  LSGGQKQRIAIARALIKKPRILILDEATSALDVESEGAINYTFGQLMKKKE---MTIVSI 665
            LSGGQ QRI IARAL++KP+ILILDE TSALD  S   I      ++K      +TIV I
Sbjct: 1188 LSGGQAQRICIARALLRKPKILILDECTSALDALSANII----IDIVKNGPPALLTIV-I 1242

Query: 666  AHRLSTIRRSENVIVLGHDGSVVEMGKFKEL 696
             H    + R+ N I +  +G ++E G FKEL
Sbjct: 1243 THS-EKMMRACNTIAVLKNGKIIEKGGFKEL 1272

 Score =  133 bits (335), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 118/434 (27%), Positives = 203/434 (46%), Gaps = 43/434 (9%)

Query: 301 TPPVILSASVFGKQISTTSRELQEA-TGHLTKVAEEQLSGIKTVQSFVAEQREINRYNFA 359
           T P+I++ +VF   +     EL+   TG   ++A   +  I+ V+ +  + RE+  +   
Sbjct: 185 TAPIIIAFAVFFSHMIHKYTELENTETGKAAQLANWAMDSIQLVKLYCTQFREVRNFREL 244

Query: 360 IRDIFNIGKKAAVINAKFFSSTSAMGDLSFLTV------LGFGSYLVLQNSLTIGDLTAF 413
             +  ++  K  +    + S+ +A+  L FL++        FG+ +V +  L I ++   
Sbjct: 245 TSNCNDLFIKCCL----YVSANTAL--LRFLSLSMFIQGFWFGATMVRKGKLQISNVVTC 298

Query: 414 MMYTEYTGNSIFGLSTFYSEIMQGAGAASRLFELTDRVPSISTTKGVK---YKPGN---- 466
                  G+++         + +G  A  ++        S S   G     Y+P      
Sbjct: 299 FQSCLMLGSTLSNTLQVIVILQKGDVALKKILGFL----STSVDHGADEPIYEPETPAEL 354

Query: 467 GEIEFKNVSFAYPTRPSNMIFKNLNFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPSSG 526
             I F N++F+YP+RPS+ + KN++   E      I+G SG GKST++ LL K+Y   +G
Sbjct: 355 CTIAFNNITFSYPSRPSHPVLKNVSLCFEPTKFTFIIGKSGSGKSTLSNLLLKFYDDYNG 414

Query: 527 EILIDGQNINDLNSKSLRRHIGLVQQEPILMSGTIRDNIVYGLT--EMPTKDEIRQVAKQ 584
            I + G ++ ++N   L  ++ +V+Q   L + T+R+NI+ G++  ++   + I Q  K 
Sbjct: 415 TITVKGNDVKEINRNWLLNNVTVVEQRCTLFNDTLRNNILLGVSKDQLEDHESIEQKLKD 474

Query: 585 CFCHNFITRFQSSYDTVIGPHG---------TLLSGGQKQRIAIARALIKKPRILILDEA 635
               + + R          PHG           LSGGQ+QR+AIARA ++   ILILDEA
Sbjct: 475 ACSISMLDRLVCDL-----PHGLNTIIGSGGISLSGGQQQRVAIARAFMRNKPILILDEA 529

Query: 636 TSALDVESEGAINYTFGQLMKKKEMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKE 695
            SALD+     +     Q    K  T + + H LS I   +   V+  +G V E G  K+
Sbjct: 530 VSALDIIHRELLMKNIRQWRSGK--TTILLTHELSQIEPDDYTYVI-QEGEVKENGYQKD 586

Query: 696 LWDDPTSELSQLLN 709
           L    TS  + +LN
Sbjct: 587 LKQKKTSVFNHMLN 600

>Ecym_3612 Chr3 (1167419..1171366) [3948 bp, 1315 aa] {ON} similar to
            Ashbya gossypii AFR432W
          Length = 1315

 Score =  164 bits (414), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 142/516 (27%), Positives = 237/516 (45%), Gaps = 58/516 (11%)

Query: 214  LLRVLSERLVARLRATVIKKTIHQDAEFF--DTHKVGDLISRLGSDAYVVSRSMTQKVSD 271
            +L V SE  +  LR   + +  +QD  +F  D +K  ++ + + +D   +   ++  +S 
Sbjct: 813  ILSVCSELWIMSLRIKAMDRISNQDVHWFSLDINKPSEISALILNDLRDLRYLVSGFLSA 872

Query: 272  GFKALICGSVGIGMMXXXXXXXXXXXXVFTPPVILSASVFGKQISTTSRELQEATGHLTK 331
                +   ++G+                  P  I    ++G  +     + + A   L  
Sbjct: 873  VTTLIFVSAIGLAWAFVSGWKLSLVCISTIPLFIGVTGIYGGVLQKYETDYKTAVAELEN 932

Query: 332  VAEEQLSGIKTVQSFVAEQREINRYNFAIRDIFNIGKKAAVINAKFFSSTSAMGDLSFLT 391
               E + GIKTV+    E    N+Y      + +  ++ AV+                  
Sbjct: 933  NMFEFVKGIKTVRCLQLESHFSNKYTMLEEGMKHQSRRRAVVT----------------- 975

Query: 392  VLGFGSYLVLQNSLTIGDLTAFMMYT--------EYTGNSI---FGLSTF----YSEIM- 435
              GFG  + L N+L IG + A + Y         EYT +++   F L  F     S +M 
Sbjct: 976  --GFG--VALSNALVIG-VQAILYYYGIKLVVDGEYTPDNLLQTFTLLVFTIMTCSALMY 1030

Query: 436  ------QGAGAASRLFE-LTDRVPSISTTKGVKYKP------GNGEIEFKNVSFAYPTRP 482
                  +G  AA+ +F  L  R   +S     + +P       N  I  ++++FAYP+  
Sbjct: 1031 EVPSFSRGRRAATYVFRILNTRSDFLSIDDDFRTEPIEKPSHMNPLIRIQDLTFAYPSAL 1090

Query: 483  SNMIFKNLNFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPSSGEILIDGQNINDLNSKS 542
               ++K L+  I  G N+ IVG SG GKST+ L+L   Y  +   + ID  +I   N  S
Sbjct: 1091 DVEVYKKLSLTINFGENLAIVGESGSGKSTMGLILCGLYPVNGNTVFIDDTDICKWNLSS 1150

Query: 543  LRRHIGLVQQEPILMSGTIRDNIVYGLTEMPTKDEIRQVAKQCFCHNFITRFQSSYDTVI 602
            LR+HI +V+Q+     G+IRDN++YGL  + T  +I +V       +F+       +T I
Sbjct: 1151 LRKHISMVEQKAKFFDGSIRDNLIYGLDRIVTDSQIFEVLSLVGIADFVKELPQGLNTRI 1210

Query: 603  GPHGTLLSGGQKQRIAIARALIKKPRILILDEATSALDVESEGAINYTFGQLMKKKEMTI 662
              +  L+SGGQ QRI+I RAL+++P++LILDE TS+LD ++  AI    G  +    +T 
Sbjct: 1211 DTN--LISGGQAQRISIGRALLRQPKLLILDECTSSLDAKNAQAIASLVGSSLYG--ITT 1266

Query: 663  VSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELWD 698
            + I H  + + +S N I+   +G + E G F+EL D
Sbjct: 1267 IVITHN-TQMMKSCNRILFFKNGRISEEGTFQELSD 1301

 Score =  115 bits (287), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 107/438 (24%), Positives = 192/438 (43%), Gaps = 46/438 (10%)

Query: 301 TPPVILSASVFGKQISTTSRELQEATGHLTKVAEEQLSGIKTVQSFVAEQREINRYNFAI 360
           TP +I  A +F K +   +      T H   +    +   + ++ F  EQ E+ +++ ++
Sbjct: 186 TPLIIALAIIFSKLVEKYTELENTETSHAASILTWSMEAPQLIRLFGTEQVELQKFSISV 245

Query: 361 RD----IFNIGKKAAVINAKFFSSTSAMGDLSFLTVLGFGSYLVLQNSLTIGDLTAFMMY 416
           +       N+ K AA   A    S   +  + F+    FG+ ++ +  L  G +      
Sbjct: 246 KKCSKFFINLSKYAAANQA----SLRGLSLIMFVQGFWFGNTMIKRGKLNSGQVITCFSA 301

Query: 417 TEYTGNSIFGLSTFYSEIMQGAGAASRLFELTD-RVPSISTTKGVKYK----PGNG---- 467
               G ++         + +G  A  ++  + +    ++   +G  ++    P +G    
Sbjct: 302 CILLGTTLNNTLQHIVIMQKGKVALQKILSMVESESDALRGRRGETFEIFPSPISGMFVS 361

Query: 468 -----EIEFKNVSFAYPTRPSNMIFKNLNFKIEAGSNVCIVGPSGRGKSTVALLLEKYYK 522
                +I F+NVSF+YP+RP+     N++          IVG SG GKST++ LL K Y 
Sbjct: 362 PVFPKQITFENVSFSYPSRPNEYALDNVSLTFYPEKITFIVGKSGSGKSTLSNLLLKLYS 421

Query: 523 PSSGEILIDGQNINDLNSKSLRRHIGLVQQEPILMSGTIRDNIVYGLTEMPTKDE----- 577
              G I +   +I       L  +I LV+Q     S T+ ++ +     +  KD+     
Sbjct: 422 DYEGTIKVGTLDIRATKDSWLLENITLVEQ-----SCTLFNDSLLNNLLLTAKDDNKNEA 476

Query: 578 -IRQVAKQCFCHNFITRFQSSYDTVIGPHGTLLSGGQKQRIAIARALIKKPRILILDEAT 636
            I++  +       +        TVIG +G  LSGGQ+QR+A+ARA+++   +LILDE+ 
Sbjct: 477 SIKRACQMALLEKLLFDLPDGLSTVIGSNGISLSGGQQQRVALARAILRDTPVLILDESI 536

Query: 637 SALDVESEGAI-----NYTFGQLMKKKEMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMG 691
           SALD+     +     N+  G+       T + + H LS I   ++ + L  DG V E G
Sbjct: 537 SALDIIHRDLLMEVIRNWRAGK-------TTIILTHELSHI-LDDDYLYLMEDGKVGEHG 588

Query: 692 KFKELWDDPTSELSQLLN 709
             ++L    +   ++L N
Sbjct: 589 YKRDLLSYTSGRFTELHN 606

>Smik_11.14 Chr11 complement(26603..30553) [3951 bp, 1316 aa] {ON}
            YKL209C (REAL)
          Length = 1316

 Score =  164 bits (414), Expect = 9e-41,   Method: Compositional matrix adjust.
 Identities = 151/533 (28%), Positives = 255/533 (47%), Gaps = 33/533 (6%)

Query: 203  VGIAA-----NYGRIILLRVLSERLVARLRATVIKKTIHQDAEFF--DTHKVGDLISRLG 255
            +G+AA     N+ +  LL   SE  +  LR  V++K   +   +F  + +K  ++ + + 
Sbjct: 793  LGVAAADGIFNFAKGFLLGYCSEYWIMDLRNEVMEKLTKKSMNWFSGEDNKASEVSALVL 852

Query: 256  SDAYVVSRSMTQKVSDGFKALICGS-VGIGMMXXXXXXXXXXXXVFTPPVILSASVFGKQ 314
            +D   + RS+  +      + I  S +G+                  P +I+ ++++G  
Sbjct: 853  NDLRDL-RSLVSEFLSAITSFITVSFIGLVWALASGWKLSLVCISMFPLIIIFSAIYGSI 911

Query: 315  ISTTSRELQEATGHLTKVAEEQLSGIKTVQSFVAEQREINRYNFAIRDIFNIGKKAAVIN 374
            +     + + +   L     + ++ IKT++   AE      Y+     +  I  K A+  
Sbjct: 912  LQKHETDYKTSVVQLENCLYQIVTNIKTIKYLQAEFHFQLSYHKLKTKMEQIASKRAIAT 971

Query: 375  AKFFSSTSAMGDLSFLTVLGFGSYLVLQNSLTIGDLTAFMMYTEYTGNSIFGLSTFYSEI 434
                S T+ +       +  +G  LV+ +  T   +        +T  S   L +   +I
Sbjct: 972  GFGISMTNMIAMCIQAILYYYGLKLVMVHEYTSKKMFTTFTLLLFTIMSCTSLVSQIPDI 1031

Query: 435  MQGAGAASRLFELTDR-----------VPSISTTKGVKY--KPGNGEIEFKNVSFAYPTR 481
             +G  AAS ++ + D              SI    G  Y  K     +  +N++FAYP+ 
Sbjct: 1032 SRGQRAASWIYRILDEKQVTLEIEDNNARSIGII-GETYHEKQTTPMLSIQNLTFAYPSA 1090

Query: 482  PSNMIFKNLNFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPSSGEILIDGQNINDLNSK 541
            PS +I+KN+N  +  G  + IVG SG GKST+ LLL + Y    G I +DG ++ND N  
Sbjct: 1091 PSVLIYKNMNLNMFCGQTIGIVGGSGSGKSTLVLLLTRLYDCEVGSIKLDGTDVNDWNLT 1150

Query: 542  SLRRHIGLVQQEPILMSGTIRDNIVYGLTEMPTKDEIRQVAKQCFCHNFITRFQSSYDTV 601
             LRR I +V+Q+P+L +GTIRDN+ YG      + EI    K    ++F+        T 
Sbjct: 1151 VLRREISVVEQKPLLFNGTIRDNLTYGCLGEILEIEIYDALKYVGIYDFVASLPLGLGTR 1210

Query: 602  IGPHGTLLSGGQKQRIAIARALIKKPRILILDEATSALDVESEGAINYTFGQLMKKKEMT 661
            I  +  LLSGGQ QR+ IARAL++KP+ILILDE TSALD  S   I     +++KK    
Sbjct: 1211 IDTN--LLSGGQAQRLCIARALVRKPKILILDECTSALDSMSSHVIK----EIVKKGPPA 1264

Query: 662  IVS--IAHRLSTIRRSENVIVLGHDGSVVEMGKFKELWDDPTSELSQLLNEKS 712
            +++  I H    +R  +++ V   DG V+E G F  L+++   E+ ++++EK+
Sbjct: 1265 LLTLVITHDEQMMRCCDSIAVF-KDGKVIEEGSFDTLYNN-CGEMFRIVSEKN 1315

 Score =  162 bits (410), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 121/426 (28%), Positives = 198/426 (46%), Gaps = 29/426 (6%)

Query: 301 TPPVILSASVFGKQISTTSRELQEATGHLTKVAEEQLSGIKTVQSFVAEQREINRYNFAI 360
           +P +   A  F + +   S++  E T    ++    ++  + V+ +  +  E  ++   I
Sbjct: 210 SPIITFFAVAFSRMVHMYSQKENEETSKAAQLFAWSMNAAQLVRLYCTQPLERKKFQRII 269

Query: 361 RDIFNIGKKAAVINAKFFSSTSAMGDLSFLTV------LGFGSYLVLQNSLTIGDLTAFM 414
                +      I +  F + +A G L FLT+        FGS ++ Q  L I D+    
Sbjct: 270 -----LSCNTFFIKSCLFVAANA-GILRFLTLTMFVQGFWFGSTMIKQGKLNINDVITCF 323

Query: 415 MYTEYTGNSIFGLSTFYSEIMQGAGAASRLFELTDRVPSISTTKGVKYKP-----GNGEI 469
                 G+++         + +G  A  ++  L +  P  +    ++         N ++
Sbjct: 324 HSCILLGSTLNNTLHQIVVLQKGEVALQKIMNLLENGPKCNPPNEIELHQYPLDYANSDL 383

Query: 470 EFKNVSFAYPTRPSNMIFKNLNFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPSSGEIL 529
            F NVSF+YP+RPS ++ +N + K  AG    IVG SG GKST++ LL K+Y    G I 
Sbjct: 384 VFDNVSFSYPSRPSEIVLENASLKFPAGQFTFIVGKSGSGKSTLSSLLLKFYDGYDGSIS 443

Query: 530 IDGQNINDLNSKSLRRHIGLVQQEPILMSGTIRDNIVYGLTEMPTKDE---------IRQ 580
           I+G+NI  +  K L ++I +V+Q   L + T+R NI+ G TE+    +         I+ 
Sbjct: 444 INGRNIQAIPQKLLIKNITVVEQRCTLFNDTLRKNILLGSTELAKNADYSTNKNTNLIKD 503

Query: 581 VAKQCFCHNFITRFQSSYDTVIGPHGTLLSGGQKQRIAIARALIKKPRILILDEATSALD 640
             +       I       +T+IG  G  LSGGQ+QR+A+ARA I+   IL LDEA SALD
Sbjct: 504 ACRMALLDRLILDLPDGLETLIGSGGVTLSGGQQQRVAMARAFIRDTPILFLDEAVSALD 563

Query: 641 VESEGAINYTFGQLMKKKEMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELWDDP 700
           +     +        K K  T + + H L  +  S++ + L  +G V+E G   EL  D 
Sbjct: 564 IIHRNLLMKAIRHWRKGK--TTIILTHELGQV-ESDDHLYLMQEGKVIESGTQSELLADS 620

Query: 701 TSELSQ 706
           TS  S+
Sbjct: 621 TSTFSK 626

>AFR432W Chr6 (1213211..1217065) [3855 bp, 1284 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YKL209C (STE6)
          Length = 1284

 Score =  160 bits (406), Expect = 7e-40,   Method: Compositional matrix adjust.
 Identities = 133/507 (26%), Positives = 237/507 (46%), Gaps = 17/507 (3%)

Query: 203  VGIAA-----NYGRIILLRVLSERLVARLRATVIKKTIHQDAEFFDTHKVGDLISRLGSD 257
            +GIA+     N+ ++ LL  +SE+ V +LR  +++  + +D  +   +K  ++ +   +D
Sbjct: 768  IGIASFDAVFNFLQLFLLGFVSEQCVRQLRGNMMQLVLKRDLHWISQNKSSEITALTMND 827

Query: 258  AYVVSRSMTQKVSDGFKALICGSVGIGMMXXXXXXXXXXXXVFTPPVILSASVFGKQIST 317
               +    +  +S      +  SVG+                  P  I   +++G  +  
Sbjct: 828  LRDLRNVTSILLSSLTSLCVLASVGLIWAIVIGWKLTLVCLSLLPLFIGVITLYGMFVQK 887

Query: 318  TSRELQEATGHLTKVAEEQLSGIKTVQSFVAEQREINRYNFAIRDIFNIGKKAAVINAKF 377
            +  + + A   L  +  E + G+KT++    E     RY    + +    ++ +++    
Sbjct: 888  SEVQYKTAVSQLENLLSEIVKGVKTIKCLQLEPYFQGRYATMEKYLKKQMRRRSILYGSG 947

Query: 378  FSSTSAMGDLSFLTVLGFGSYLVLQNSLTIGDLTAFMMYTEYTGNSIFGLSTFYSEIMQG 437
             + TS +  L    +  +G  LV+        L        +T  S  GL +      +G
Sbjct: 948  LAITSCLVILLQTILYYYGIRLVVTGEYDSKQLFQTFTLILFTTMSSVGLLSALPSSSRG 1007

Query: 438  AGAASRLF-ELTDRVPSISTTKGVKYK-PGNG-----EIEFKNVSFAYPTRPSNMIFKNL 490
              A + +F  L + +P       V  K P N       +  + ++FAYP      I+KN 
Sbjct: 1008 QRAGTFVFGMLEEPLPEPDNYSAVLRKAPTNHFSREPLVVLRALNFAYPAAKDVQIYKNF 1067

Query: 491  NFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPSSGEILIDGQNINDLNSKSLRRHIGLV 550
            N +I  G+ V IVG SG GKST+  L+   Y      + IDG +I +    +LR+ I +V
Sbjct: 1068 NLRINQGTKVAIVGESGSGKSTLFYLICGLYPVKPASLFIDGTDICNWEMSALRKIIAVV 1127

Query: 551  QQEPILMSGTIRDNIVYGLTEMPTKDEIRQVAKQCFCHNFITRFQSSYDTVIGPHGTLLS 610
            +Q+P   +GTIR+N+VYGL    T +EI +V  +    NF+       +T +  +  L+S
Sbjct: 1128 EQKPRFFNGTIRENLVYGLEGTITDNEIYEVLAEVRIINFVRSLPEGLETRVDTN--LVS 1185

Query: 611  GGQKQRIAIARALIKKPRILILDEATSALDVESEGAINYTFGQLMKKKEMTIVSIAHRLS 670
            GGQ QR++I RAL+++P +LILDE TSALD  +  AI       +   ++T++ I H   
Sbjct: 1186 GGQLQRLSIVRALLRRPTLLILDECTSALDAANANAIANVVRNSL--HDITVIVITHSKQ 1243

Query: 671  TIRRSENVIVLGHDGSVVEMGKFKELW 697
             ++  + ++VL  +G+V E G F +L+
Sbjct: 1244 MMKMCDRIVVL-KNGAVAEDGSFDDLF 1269

 Score =  109 bits (273), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 112/422 (26%), Positives = 188/422 (44%), Gaps = 28/422 (6%)

Query: 310 VFGKQISTTSRELQEATGHLTKVAEEQLSGIKTVQSFVAEQREINRYNFAIRDIFNIGKK 369
           VF K +   +    E T   +      L+    V+ F  +  E+ ++N A+    N+ KK
Sbjct: 191 VFSKFVQKYAALENEQTSSASSTLSWALNSATMVKLFGTQDLELRKFNKAV----NLSKK 246

Query: 370 AAVINAKFFS-STSAMGDLS---FLTVLGFGSYLVLQNSLTIGDLTAFMMYTEYTGNSIF 425
             V      S + +AM  LS   F+    +GS L+ ++ +    +      +    +SI 
Sbjct: 247 YFVRTLICSSINQAAMRFLSLMMFVQAFWYGSILIQRDEVETAAVITVFSASVLLSSSIN 306

Query: 426 GLSTFYSEIMQGAGAASRLFELTDRVPSISTTK-GVKYKPGN--------GEIEFKNVSF 476
            + +    + +G  A  ++ E  +  P     +    Y+ G+         EI F  VSF
Sbjct: 307 AMLSKVVLLQKGKVACRQIAEAVNVEPEGRPNQYAFPYEVGHIIALEDQPSEIVFDQVSF 366

Query: 477 AYPTRPSNMIFKNLNFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPSSGEILIDGQNIN 536
            YP RP       ++          IVG SG GKST+  LL K+Y    G I ++  N+ 
Sbjct: 367 NYPARPDTKALDGVSLTFRPNQITFIVGKSGSGKSTLGNLLLKFYSDYEGIITVNSTNLR 426

Query: 537 DLNSKSLRRHIGLVQQEPILMSGTIRDNIVYGLTEMP---TKDEIRQVAKQCFCHNFITR 593
            ++   L ++I LV+Q   L +GT+ +NI   L+  P   T   +++  +       +  
Sbjct: 427 GIDRSWLLQNITLVEQSCTLFNGTLFENIT--LSAKPVNKTAGAVKRACQMALLEKLVFD 484

Query: 594 FQSSYDTVIGPHGTLLSGGQKQRIAIARALIKKPRILILDEATSALDVESEGAINYTFGQ 653
                 T +G  G  +SGGQ+QR+A+ARA+++   +LILDEA SALD+     +      
Sbjct: 485 LPEGLHTKVGSGGISMSGGQQQRVALARAILRDAPVLILDEAISALDIIHRDLLMEVIRS 544

Query: 654 LMKKKEMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELWDDPTSE---LSQLLNE 710
               K  T + + H LS +   + + ++ H G V+E G   EL  +P S    L++L N 
Sbjct: 545 WRADK--TTIILTHELSHVLDDDYLYMMEH-GQVIEQGYKSELLSNPNSRFRALNRLQNS 601

Query: 711 KS 712
           K+
Sbjct: 602 KN 603

>TDEL0E05610 Chr5 (1038912..1043519) [4608 bp, 1535 aa] {ON} Anc_4.52
            YLL015W
          Length = 1535

 Score =  156 bits (395), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 144/530 (27%), Positives = 247/530 (46%), Gaps = 59/530 (11%)

Query: 208  NYGRIILLRVLSERLVARLRATVIKKTIHQDAEFFDTHKVGDLISRLGSDAYVVSRSMTQ 267
            N   I+LL   + R  A+L  T+ K  +     FF+T  VG +I+R  SD   V  ++  
Sbjct: 1012 NLRTIVLLLFCTIRGAAQLHDTMAKTVLRSPMSFFETTPVGRIINRFSSDVQAVDSTLQW 1071

Query: 268  KVSDGFKALICGSVGIGMMXXXXXXXXXXXXVFTPPVILSASVFGKQISTTSRELQE--- 324
              +  F++++  +V + ++            V     I   + +     T SREL+    
Sbjct: 1072 VFAFFFRSILNYAVTVILISYNMPWFLIVNAVLLIIYIYYQAFY----ITLSRELKRLTS 1127

Query: 325  -ATGHLTKVAEEQLSGIKTVQSFVAEQREINRYNFAIRDIFNIGKKAAVINAKF-FSSTS 382
             +T  +  +  E L G   + +F    +  +R++F      N       IN  F F ST+
Sbjct: 1128 VSTSPIMSLFSETLGGHAVINAF----KHFDRFDF-----INFNNVQFNINCSFNFRSTN 1178

Query: 383  AMGDLSFLTVLGFGSYLVLQNSL----TI--------GDLTAFMMYTEYTGNSIFGLSTF 430
                +   T+   G+++VL  +L    TI        G +   M Y     +S+  +   
Sbjct: 1179 RWLSVRLQTI---GAFIVLATALLALSTINSERRLSPGMVGLLMSYALQVTSSLMWIVRM 1235

Query: 431  YSEIMQGAGAASRLFELTDRVPS----ISTTKGVKYKPGNGEIEFKNVSFAYPTRPSNMI 486
              +I     +  R++E  +  P     I + +  K  P  GEI FKN S  Y T+  ++ 
Sbjct: 1236 SVQIETNIVSVERIYEYCNLTPEAPEVIESCRPKKTWPSEGEIIFKNYSTKYKTK-GDLA 1294

Query: 487  FKNLNFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPSSGEILIDGQNINDLNSKSLRRH 546
             K +N  I+    + +VG +G GKST++L L +  + + G I IDG +I+ +  K LR H
Sbjct: 1295 LKGINLSIKPQEKIGVVGRTGAGKSTLSLALFRLLEATEGTIEIDGLDISKMGLKDLRSH 1354

Query: 547  IGLVQQEPILMSGTIRDNI----VYGLTEMPTKDEIRQVAK---QCFCHNFITRFQSS-- 597
            +G++ Q+     GT+R N+     Y   E+    E+  +     + F     +   +S  
Sbjct: 1355 LGIIPQDAQAFEGTVRSNLDPFEQYSTEELWASIELSHLKPHIVEMFRKEDNSELPASKE 1414

Query: 598  --YDTVIGPHGTLLSGGQKQRIAIARALIKKPRILILDEATSALDVESEGAINYTFGQLM 655
               D  I  +G  LS GQ+Q + ++RAL+   ++L+LDEAT+A+D+E++  I  T    +
Sbjct: 1415 KMLDVKISENGGNLSVGQRQLLCLSRALLNTSKVLVLDEATAAVDMETDKIIQETIRSEL 1474

Query: 656  KKKEMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELWDDPTSELS 705
            K+K  TI++IAHR+ T+  S+ +IVL       + G+ KE +D P + LS
Sbjct: 1475 KEK--TILTIAHRIDTVLDSDKIIVL-------DAGQVKE-FDTPENLLS 1514

 Score = 91.3 bits (225), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 107/419 (25%), Positives = 185/419 (44%), Gaps = 64/419 (15%)

Query: 331 KVAEEQLSGIKTVQSFVAEQREINRYNFAIR---DIFNIGKKAAVINAKFFSSTSA--MG 385
           K   E L+ +K+++ +  E+  + R +  +R   ++ N  +   V N  +F+      M 
Sbjct: 464 KTTTEILNSMKSIKLYAWEEAMLKRLD-HVRNGLELENYKRIGVVSNLIYFAWNCVPLMV 522

Query: 386 DLSFLTVLGFGSYLVLQNSLTIGDLTAFMMYTEYTGNSIFGLSTFYSEIMQGAGAASRLF 445
             S   +  F +   L   +    L+ F +      ++I+ L    + I++   + +R+ 
Sbjct: 523 TCSTFAIFSFFNKTPLSPEVVFPSLSLFNI----LNDAIYSLPNTINSIIETKVSINRIK 578

Query: 446 E------LTDRVPSISTTKGVKYKPGNGEIEFKNVSFAYPT---------------RPSN 484
           E      L D    I  T   K  P    +E  N +F + +                 S 
Sbjct: 579 EFLLSEELDDSFIEIDKTPSDKVSP---VVEIINATFLWKSPKILFSEGSDEESRIESSQ 635

Query: 485 MIFKNLN-FKIEAGSNVCIVGPSGRGKSTV--ALLLEKYYKPSSGEILIDGQNINDLNSK 541
           +  +N+N F+ + G   CIVG  G GKST+  A+L         G++     ++  L  K
Sbjct: 636 VALENINGFQAKKGELTCIVGRVGSGKSTMLRAIL---------GQLPCVNASVGGLEPK 686

Query: 542 SLRRH--IGLVQQEPILMSGTIRDNIVYGLTEMPTKDEIRQVA--KQCFCHNFITRFQSS 597
            L R   +    QEP +M+ +I+DNI +G       DE    A  K C     +      
Sbjct: 687 VLIRASTVAYCPQEPWIMNASIKDNITFGFR----YDETYYNATIKACQLLPDLDILPER 742

Query: 598 YDTVIGPHGTLLSGGQKQRIAIARALIKKPRILILDEATSALDVE-----SEGAINYTFG 652
            +T++G  G  LSGGQK RI++ARA+  +  + +LD+  SA+D E      E  ++   G
Sbjct: 743 DNTLVGEKGISLSGGQKARISLARAVYSRADLFLLDDILSAVDAEVSKNIVEMVLDKKMG 802

Query: 653 QLMKKKEMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELWDDPT-SELSQLLNE 710
            L  K   T+V   + +S + RS+ + +L   GS+VE G F E+   P  S+L ++++E
Sbjct: 803 LLRNK---TVVLTTNAISVLNRSQKIYML-EGGSIVEEGSFTEVTSSPEPSKLKKMIDE 857

>KLTH0B01100g Chr2 complement(94260..98156) [3897 bp, 1298 aa] {ON}
            similar to uniprot|P12866 Saccharomyces cerevisiae
            YKL209C STE6 ATP-binding cassette (ABC) transporter
            required for the export of a-factor catalyzes ATP
            hydrolysis coupled to a-factor transport contains 12
            transmembrane domains and two ATP binding domains
            expressed only in MATa cells
          Length = 1298

 Score =  154 bits (390), Expect = 8e-38,   Method: Compositional matrix adjust.
 Identities = 121/425 (28%), Positives = 205/425 (48%), Gaps = 27/425 (6%)

Query: 302  PPVILSASVFGKQISTTSRELQEATGHLTKVAEEQLSGIKTVQSFVAEQREINRYNFAIR 361
            P  IL    +G  +       + A   +       +  IKT++    E+R I  Y     
Sbjct: 886  PAFILFTGAYGGLLQKCEANYKSAVASMEDQLYSAVRRIKTIRCLQVEERVIKEYEVLEG 945

Query: 362  DIFNIGKKAAVINAKFFSSTSAMGDLSFLTVLGFGSYLVLQNSLTIGDLTAFMMYTEYTG 421
                 G+K A+      + ++A+  ++   +L +G  LV+    +   +   +    +T 
Sbjct: 946  KAKLAGRKRALGTGFGVALSNALTLITQSILLYYGMKLVITGEYSSERMFQTLTLLLFTI 1005

Query: 422  NSIFGLSTFYSEIMQGAGAASRLFELTDRVPSIS----------TTKGVKYKPGNGEIEF 471
             +   L     EI +G  AA+ LF + D     +          T++G         I  
Sbjct: 1006 MTCMSLIAQIPEISRGQRAATYLFRILDSETQFADANLEGESALTSRGCS---NEALIFI 1062

Query: 472  KNVSFAYPTRPSNMIFKNLNFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPSSGEILID 531
            K++ F+Y    + M+++ LN  ++AG  V +VG SG GKST+  L+ + Y+  SG I  D
Sbjct: 1063 KDLRFSYSFLNNPMVYRGLNLSVKAGETVALVGLSGSGKSTLWHLITRLYRVPSGSIWFD 1122

Query: 532  GQNINDLNSKSLRRHIGLVQQEPILMSGTIRDNIVYGLTEMPTKDEIRQVAKQCFCHNFI 591
            G ++N+    +LR+ I +V+Q P L  G+I DN+ YGL+    + EIR++ +     +F+
Sbjct: 1123 GLDVNEWEEWALRKRIAVVEQRPSLFRGSIFDNLTYGLSTSVDEREIRELLELVGMMDFV 1182

Query: 592  TR----FQSSYDTVIGPHGTLLSGGQKQRIAIARALIKKPRILILDEATSALDVESEGAI 647
                   QS  DT +      LSGGQ QR+AI RAL++KP++L+LDE TSALD +  G I
Sbjct: 1183 NSNPLGLQSFIDTDV------LSGGQLQRLAIVRALLRKPQLLVLDECTSALDAQ-HGFI 1235

Query: 648  NYTFGQLMKKKEMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELWDDPTSELSQL 707
               F +   +   T+V + H    + R+ N I+   +G+++E G F+ L+     EL ++
Sbjct: 1236 MSEFVRQGSQSTTTLV-LTHS-EQMMRACNRILTFANGNIIEDGSFERLYSQK-GELFKI 1292

Query: 708  LNEKS 712
            L+  S
Sbjct: 1293 LSSCS 1297

 Score =  145 bits (367), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 138/509 (27%), Positives = 226/509 (44%), Gaps = 31/509 (6%)

Query: 218 LSERLVARLRATVIKKTIHQDAEFFDTHK--VGDLISRLGSDAYVVSRSMTQKVSDGFKA 275
           L ER   RLR  +++  + +   ++D ++   GD  ++L      +  S  +  +  F+ 
Sbjct: 99  LGERQAFRLRRKMLQSYLDKSMAWYDANEQISGDF-TQLNRCVEELRSSSAESSAIVFQN 157

Query: 276 LICGSVGIGMMXXXXXXXXXXXXVFTPPVILSASVFGKQISTTSRELQEATGHLTKVAEE 335
           ++  +  +G                +P VI  A  F +++   ++     T         
Sbjct: 158 VVTVAALLGSALYYSWSLTLIIMANSPLVIGFAVFFSRKVEKYAKRENSETSSAADAMAW 217

Query: 336 QLSGIKTVQSFVAEQREINRYNFAIRDIFNIGKKAAVINAKFFSSTSAMGDLSFLTVLGF 395
            L   K V+    + RE+ R+   ++       K ++ ++  +S       L FLT+  F
Sbjct: 218 SLDAAKMVRLLGTQDRELARFEACVQKCRQHFNKMSLFSSLNYSV------LRFLTLCMF 271

Query: 396 GSYLVLQNS-LTIGDLTAFMMYTEYTGNSIFGL---STFYSEIMQGAGAASRLFELTDRV 451
                  NS + IG L    + T ++   +      ST +  I+   GA   L ++   V
Sbjct: 272 VQGFWYGNSRINIGKLKPGDVVTCFSSCVLLASTLNSTLHQIIILQKGAVG-LQKIMAFV 330

Query: 452 PSISTTKGVKYK--------PGNGE---IEFKNVSFAYPTRPSNMIFKNLNFKIEAGSNV 500
            S   ++  K K        P   E   I F+NV FAYPTRP + + K ++    +G   
Sbjct: 331 NSRDASESQKNKVEISFRRLPLCWERASITFQNVHFAYPTRPDDFVLKGVSLDFPSGETT 390

Query: 501 CIVGPSGRGKSTVALLLEKYYKPSSGEILIDGQNINDLNSKSLRRHIGLVQQEPILMSGT 560
            ++G SG GKST+  LL  +Y   SG I ++GQ++ ++N   L R+I LV+Q   L + T
Sbjct: 391 FVIGKSGSGKSTIGNLLLGFYGIGSGTINVNGQDVKEINQSELARNIMLVEQTTSLFTET 450

Query: 561 IRDNIVYGLTEMPTKDEIR--QVAKQCFCHNFITRFQSSYDTVIGPHGTLLSGGQKQRIA 618
           + +N+  G   +   DEIR  Q  +     N I       +T IG  G  LSGG++QR+A
Sbjct: 451 LANNVTIGEAGVD-DDEIRLKQACQMAMLGNIIRDLAKGLETTIGCSGLDLSGGEQQRVA 509

Query: 619 IARALIKKPRILILDEATSALDVESEGAINYTFGQLMKKKEMTIVSIAHRLSTIRRSENV 678
           +ARA  +   ILILDEA SA D   +  +     +    K  T + + H LS I  ++ V
Sbjct: 510 LARAYFRNAPILILDEALSAQDRIHKSLLMEAIRKWRADK--TTIILTHELSDILDTDYV 567

Query: 679 IVLGHDGSVVEMGKFKELWDDPTSELSQL 707
            V+  DG + E G    L  +P SE S L
Sbjct: 568 YVMS-DGQIREHGYKSGLLSNPKSEFSNL 595

>Kwal_33.15561 s33 (1157299..1161192) [3894 bp, 1297 aa] {ON}
           YKL209C (STE6) - ABC transporter, glycoprotein,
           component of a-factor secretory pathway [contig 290]
           FULL
          Length = 1297

 Score =  153 bits (386), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 91/241 (37%), Positives = 135/241 (56%), Gaps = 3/241 (1%)

Query: 467 GEIEFKNVSFAYPTRPSNMIFKNLNFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPSSG 526
            +I F+NVSFAYP+R  + + KNLN K+  G    IVG SG GKST++ LL K Y+P SG
Sbjct: 358 AQISFENVSFAYPSRSKHPVIKNLNLKVPGGRFTFIVGKSGSGKSTISNLLLKLYRPCSG 417

Query: 527 EILIDGQNINDLNSKSLRRHIGLVQQEPILMSGTIRDNIVYGLTEMPTKDEIRQVAKQCF 586
            I ++  +I ++N + L R I LV+Q   L   +I++NI     E      + Q  +   
Sbjct: 418 LIKVNDVDIREINQQDLFRSITLVEQNSPLFEDSIKNNIQLTSDEHRDDGRLSQACQAAM 477

Query: 587 CHNFITRFQSSYDTVIGPHGTLLSGGQKQRIAIARALIKKPRILILDEATSALDVESEGA 646
               I       DT+IG  G  LSGG++QR+A+ARA ++   ILILDEA SA D   +  
Sbjct: 478 LEGVIRDLAKGLDTIIGSSGVDLSGGEQQRVALARAFVRDSPILILDEALSAQDRMHKDL 537

Query: 647 INYTFGQLMKKKEMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELWDDPTSELSQ 706
           +     +  +K   TI+ + H L+ I   ++ ++L  DG+V+E G+  +L  D TS+ S 
Sbjct: 538 LMEAI-RFWRKGRTTII-LTHELNDILE-DDFVLLMEDGNVIERGQKSDLLSDSTSKFSL 594

Query: 707 L 707
           L
Sbjct: 595 L 595

 Score =  147 bits (370), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 115/420 (27%), Positives = 199/420 (47%), Gaps = 17/420 (4%)

Query: 302  PPVILSASVFGKQISTTSRELQEATGHLTKVAEEQLSGIKTVQSFVAEQREINRYNFAIR 361
            P  +L + ++G  +       +     L     + +  +KT++    E +    Y     
Sbjct: 885  PMFVLFSGIYGGLLQNYEARYKTCIAELENELYKAIRCMKTIKCLQMENKVARSYEMLEV 944

Query: 362  DIFNIGKKAAVINAKFFSSTSAMGDLSFLTVLGFGSYLVLQNSLTIGDLTAFMMYTEYTG 421
                  +K A+      +S++A+  ++   +L FG  LV+    T G +   +    +T 
Sbjct: 945  TSKGAARKRAMGTGFGVASSNALTFITQSILLYFGMKLVITGEYTPGKMLETLTLLLFTI 1004

Query: 422  NSIFGLSTFYSEIMQGAGAASRLFEL--TDRVPSISTTKG-----VKYKPGNGEIEFKNV 474
             +   L +   EI +G  AA+ LF+L   +     S  K      +K       I  K++
Sbjct: 1005 MTCMTLMSQVPEISRGQRAATYLFKLFGNEHEEGASVLKERHAPIIKTCSKQTLISIKHL 1064

Query: 475  SFAYPTRPSNMIFKNLNFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPSSGEILIDGQN 534
             F+Y    + M++KNL+ K++ G  V ++G SG GKST+  LL + Y   +G I IDG +
Sbjct: 1065 KFSYSNINNPMVYKNLSLKVDRGEIVGLIGTSGSGKSTLWSLLTRLYPVENGSISIDGTD 1124

Query: 535  INDLNSKSLRRHIGLVQQEPILMSGTIRDNIVYGLTEMPTKDEIRQVAKQCFCHNFITRF 594
            IN  + K+LR  I +V+Q+P+  SG+I +N+ YGL    + +E+ ++        F+   
Sbjct: 1125 INQWDRKALRSCIAVVEQKPLFFSGSIIENLTYGLMRKVSDEEVNELLLTLGMLEFVNST 1184

Query: 595  QSSYDTVIGPHGTLLSGGQKQRIAIARALIKKPRILILDEATSALDVESEGAINYTFGQL 654
                 +VI     LLSGGQ QR+AI RAL++KP++L+LDE TSALD       ++   + 
Sbjct: 1185 PKRLHSVIDTQ--LLSGGQVQRLAIVRALLRKPQLLVLDECTSALDARH----SFIMSEF 1238

Query: 655  MKKK--EMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELWDDPTSELSQLLNEKS 712
            +K      T + + H    +R    ++   + G +VE G    L++    EL ++L   S
Sbjct: 1239 VKHHLYHTTTLVVTHSEQMMRSCHRILTF-NKGEIVEEGSIDNLFNQK-GELYRILTCNS 1296

>Ecym_4265 Chr4 (560254..564771) [4518 bp, 1505 aa] {ON} similar to
            Ashbya gossypii AGR047W
          Length = 1505

 Score =  151 bits (382), Expect = 9e-37,   Method: Compositional matrix adjust.
 Identities = 143/505 (28%), Positives = 226/505 (44%), Gaps = 37/505 (7%)

Query: 224  ARLRATVIKKTIHQDAEFFDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGSVGI 283
            ARL   + K  +     FF+T  VG +++R  +D Y V   + +  S  F  +      +
Sbjct: 1015 ARLHDAMAKAVLRAPMSFFETTPVGRILNRFSNDIYKVDELLGRSFSQFFIHV----TKV 1070

Query: 284  GMMXXXXXXXXXXXXVFTPPVILSASVFGKQISTTSRELQEATGHLTKVA-----EEQLS 338
                            F  P+ +    + +    TSREL+     +TK       +E L+
Sbjct: 1071 VFTMIVICSITWQFIFFILPLSVLYLFYQQYYLRTSRELRR-LASVTKSPVYAHFQETLT 1129

Query: 339  GIKTVQSFVAEQR-------EINRYNFAIRDIFNIGKKAAVINAKFFSSTSAMGDLSFLT 391
            G+ TV+SF  + R        IN Y  A     N  +  A            MG +  L 
Sbjct: 1130 GVTTVRSFKKQDRFIHINQSRINTYMCAYYLSINANRWLAF-------RLEFMGSIVILA 1182

Query: 392  VLGFGSYLVLQNSLTIGDLTAFMMYTEYTGNSIFGLSTFYSEIMQGAGAASRLFELTDRV 451
                  + + Q  LT G L   + Y      S+  +     E+     +  R+ E TD  
Sbjct: 1183 AAVLSVFRLKQGKLTAGMLGLGLSYALQITQSLNWIVRMTVEVETNIVSVERIKEYTDLK 1242

Query: 452  PS----ISTTKGVKYKPGNGEIEFKNVSFAYPTRPS-NMIFKNLNFKIEAGSNVCIVGPS 506
            P     I T++  K  P NG+I+F++ S  Y  RP  ++I +++N  I     V IVG +
Sbjct: 1243 PEAPMIIPTSRPPKNWPANGDIKFEHFSTRY--RPELDLILEDINLHIHPREKVGIVGRT 1300

Query: 507  GRGKSTVALLLEKYYKPSSGEILIDGQNINDLNSKSLRRHIGLVQQEPILMSGTIRDNIV 566
            G GKS++ + L +  + ++G ILID   I+ +    LR  + ++ Q+  +  GT R+NI 
Sbjct: 1301 GAGKSSLTVSLFRLIEAAAGRILIDDLPIDSIGLNDLRSSLSIIPQDSEVFEGTFRENI- 1359

Query: 567  YGLTEMPTKDEIRQVAKQCFC-HNFITRFQSSYDTVIGPHGTLLSGGQKQRIAIARALIK 625
                   T DEI    +      + +T      +T +   G+ LS GQ+Q + +ARAL+ 
Sbjct: 1360 -DPCNKFTDDEIWNALELAHLKQHVMTLGTEGLNTSLKEGGSNLSVGQRQLMCLARALLV 1418

Query: 626  KPRILILDEATSALDVESEGAINYTFGQLMKKKEMTIVSIAHRLSTIRRSENVIVLGHDG 685
              +IL+LDEAT+A+DVE++  I  T     K +  TI++IAHRL+TI  S+ ++VL   G
Sbjct: 1419 PSKILVLDEATAAIDVETDKLIQRTIRTAFKDR--TILTIAHRLNTIMDSDKIVVLDK-G 1475

Query: 686  SVVEMGKFKELWDDPTSELSQLLNE 710
             + E      L  D TS    L NE
Sbjct: 1476 RIAEFDTPCNLLKDETSIFYSLCNE 1500

 Score = 77.4 bits (189), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 62/240 (25%), Positives = 111/240 (46%), Gaps = 22/240 (9%)

Query: 473 NVSFAYPTRPSNMI-FKNLNFKIEAGSNVCIVGPSGRGKSTV--ALLLEKYYKPSSGEIL 529
           + ++ +  +P   +  KN+NF+   G   CIVG  G GKS +  A+L             
Sbjct: 619 DATYLWQRQPEYKVALKNINFQARKGELSCIVGKVGTGKSALIQAML------------- 665

Query: 530 IDGQNINDLNSKSLRRHIGLVQQEPILMSGTIRDNIVYGLTEMPTKDEIRQVAKQCFCHN 589
             G       S +L   +  V Q   +M+GTI+DNI++G       +   +  K C    
Sbjct: 666 --GDLFRVKGSATLHGSVAYVSQVSWIMNGTIKDNILFGYKY--DAEFYEKTIKACALSL 721

Query: 590 FITRFQSSYDTVIGPHGTLLSGGQKQRIAIARALIKKPRILILDEATSALDVE-SEGAIN 648
            +        T +G  G  LSGGQK R+A+ARA+  K  +  LD+  +A+D   S+  + 
Sbjct: 722 DLNTLPDGDQTFVGERGISLSGGQKARLALARAVYAKADVYFLDDPLAAVDEHVSKHLVK 781

Query: 649 YTFGQLMKKKEMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELWDDPTSELSQLL 708
           Y  G     K  T +   +++  +  ++++ +L  +G +V+ G + ++  +  S L +L+
Sbjct: 782 YVIGPTGLLKTKTRILTTNKIHVLSVADSITLLD-NGVIVQQGSYDQVNSNKDSPLFKLI 840

>TPHA0C00960 Chr3 (204061..208632) [4572 bp, 1523 aa] {ON} Anc_8.303
            YDR135C
          Length = 1523

 Score =  147 bits (370), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 137/495 (27%), Positives = 223/495 (45%), Gaps = 41/495 (8%)

Query: 225  RLRATVIKKTIHQDAEFFDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGSVGIG 284
            +L +++          FF+T  +G +++R  +D Y +   + +  S  F+     ++ + 
Sbjct: 1018 QLHSSMTSSIFRAPMSFFETTPIGRILNRFSNDVYKIDEILGRSFSQFFQ----NTIRVS 1073

Query: 285  MMXXXXXXXXXXXXVFTPPVILSASVFGKQISTTSRELQE----ATGHLTKVAEEQLSGI 340
                              P+      + +    TSREL+         L    +E L G+
Sbjct: 1074 FTIVVICSTTWQFIFLIIPMAFLYIYYQQYFLRTSRELRRLDSTTRSPLYAHFQETLCGV 1133

Query: 341  KTVQSFVAEQREINRYNFAIRDIFNIGKKAAVINAKFFSS--TSAMGDLSFLTVLGFGSY 398
             T++ F  + R I+     +    N+      IN+  + +     +G L  L       +
Sbjct: 1134 STIRGFAQQDRFIHINQSRVDS--NMMAYYPSINSNRWLAFRLEFLGSLIILGAATLSIF 1191

Query: 399  LVLQNSLTIGDLTAFMMYTEYTGNSIFGLSTFYSEIMQGAGAASRLFELTDRVPS----- 453
             +   SLT G +   M Y      S+  +     ++     +  R+ E +  +PS     
Sbjct: 1192 RLKNGSLTAGMIGLSMSYALQVTQSLNWIVRMTVDVESNIVSVERIEEYS-HLPSEAPLI 1250

Query: 454  ISTTKGVKYKPGNGEIEFKNVSFAYPTRPS-NMIFKNLNFKIEAGSNVCIVGPSGRGKST 512
            I   +  +  P  G IEFKN S  Y  RP  +++ KN+N KI     V IVG +G GKS+
Sbjct: 1251 IENNRPSEEWPSKGAIEFKNYSTRY--RPELDLVLKNINLKILPKEKVGIVGRTGAGKSS 1308

Query: 513  VALLLEKYYKPSSGEILIDGQNINDLNSKSLRRHIGLVQQEPILMSGTIRDNIVYGLTEM 572
            + L L +  + SSG I IDG NIN+L    LR  + ++ Q+  +  G+IR+NI    T+ 
Sbjct: 1309 LTLALFRIIEASSGSIEIDGVNINELGLYDLRHKLSIIPQDSQVFEGSIRENI--DPTQQ 1366

Query: 573  PTKDEIRQVAKQCFCHNFITRF-------------QSS--YDTVIGPHGTLLSGGQKQRI 617
             ++ EI    +       I +              QSS   D  I   G+ LS GQ+Q I
Sbjct: 1367 FSEQEIWNALEMAHLKPHILKMNEISPESENSDTNQSSNPLDAKITEGGSNLSVGQRQLI 1426

Query: 618  AIARALIKKPRILILDEATSALDVESEGAINYTFGQLMKKKEMTIVSIAHRLSTIRRSEN 677
             +ARAL+    +LILDEAT+A+DVE++  I +T     K +  TI++IAHR++TI  S+ 
Sbjct: 1427 CLARALLVPSNVLILDEATAAVDVETDELIQHTIRTAFKDR--TILTIAHRINTIMDSDK 1484

Query: 678  VIVLGHDGSVVEMGK 692
            +IVL  +G V E  K
Sbjct: 1485 IIVLD-NGEVAEFDK 1498

 Score = 85.1 bits (209), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 74/286 (25%), Positives = 135/286 (47%), Gaps = 24/286 (8%)

Query: 432 SEIMQGAGAASRLFE-LTDRVPSISTTKGVKYKPGNGEIEFK---NVSFAYPTRPSNMI- 486
           S  ++ + + SRL+  LT+        + + +   NGE   K   N +F +  +P   + 
Sbjct: 574 SAFIEASVSISRLYSYLTNEELQKDAIQRLPFVKQNGETTVKIGDNATFLWKRKPEYKVA 633

Query: 487 FKNLNFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPSSGEIL-IDGQNINDLNSKSLRR 545
            KN+NF+   G   CIVG  G GKS        + +   G++  + G         S+  
Sbjct: 634 LKNINFEARKGELACIVGKVGSGKSA-------FIQSILGDLFRVKG-------FASIHG 679

Query: 546 HIGLVQQEPILMSGTIRDNIVYGLTEMPTKDEIRQVAKQCFCHNFITRFQSSYDTVIGPH 605
           ++  V Q   +M+GT++DNI++G    P   E  +  K C     ++       T++G  
Sbjct: 680 NVAYVSQLAWIMNGTVKDNIIFGHRYDPEFYE--KTIKACALTIDLSILPDGDQTLVGEK 737

Query: 606 GTLLSGGQKQRIAIARALIKKPRILILDEATSALDVE-SEGAINYTFGQLMKKKEMTIVS 664
           G  LSGGQK R+++ARA+  +  I +LD+  +A+D   S+  I    G     K  T + 
Sbjct: 738 GISLSGGQKARLSLARAVYARADIYLLDDPLAAVDEHVSKHLIQNVLGAKGLLKSKTRIL 797

Query: 665 IAHRLSTIRRSENVIVLGHDGSVVEMGKFKELWDDPTSELSQLLNE 710
             +++  +  ++++ +L  +G + E G + ++     S LS+L+ E
Sbjct: 798 TTNKIPVLSIADSITLL-ENGEITEQGTYFDVMATEGSSLSKLITE 842

>NDAI0B00640 Chr2 (141258..145733) [4476 bp, 1491 aa] {ON} Anc_5.10
          Length = 1491

 Score =  144 bits (362), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 131/519 (25%), Positives = 246/519 (47%), Gaps = 46/519 (8%)

Query: 214  LLRVLSERLVARLRATVIKKTIHQDAEFFDTHKVGDLISRLGSDAYVVSRSMTQKVSDGF 273
            LL  +  R    L    + + +H    + DT  +G +++R   D    + S+  ++++  
Sbjct: 972  LLCAIGIRASKWLNLKAVHRILHTPMSYLDTTPLGRILNRFTKD----TDSLDNELTESI 1027

Query: 274  KALICGSVGIGMMXXXXXXXXXXXXVFTPPVILSASVFGKQISTTSRELQEATG----HL 329
            + ++  +  I  +            +  P + +  ++      +T RE++         +
Sbjct: 1028 RLMLFQTANIVGVCVMCIIYLPWFAIAIPFLFIGFTLITDHYQSTGREVKRLEAIQRSFV 1087

Query: 330  TKVAEEQLSGIKTVQSFVAEQREINRYNFAIRDIFNIGKKAAVIN--AKFFSSTSAMGDL 387
                 E L G+ T++S+ +E+R + + ++ I  +   G  +  +      F    A+   
Sbjct: 1088 YNNFNEILGGMDTIKSYGSEERFLAKSDYLINKMNEAGYLSVALQRWVAIFLDLVAVCFA 1147

Query: 388  SFLTVLGFGSYLVLQNSLTIGDLTAFMMYTEYTGNSIFGLSTFYSEIMQGA----GAASR 443
              +T+L       + +++++G L  +++      N +    T     M  A      A+ 
Sbjct: 1148 LIITLLCVTRAFHI-SAVSVGVLLTYVLQLPGLLNGVLRALTQTENDMNSAERLVSYATE 1206

Query: 444  L-FELTDRVPSISTTKGVKYKPGNGEIEFKNVSFAY-PTRPSNMIFKNLNFKIEAGSNVC 501
            L  E   R P +S  +     P  G+IEFK+V F+Y P  P  ++ K+L+  I++G  + 
Sbjct: 1207 LPLEAAYRRPEVSPPENW---PSEGKIEFKHVDFSYRPGLP--IVLKDLDLDIKSGEKIG 1261

Query: 502  IVGPSGRGKSTVALLLEKYYKPSSGEILIDGQNINDLNSKSLRRHIGLVQQEPILMSGTI 561
            I G +G GKST+   L +  + S GEILID  +I+ L    LRR + ++ Q+P+L  GTI
Sbjct: 1262 ICGRTGAGKSTIMSALYRLNEISQGEILIDNVDISKLGLYDLRRKLAIIPQDPVLFRGTI 1321

Query: 562  R----------DNIVY------GLTEMPTKDEIR-QVAKQCFCHNFITRFQSSYDTVIGP 604
            R          D++++      G  E    ++I+ Q   +   H  + +F    D ++  
Sbjct: 1322 RKNLDPFNEHDDDLLWDSLVRGGAIERAALNKIKNQKVDKDGTHADMFKFH--LDQLVEE 1379

Query: 605  HGTLLSGGQKQRIAIARALIKKPRILILDEATSALDVESEGAINYTFGQLMKK-KEMTIV 663
             G   S G++Q +A+ RAL+++ ++LILDEATS++D E++G I     +++K+  + TI+
Sbjct: 1380 EGANFSLGERQLLALTRALVRQAKVLILDEATSSVDYETDGKIQ---ARIVKEFGDCTIL 1436

Query: 664  SIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELWDDPTS 702
             IAHRL+TI   + ++VL   G V E  K K L+D   S
Sbjct: 1437 CIAHRLNTILNYDRILVL-EKGEVAEFEKPKVLFDQEDS 1474

 Score = 86.7 bits (213), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 65/206 (31%), Positives = 102/206 (49%), Gaps = 20/206 (9%)

Query: 487 FKNLNFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPSSGEILIDGQNINDLNSKSLRRH 546
           F ++   I+ G  + +VGP G GK++    L  +   + G I ++G    DL        
Sbjct: 627 FHDITLDIKKGEFIIMVGPIGTGKTSFLNALAGFMNKTEGRIQVNG----DL-------- 674

Query: 547 IGLVQQEPILMSGTIRDNIVYGLTEMPTKDEIRQVAKQCFCHNFITRFQSSYDTVIGPHG 606
             L+   P + + T+RDNI++G      K +  +V + C     +    +   T IG  G
Sbjct: 675 --LLCGYPWIQNATVRDNILFG--SPYDKKKYEEVLRCCSLEADLDILPAGDSTEIGERG 730

Query: 607 TLLSGGQKQRIAIARALIKKPRILILDEATSALDVE-SEGAINYTFGQLMKKKEMTIVSI 665
             LSGGQK RI +AR + KK  I + D+  SA+D    +  ++  F  L+K +  T +  
Sbjct: 731 ITLSGGQKARINLARCVYKKKDIYLFDDVLSAVDSRVGKHIMDECFLGLLKNE--TRILA 788

Query: 666 AHRLSTIRRSENVIVLGHDGSVVEMG 691
            H+LS + R+  VIVLG DGS  E+G
Sbjct: 789 THQLSLLERASRVIVLGTDGS-FEIG 813

>CAGL0E03982g Chr5 (378442..383421) [4980 bp, 1659 aa] {ON} similar to
            uniprot|P32386 Saccharomyces cerevisiae YLL048c YBT1
            yeast bile transporter
          Length = 1659

 Score =  143 bits (361), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 142/530 (26%), Positives = 237/530 (44%), Gaps = 77/530 (14%)

Query: 225  RLRATVIKKTIHQDAEFFDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALI-CGSVGI 283
            R+   ++ K +H    F D+  +G +++R   D   V + +T  +   F  L+ C S  I
Sbjct: 1141 RIFKKLLSKVLHSRLRFIDSTPIGRIMNRFSKDIEAVDQELTPFLEAAFFCLVQCISTII 1200

Query: 284  GMMXXXXXXXXXXXXVFTPPVILSASVF--------GKQISTTSRELQE----ATGHLTK 331
             +              F  P  L  +V         G     TSREL+         + +
Sbjct: 1201 LI-------------TFITPQFLFVAVLVCVLYYLVGYFYINTSRELKRIESITKSPIYQ 1247

Query: 332  VAEEQLSGIKTVQSFVAEQREINRYNFAIRDIFNIGKKAAVINAKFFSSTSAMGDLSF-- 389
               E L+G+ T+++F  E R      F + ++  I +     N  FF    A   L+F  
Sbjct: 1248 HFSETLTGVATIRAFGDEIR------FIMHNLEKIDEN----NKPFFYLWVANRWLAFRI 1297

Query: 390  -----LTVLGFGSYLVLQ-NSLTIG----DLTAFMMYTEYTGNSIFGLSTFYSEIMQGAG 439
                 L + G G +++L  N +  G     LT  + +TE        L  FYS +     
Sbjct: 1298 DMIGALIIFGSGVFILLNLNRIDSGMAGISLTYAISFTE----GALWLVRFYSTVEMNMN 1353

Query: 440  AASRLFELTDRVPSISTTKGV----KYKPGNGEIEFKNVSFAYPTRPSNMIFKNLNFKIE 495
            +  RL E  D VP     +G        P  G+IE K++S  Y      +I K ++F IE
Sbjct: 1354 SVERLKEYMD-VPQEPYNEGTITTSTNWPTEGKIEVKDLSLRYAENLPRVI-KEVSFDIE 1411

Query: 496  AGSNVCIVGPSGRGKSTVALLLEKYYKPSSGEILIDGQNINDLNSKSLRRHIGLVQQEPI 555
              + V IVG +G GKST+   L ++ +P +G I IDG +I  ++ ++LRR I ++ Q+P 
Sbjct: 1412 PHNMVGIVGRTGAGKSTIITALFRFLEPETGSIKIDGIDITSIDLQTLRRSITIIPQDPT 1471

Query: 556  LMSGTIRDNI-------------VYGLTEMPTKDEI--RQVAKQCFCHNFITRFQSSYDT 600
            L +GTIR N+             V     +   DE+  +         + + +F +  + 
Sbjct: 1472 LFTGTIRSNLDPFGKYPDEEIFRVLHRVNLIDDDEMTAQSSDNNSLSSDNVNKFLN-LEN 1530

Query: 601  VIGPHGTLLSGGQKQRIAIARALIKKPRILILDEATSALDVESEGAINYTFGQLMKKKEM 660
             I   G  LS GQKQ + +ARAL++ P++++LDEAT+++D  S+  I  T   +  K   
Sbjct: 1531 EITEGGNNLSQGQKQLMCLARALLRNPKVILLDEATASIDYASDAKIQQTIRNVFDKS-- 1588

Query: 661  TIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELWDDPTSELSQLLNE 710
            T+++IAHRL ++   + ++V+   G V+E  +   L  D  S    +  +
Sbjct: 1589 TVLTIAHRLRSVIDYDKILVMDA-GEVIEYDQPYTLLLDKNSHFYSMCEQ 1637

 Score =  101 bits (252), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 76/283 (26%), Positives = 133/283 (46%), Gaps = 17/283 (6%)

Query: 427 LSTFYSEIMQGAGAASRLFELTDRVPSISTTKGVKYKPGNGEIEFKNVSFAYPTRPSNMI 486
           LS   S ++Q   +  R+    D          +K  P   ++ F+N + A+     +  
Sbjct: 672 LSNMLSYVIQSKVSLDRVQNFLDE-EDTQKYNQLKVAPDGNKLAFENATIAWSNNNQDFK 730

Query: 487 FKNLNFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPSSGEILI---DGQNINDLNSKSL 543
            K+L+   + G    ++GP+G GK+++ L L    +  SG I++   D ++   ++S  +
Sbjct: 731 LKDLDINFKIGKLNVVIGPTGSGKTSLLLALLGEMQLLSGRIVVPSLDARHEMLIDSDGM 790

Query: 544 RRHIGLVQQEPILMSGTIRDNIVYGLTEMPTKDEIRQVAKQCFCHNFITRFQSSYDTVIG 603
              I    Q   L++ T+R+NI++       +D  ++V   C        F +   T IG
Sbjct: 791 TNSIAYCSQSAWLLNDTVRNNILF--YSPYNEDRYKEVIIACGLKRDFELFDAGDQTEIG 848

Query: 604 PHGTLLSGGQKQRIAIARALIKKPRILILDEATSALDVESEGAI--NYTFGQLMKKKEMT 661
             G  LSGGQKQRI++ARAL    R L+LD+  SA+D  +   I  N   G LM+ +  T
Sbjct: 849 EKGITLSGGQKQRISLARALYSNCRHLLLDDCLSAVDSHTAAWIYDNCITGPLMEGR--T 906

Query: 662 IVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELWDDPTSEL 704
            V ++H ++   ++  ++V+  +G +   G       DP S L
Sbjct: 907 CVLVSHNIALTLKNAELVVMLENGRITNRG-------DPISLL 942

>YHL035C Chr8 complement(27978..32756) [4779 bp, 1592 aa] {ON}
            VMR1Vacuolar membrane protein involved in multiple drug
            resistance and metal sensitivity; ATP-binding cassette
            (ABC) family member involved in drug transport; potential
            Cdc28p substrate; induced under respiratory conditions
          Length = 1592

 Score =  143 bits (361), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 144/511 (28%), Positives = 235/511 (45%), Gaps = 77/511 (15%)

Query: 235  IHQDAEFFDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALI-CGSVGIGMMXXXXXXX 293
            +H    FFD   VG +++R   D   V + +   +      LI C S+   +        
Sbjct: 1083 LHAQIRFFDVTPVGRIMNRFSKDIEGVDQELIPYLEVTIFCLIQCASIIFLITVITPRFL 1142

Query: 294  XXXXXVFTPPVILSASVFGKQISTTSRELQEATGHLTKVA-----EEQLSGIKTVQSFVA 348
                 VF     +     GK   T SREL+     +TK        E L G+ T+++F  
Sbjct: 1143 TVAVIVFVLYFFV-----GKWYLTASRELKRLDS-ITKSPIFQHFSETLVGVCTIRAFGD 1196

Query: 349  EQREI----NRYNFAIRDIFNIGKKAAVINAKFFSSTSAMGDLSFLTVLGFGSYLVLQ-- 402
            E+R I    N+ +   R  F +      +  K+FS    M  +    VL  GS+++L   
Sbjct: 1197 ERRFILENMNKIDQNNRAFFYLS-----VTVKWFSFRVDM--IGAFIVLASGSFILLNIA 1249

Query: 403  ---NSLTIGDLTAFMMYTEYTGNSIFGLSTFYSEIMQGAGAASRLFELTDRVPSISTTKG 459
               + L    LT  +++T+        L   YS       +  RL E +    SI     
Sbjct: 1250 NIDSGLAGISLTYAILFTD----GALWLVRLYSTFEMNMNSVERLKEYS----SIEQENY 1301

Query: 460  VKYK------------PGNGEIEFKNVSFAY-PTRPSNMIFKNLNFKIEAGSNVCIVGPS 506
            + +             P +GEIE +N+S  Y P  P   + +N++FK++  S + IVG +
Sbjct: 1302 LGHDEGRILLLNEPSWPKDGEIEIENLSLRYAPNLPP--VIRNVSFKVDPQSKIGIVGRT 1359

Query: 507  GRGKSTVALLLEKYYKPSSGEILIDGQNINDLNSKSLRRHIGLVQQEPILMSGTIRDNIV 566
            G GKST+   L +  +P +G I IDGQ+I+ ++  +LRR I ++ Q+PIL +GTI+ N+ 
Sbjct: 1360 GAGKSTIITALFRLLEPITGCIKIDGQDISKIDLVTLRRSITIIPQDPILFAGTIKSNV- 1418

Query: 567  YGLTEMPTKDEIRQVAKQCFCHNFIT------------RFQSSYDTVIGPH------GTL 608
                     DE +++ K     N I+            RF S+++  +  H      G  
Sbjct: 1419 ---DPYDEYDE-KKIFKALSQVNLISSHEFEEVLNSEERFNSTHNKFLNLHTEIAEGGLN 1474

Query: 609  LSGGQKQRIAIARALIKKPRILILDEATSALDVESEGAINYTFGQLMKKKEMTIVSIAHR 668
            LS G++Q + IAR+L+++P+I++LDEATS++D +S+  I         K   TI++IAHR
Sbjct: 1475 LSQGERQLLFIARSLLREPKIILLDEATSSIDYDSDHLIQGIIRSEFNKS--TILTIAHR 1532

Query: 669  LSTIRRSENVIVLGHDGSVVEMGKFKELWDD 699
            L ++   + +IV+   G V E  +  EL  D
Sbjct: 1533 LRSVIDYDRIIVMDA-GEVKEYDRPSELLKD 1562

 Score = 90.1 bits (222), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 106/411 (25%), Positives = 180/411 (43%), Gaps = 28/411 (6%)

Query: 299 VFTPPVILSASVFGKQISTTSRELQEATGHLTKVAEEQLSGIKTVQSFVAEQREINRYNF 358
           V  P   L A++ GK      ++  + T        E L  I+ V+ F  E+  IN    
Sbjct: 500 VMFPLNFLLANLLGK----FQKQTLKCTDQRISKLNECLQNIRIVKYFAWERNIINEIK- 554

Query: 359 AIR--DIFNIGKKAAVINAK---FFSSTSAMGDLSFLTVLGFGSYLVLQNSLTIGDLTAF 413
           +IR  ++ ++ KK+ V +     +F + + +  ++F  +  F  +  L   L    L+ F
Sbjct: 555 SIRQKELRSLLKKSLVWSVTSFLWFVTPTLVTGVTF-AICTFVQHEDLNAPLAFTTLSLF 613

Query: 414 MMYTEYTGNSIFGLSTFYSEIMQGAGAASRLFELTDRVPSISTTKGVKYKPGNGEIEFKN 473
            +        +  LS   S I Q   +  R+ +   R+        +   P   +IEFKN
Sbjct: 614 TLLK----TPLDQLSNMLSFINQSKVSLKRISDFL-RMDDTEKYNQLTISPDKNKIEFKN 668

Query: 474 VSFAYPTRPSNM-IFK--NLNFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPSSGEILI 530
            +  +    S+M  FK   LN K + G    I+G +G GKS + L L       SG I++
Sbjct: 669 ATLTWNENDSDMNAFKLCGLNIKFQIGKLNLILGSTGSGKSALLLGLLGELNLISGSIIV 728

Query: 531 DG-QNINDL--NSKSLRRHIGLVQQEPILMSGTIRDNIVYGLTEMPTKDEIRQVAKQCFC 587
              +  +DL  + + L        Q   L++ T+++NI++       +D   +V   C  
Sbjct: 729 PSLEPKHDLIPDCEGLTNSFAYCSQSAWLLNDTVKNNIIFD--NFYNEDRYNKVIDACGL 786

Query: 588 HNFITRFQSSYDTVIGPHGTLLSGGQKQRIAIARALIKKPRILILDEATSALDVESEGAI 647
              +    +   T IG  G  LSGGQKQRI++ARA+    + ++LD+  SA+D  +   I
Sbjct: 787 KRDLEILPAGDLTEIGEKGITLSGGQKQRISLARAVYSSAKHVLLDDCLSAVDSHTAVWI 846

Query: 648 --NYTFGQLMKKKEMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKEL 696
             N   G LMK +  T + + H +S   R+ +  ++  +G V   G   EL
Sbjct: 847 YENCITGPLMKNR--TCILVTHNVSLTLRNAHFAIVLENGKVKNQGTITEL 895

>NCAS0C05930 Chr3 (1220180..1225153) [4974 bp, 1657 aa] {ON} Anc_4.6
          Length = 1657

 Score =  143 bits (360), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 142/539 (26%), Positives = 242/539 (44%), Gaps = 91/539 (16%)

Query: 213  ILLRVLSERLVARLRATVIKKTIHQDAEFFDTHKVGDLISRLGSDAYVVSRSMTQKVSDG 272
            +L  VL  R   ++  +++ +T+H    FFD   +G +++R   D   V + +T  +   
Sbjct: 1128 VLNFVLGIRASRKIFESLLYRTLHAKLGFFDATPIGRIMNRFSKDIESVDQELTPYLEAA 1187

Query: 273  FKALICGSVGIGMMXXXXXXXXXXXXVFTPPVILSASVF--------GKQISTTSRELQE 324
            F  L+     + ++             F  P  LS ++         G      SREL+ 
Sbjct: 1188 FFCLVQCIATMALI------------TFITPQFLSVAILVGCLYYLVGYFYMAASRELKR 1235

Query: 325  ----ATGHLTKVAEEQLSGIKTVQSFVAEQREINRYNFAIRDIFNIGKKAAVINAKFFSS 380
                +   + +   E L G+ T++++  E R      F + ++  I +     N  FF  
Sbjct: 1236 FESISKSPIYQHFSETLVGVATIRAYGDESR------FMLENLHKIDEN----NKPFFYL 1285

Query: 381  TSAMGDLSF-------LTVLGFGSYLVLQNSLTIGD------LTAFMMYTEYTGNSIFGL 427
                  LSF         + G G + +L N   I        LT  + +TE        L
Sbjct: 1286 WVFNRWLSFRIDMIGAFVIFGAGVF-ILTNIKNIDSGMAGISLTYAISFTE----GALWL 1340

Query: 428  STFYSEIMQGAGAASRLFELTDRVPSISTTKGVKYK--------PGNGEIEFKNVSFAY- 478
              FY+++     +  RL E  +    I      +YK        P NG+IE K++S  Y 
Sbjct: 1341 VRFYADVEMNMNSVERLKEYME----IEQEPYDEYKDTLLHDEWPSNGKIEVKDLSLRYA 1396

Query: 479  PTRPSNMIFKNLNFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPSSGEILIDGQNINDL 538
            P  P   + KN++F +E  + + IVG +G GKST+   + ++  P SG I ID  NI  +
Sbjct: 1397 PNLPK--VIKNVSFVVEPKTKIGIVGRTGAGKSTIITAMFRFLNPESGYIKIDDVNIASI 1454

Query: 539  NSKSLRRHIGLVQQEPILMSGTIR-----------DNIVYGL--TEMPTKDEIRQVAKQC 585
            N   LRR I ++ Q+P L +GTI+           D I   L    + T++E++    Q 
Sbjct: 1455 NLTKLRRSITIIPQDPTLFTGTIKLNLDPYNEFTDDAIFEALKRVNLVTEEELQNNGTQT 1514

Query: 586  FCHNFITRFQSSYDTVIGPHGTLLSGGQKQRIAIARALIKKPRILILDEATSALDVESEG 645
                   +F  + +  I   G+ LS GQ+Q + +AR+L++ P+I++LDEAT+++D  S+ 
Sbjct: 1515 GTSENANKFL-NLENEITEGGSNLSHGQRQLVCLARSLLRNPKIILLDEATASIDYASDA 1573

Query: 646  AINYTFGQLMKKKEMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELWDDPTSEL 704
             I  T  +  +  + TI++IAHRL ++   + +IV+       + G+ KE +D P S L
Sbjct: 1574 KIQETIRK--EFSQSTILTIAHRLRSVIDYDKIIVM-------DAGEVKE-YDHPYSLL 1622

 Score = 92.4 bits (228), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 96/370 (25%), Positives = 167/370 (45%), Gaps = 27/370 (7%)

Query: 335 EQLSGIKTVQSFVAEQREINRYNFAIRDIFNIGKKAAVINAK-----FFSSTSAMGDLSF 389
           E L  I+ ++ F  E       NF+ RDI  + +K   +  K      FSS       S 
Sbjct: 579 ETLQAIRIIKFFSWED------NFS-RDIKEVREKELHLLLKRSLIWAFSSFVWFVTPSI 631

Query: 390 LTVLGFGSYLVLQNSL--TIGDLTAFMMYTEYTGNSIFGLSTFYSEIMQGAGAASRLFEL 447
           +T   F  Y+ +Q  +  T    TA  ++T      +  LS   S ++Q   +  R+ + 
Sbjct: 632 VTSASFAFYIYVQGEVLTTPVAFTALSLFT-LLKTPLDQLSNMISFVIQSKVSLDRIQDF 690

Query: 448 TDRVPSISTTKGVKYKPGNGEIEFKNVSFAYPTRPSNMIFKNLNFKIEAGSNVCIVGPSG 507
                +    +    K GN  I FKNV+  +     +   ++LN + + G+   ++GP+G
Sbjct: 691 LGEQDTDKYNQLTIDKLGN-RIAFKNVTVTWDNGEEDFKLRDLNIEFKPGALNVVIGPTG 749

Query: 508 RGKSTVALLLEKYYKPSSGEILIDGQNIND---LNSKSLRRHIGLVQQEPILMSGTIRDN 564
            GK+++ L L        GEI++   N      ++   L   I    Q   L++ T+R+N
Sbjct: 750 SGKTSLLLALLGEMCLEKGEIIVPALNPRQDLVIDKFGLTNSIAYCSQAAWLLNETVRNN 809

Query: 565 IVYGLTEMPTKDE-IRQVAKQCFCHNFITRFQSSYDTVIGPHGTLLSGGQKQRIAIARAL 623
           I++     P  +E    V   C     +   ++S  T IG  G  LSGGQKQR+++ARAL
Sbjct: 810 ILFN---SPYNEERYNAVIDACGLRRDLKILKASDMTEIGEKGITLSGGQKQRVSLARAL 866

Query: 624 IKKPRILILDEATSALDVESEGAI--NYTFGQLMKKKEMTIVSIAHRLSTIRRSENVIVL 681
               + ++LD+  SA+D  +   I  N   G LM  +  T + ++H ++   ++  ++V+
Sbjct: 867 YSNSKHVLLDDCLSAVDSHTALWIYDNCITGPLMSGR--TCILVSHNIALTLKNAELVVI 924

Query: 682 GHDGSVVEMG 691
             +G V + G
Sbjct: 925 LENGRVKDQG 934

>NDAI0H00190 Chr8 complement(20586..25634) [5049 bp, 1682 aa] {ON}
            Anc_4.6
          Length = 1682

 Score =  142 bits (357), Expect = 8e-34,   Method: Compositional matrix adjust.
 Identities = 146/541 (26%), Positives = 240/541 (44%), Gaps = 100/541 (18%)

Query: 225  RLRATVIKKTIHQDAEFFDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALI-CGSVGI 283
            ++  +++   +H    FFD   +G +++R   D   V + +T  +   F  L+ C S  +
Sbjct: 1159 KIFKSLLHTVLHSKLRFFDATPIGRIMNRFSKDIEAVDQELTPYLEAAFYCLVECVSTML 1218

Query: 284  GMMXXXXXXXXXXXXVFTPPVILSASVF--------GKQISTTSRELQE----ATGHLTK 331
             +              F  P  L  ++F        G      SREL+         + +
Sbjct: 1219 LI-------------AFITPQFLILAIFIGFLYYLVGYFYMAASRELKRFESVTKSPIYQ 1265

Query: 332  VAEEQLSGIKTVQSFVAEQREINRYNFAIRDIFNIGKKAAVINAKFFSSTSAMGDLSF-- 389
               E L GI T++++  E+R      F + ++  I +     N  FF   +    LSF  
Sbjct: 1266 HFSETLVGIVTIRAYGDEKR------FMLENLHKIDEN----NKPFFYLWAFNRWLSFRI 1315

Query: 390  -----LTVLGFGSYLVLQ-NSLTIG----DLTAFMMYTEYTGNSIFGLSTFYSEIMQGAG 439
                 L V G G +++L  ++L  G     LT  + +TE    +   L  FY+++     
Sbjct: 1316 DMIGSLVVFGAGVFIILNIDNLDSGLAGISLTYAISFTE----AALWLVRFYADVEMNMN 1371

Query: 440  AASRLFELT--DRVP-----SISTTKGVKYKPGNGEIEFKNVSFAY-PTRPSNMIFKNLN 491
            +  RL E    D+ P       S    V   P NG+IE  N+S  Y P  P   + KN+ 
Sbjct: 1372 SVERLKEYMEIDQEPYEEHLERSEVLAVDNWPRNGKIEVNNLSLRYAPNLPK--VIKNVT 1429

Query: 492  FKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPSSGEILIDGQNINDLNSKSLRRHIGLVQ 551
            F +E    V +VG +G GKST+   L ++    +G I ID  +I  +N   LRR I ++ 
Sbjct: 1430 FVVEPNCKVGVVGRTGAGKSTIITALFRFLDAETGYIKIDDIDITTVNLTKLRRSITIIP 1489

Query: 552  QEPILMSGTIRDNIVYGLTEMPTKDEIRQVAKQCFCHNFITRFQSS-------------- 597
            Q+P L SGTIR N+        + D I +  ++    N I   +S+              
Sbjct: 1490 QDPTLFSGTIRSNL--DPYNEFSDDAIFKALRRV---NLINENESTGPASSETSPSSTEN 1544

Query: 598  ------YDTVIGPHGTLLSGGQKQRIAIARALIKKPRILILDEATSALDVESEGAINYTF 651
                      I   G  LS GQ+Q + +AR+L++ P+I++LDEAT+++D  S+  I  T 
Sbjct: 1545 VNKFLNLKNEITEGGNNLSHGQRQLVCLARSLLRCPKIILLDEATASIDNASDAKIQETI 1604

Query: 652  GQLMKKKEMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELWDDPTSELSQLLNEK 711
             +  + KE TI++IAHRL ++   + ++V+       + G+ KE +D P    S LLN+ 
Sbjct: 1605 RK--EFKESTILTIAHRLRSVCDYDKILVM-------DAGEVKE-YDHP---YSLLLNKN 1651

Query: 712  S 712
            S
Sbjct: 1652 S 1652

 Score = 98.2 bits (243), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 104/410 (25%), Positives = 182/410 (44%), Gaps = 41/410 (10%)

Query: 300 FTPPVILSASVFG----KQISTTSRELQEATGHLTKVAEEQLSGIKTVQSFVAEQREINR 355
           F P  +  A++ G    K ++ T + +Q+          E    I+ ++ F  E      
Sbjct: 568 FLPLNLKLATLLGEYQKKSLAVTDKRIQKLN--------ETFQAIRIIKYFSWED----- 614

Query: 356 YNFAIRDIFNIGKKAAVINAK-----FFSSTSAMGDLSFLTVLGFGSYLVLQNSLTIGDL 410
            NF  RDI  + +K   +  K      FSS       S +T   F  Y+ +Q   T+   
Sbjct: 615 -NFT-RDIETVREKELHLLFKRSLIWAFSSFIWFITPSIVTSCSFAFYIYVQGE-TLTTP 671

Query: 411 TAFMMYTEYT--GNSIFGLSTFYSEIMQGAGAASRLFELTDRVPSISTTKGVKYKPGNGE 468
            AF   + +T     +  LS   S ++Q   +  R+ +L     +   ++    K GN  
Sbjct: 672 VAFTALSLFTLLKTPLDQLSNMISFVIQSKVSLDRIQDLLQEKETEKYSQLTIDKNGN-R 730

Query: 469 IEFKNVSFAYPTRPSNMIFKNLNFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPSSGEI 528
           I F+N + A+  + S    ++LN   + G    ++GP+G GKS++ L L       +G I
Sbjct: 731 IAFQNATVAWDKKNSEFKLRDLNIDFKPGKLNVVIGPTGSGKSSLLLALLGEMHLENGNI 790

Query: 529 LIDGQNIND---LNSKSLRRHIGLVQQEPILMSGTIRDNIVYGLTEMPTKDEIR--QVAK 583
           ++   +  D   ++   +   I    Q   L++ T+R+NI++        +E R   V +
Sbjct: 791 IVPSLDPRDELVIDHDGMTNSIAYCSQGAWLLNDTVRNNILFN----SPYNEARYNAVVE 846

Query: 584 QCFCHNFITRFQSSYDTVIGPHGTLLSGGQKQRIAIARALIKKPRILILDEATSALDVES 643
            C         ++   T IG  G  LSGGQKQR+++ARAL    R ++LD+  SA+D  +
Sbjct: 847 ACCLKRDFEILKAGDMTEIGEKGITLSGGQKQRVSLARALYSNSRHVLLDDCLSAVDSHT 906

Query: 644 EGAI--NYTFGQLMKKKEMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMG 691
              I  N   G LM+ +  T + ++H ++   R+  ++V+  DG V + G
Sbjct: 907 ALWIYDNCITGPLMENR--TCILVSHNIALTLRNAELVVILEDGRVKDQG 954

>TBLA0G00710 Chr7 (157927..163002) [5076 bp, 1691 aa] {ON} Anc_4.6
            YHL035C
          Length = 1691

 Score =  142 bits (357), Expect = 9e-34,   Method: Compositional matrix adjust.
 Identities = 142/540 (26%), Positives = 247/540 (45%), Gaps = 99/540 (18%)

Query: 225  RLRATVIKKTIHQDAEFFDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALI-CGSVGI 283
            ++  +++K ++H    FFD+  +G +++R   D   V + +   +   F  L+ C S+ +
Sbjct: 1169 KMFNSLLKNSLHAKLRFFDSTPLGRIMNRFSKDIEAVDQEVPMYLGGTFACLVECFSIIV 1228

Query: 284  GMMXXXXXXXXXXXXVFTPPVILSASVF--------GKQISTTSRELQE----ATGHLTK 331
             +                 P  L  ++F        G    + SREL+         + +
Sbjct: 1229 LI-------------TLITPQFLGVAIFIAVFYWFVGAVYISGSRELKRFDSITKSPIYQ 1275

Query: 332  VAEEQLSGIKTVQSFVAEQREINRYNFAIRDIFNIGKKAAVINAKFFSSTSAMGDLSFLT 391
               E L+GI TV+++  E R      F   ++  I +     N  FF    +   LSF T
Sbjct: 1276 HFSETLAGITTVRAYGDESR------FMRENLEKIDEN----NKPFFYMWVSNRWLSFRT 1325

Query: 392  -------VLGFGSYLVLQ-NSLTIGDLTAFMMYTEYTGNSIFGLSTFYSEIMQGAGAASR 443
                   +LG G + +   N +  G     + Y     ++   L  FY +      +  R
Sbjct: 1326 QIIGAFVILGAGGFSIWNINKIDSGLAGISLTYALTFSDAALWLVRFYGDTEMNMNSTER 1385

Query: 444  LFELT--DRVP-SISTTKGVKYKPGNGEIEFKNVSFAY-PTRPSNMIFKNLNFKIEAGSN 499
            + E    D+ P +  T +     P NG+IE  +VS  Y P  P   + KN++F +++ S 
Sbjct: 1386 IQEYMNIDQEPYNEGTVEPPADWPENGKIEINDVSLRYAPNLPR--VIKNVSFTVDSKSK 1443

Query: 500  VCIVGPSGRGKSTVALLLEKYYKPSSGEILIDGQNINDLNSKSLRRHIGLVQQEPILMSG 559
            V IVG +G GKST+   L ++ +P +G I ID  +I  ++ + LRR I ++ Q+P L +G
Sbjct: 1444 VGIVGRTGAGKSTIITALFRFLEPETGNIKIDNIDIVSIDLQKLRRSISIIPQDPTLFTG 1503

Query: 560  TIRDNIVYGLTEMPTKDEIRQVAKQCFCHNFITRFQ-------SSYDTV----------- 601
            TIR N+     +  T+   +++     C N ++R +       SS DT            
Sbjct: 1504 TIRSNL-----DPYTQYSDKEIFDSLICVNLVSREELAQVQSPSSNDTSSIVSENFNHFL 1558

Query: 602  -----IGPHGTLLSGGQKQRIAIARALIKKPRILILDEATSALDVESEGAINYT----FG 652
                 +   G+ +S GQ+Q + +AR+L+ KP+I++LDEAT+++D ES+  I  T    FG
Sbjct: 1559 DLEYNVSEGGSNISQGQRQLLCLARSLLGKPKIILLDEATASIDYESDKKIQETIRNEFG 1618

Query: 653  QLMKKKEMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELWDDPTSELSQLLNEKS 712
                    TI++IAHRL ++   + ++V+       + G+ +E +D P    S LLN+ S
Sbjct: 1619 N------STILTIAHRLRSVIDYDKILVM-------DAGEVEE-YDHP---YSLLLNKNS 1661

 Score = 82.4 bits (202), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 83/336 (24%), Positives = 155/336 (46%), Gaps = 40/336 (11%)

Query: 388 SFLTVLGFGSYLVLQNSLTIGDLTAFMMYTEYTGNSIFGL--------STFYSEIMQGAG 439
           + +T L F  Y+ +Q      +LT+ + +T     S+F L        +   S ++Q   
Sbjct: 677 TIVTSLSFAYYIFIQKQ----ELTSPVAFTAL---SLFALLKIPLDQMANMLSYVVQSKV 729

Query: 440 AASRLFELTDRVPSISTTKGVKYKPGNGEIEFKNVSFAYPTRPSNMIFKNLNFKIEAGSN 499
           +  R+    D  P     + +       ++ FKN + ++     +   +NL+   + G  
Sbjct: 730 SLDRVQTFLDE-PDTKKYEQLTVPVEKNKLSFKNATMSWGNDNDSFKLRNLDIDFKIGQL 788

Query: 500 VCIVGPSGRGKSTVALLLEKYYKPSSGEILI---DGQNINDLNSKSLRRHIGLVQQEPIL 556
             ++GP+G GK+++ + L      + G+I I   D ++   + S      I    Q   L
Sbjct: 789 NVVIGPTGSGKTSLLMALLGEMTLTEGQINIPSLDPRHDLIIESDGHTNSIAYCSQAAWL 848

Query: 557 MSGTIRDNIVYGLTEMPTKDEIRQVA---KQCFCHNFITRFQSSYD-TVIGPHGTLLSGG 612
           ++ T+R+NI++       + +   VA   K+ F         ++ D T IG  G  LSGG
Sbjct: 849 LNDTVRNNILFNSPYNKDRYDAAIVAAGLKRDF------EILAAGDLTEIGERGITLSGG 902

Query: 613 QKQRIAIARALIKKPRILILDEATSALDVESEGAI--NYTFGQLMKKKEMTIVSIAHRLS 670
           QKQRI++ARAL    R ++LD+  SA+D  +   I  N   G LM+ +  T V ++H ++
Sbjct: 903 QKQRISLARALYSNARHVLLDDCLSAVDAHTAAWIYDNCISGPLMEGR--TCVLVSHNIA 960

Query: 671 TIRRSENVIVLGHDGSVVEMGKFKELWDDPTSELSQ 706
              ++ +++V+  +G V + G       DP + L++
Sbjct: 961 LTLKNASLVVMLKNGRVADQG-------DPVTLLNK 989

>NCAS0B03470 Chr2 complement(606008..610546) [4539 bp, 1512 aa] {ON}
            Anc_8.303
          Length = 1512

 Score =  140 bits (352), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 133/485 (27%), Positives = 229/485 (47%), Gaps = 31/485 (6%)

Query: 241  FFDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGSVGIGMMXXXXXXXXXXXXVF 300
            FF+T  +G +++R  +D Y V   + +  S  F      +V +                 
Sbjct: 1038 FFETTPIGRILNRFSNDVYKVDSVLGRTFSQFF----VNAVKVSFTIIVICFTTWQFIFI 1093

Query: 301  TPPVILSASVFGKQISTTSRELQEATGHLTKVA-----EEQLSGIKTVQSFVAEQR--EI 353
              P+ +    + +    TSREL+     +TK       +E L GI T++ +  + R   I
Sbjct: 1094 IIPLGVFYIYYQQYFLRTSRELRRLDS-ITKSPIFSHFQETLGGITTIRGYQQQHRFTHI 1152

Query: 354  NRYNFAIRDIFNIGKKAAVINAKFFSS--TSAMGDLSFLTVLGFGSYLVLQNSLTIGDLT 411
            N+     R   N+      +NA  + +     +G L  L       + + Q +LT G + 
Sbjct: 1153 NQ----CRVDNNMSAFYPSVNANRWLAYRLETIGSLIILGAATLSVFRLRQGTLTAGMVG 1208

Query: 412  AFMMYTEYTGNSIFGLSTFYSEIMQGAGAASRLFELTD---RVPS-ISTTKGVKYKPGNG 467
              + Y      S+  +     E+     +  R+ E +D     P+ I   +  +  P  G
Sbjct: 1209 LSLSYALQITQSLNWIVRMTVEVETNIVSVERIKEYSDLKSEAPAVIEDHRPAETWPDEG 1268

Query: 468  EIEFKNVSFAYPTRPS-NMIFKNLNFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPSSG 526
            +I+F++ S  Y  RP  ++I K++N  I+    V IVG +G GKS++ L L +  + SSG
Sbjct: 1269 DIKFEHYSTRY--RPELDLILKDINVHIKPKEKVGIVGRTGAGKSSLTLALFRIIEASSG 1326

Query: 527  EILIDGQNINDLNSKSLRRHIGLVQQEPILMSGTIRDNIVYGLTEMPTKDEIRQV-AKQC 585
             I+ID   IN++    LR  + ++ Q+  +  GT+R+NI    T   T ++I  V A   
Sbjct: 1327 RIVIDNVPINEIGLYDLRHKLSIIPQDSQVFEGTVRENI--DPTNEYTDEQIWNVLALSH 1384

Query: 586  FCHNFITRFQSSYDTVIGPHGTLLSGGQKQRIAIARALIKKPRILILDEATSALDVESEG 645
               + I+      +  +   G  LS GQ+Q + +ARAL+   +IL+LDEAT+A+DVE++ 
Sbjct: 1385 LKDHIISMGDEGLNNQLTEGGNNLSVGQRQLLCLARALLVPSKILLLDEATAAVDVETDK 1444

Query: 646  AINYTFGQLMKKKEMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELWDDPTSELS 705
             I  T     K +  TI++IAHR++TI  S+ +IVL  +G++ E    ++L ++P+S   
Sbjct: 1445 VIQETIRTAFKDR--TILTIAHRINTIMDSDRIIVLD-NGTIKEFDSPEKLLENPSSLFY 1501

Query: 706  QLLNE 710
             L  E
Sbjct: 1502 SLCQE 1506

 Score = 88.2 bits (217), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 93/416 (22%), Positives = 182/416 (43%), Gaps = 80/416 (19%)

Query: 330 TKVAEEQLSGIKTVQSFVAE-----QREINRYNFAIRDIFNIGKKAAVINAKFFSSTSAM 384
           T+V  E L+ IK+++ +  E     + E  R N  ++++  +G   A+++ +F       
Sbjct: 481 TRVISEMLNNIKSLKLYAWEVPYRQKLENVRNNKELKNLTKLGCYMALMSFQF------- 533

Query: 385 GDLSFL-TVLGFGSYLVLQNSLTIGDLTAFMMYTEYTGNSIFGLSTF--------YSEIM 435
             + FL +   F +++  +N     DL        +   ++F L  F         + I+
Sbjct: 534 NVVPFLVSCCTFAAFIYTENRPLTTDLV-------FPALTLFNLLHFPLMVIPNVLTMII 586

Query: 436 QGAGAASRLFEL----------TDRVPSISTTKGVKYKPGNGEIEFKNVSFAYPTRPSNM 485
           + + +  RLF              R+P ++    V    G+      + +F +  +P   
Sbjct: 587 ETSVSIGRLFSFLTNEELQKDAVQRLPKVTNIGDVAINVGD------DATFLWQRKPEYK 640

Query: 486 I-FKNLNFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPSSGEILIDGQNINDLNSKSLR 544
           +  KN+NF+ + G   CIVG  G GKS +              IL D   +      ++ 
Sbjct: 641 VALKNINFQAKKGELTCIVGKVGSGKSAMI-----------QSILGDLFRVKGF--ATIH 687

Query: 545 RHIGLVQQEPILMSGTIRDNIVYGLTEMPTKDEIRQVAKQCFCHNFITRFQSSYDTVIGP 604
            ++  V Q   +M+GT+++NI++G      +D  ++  K C     +        T++G 
Sbjct: 688 GNVAYVSQVAWIMNGTVKENILFG--HKYDEDFYQKTIKACALTIDLAVLMDGDQTLVGE 745

Query: 605 HGTLLSGGQKQRIAIARALIKKPRILILDEATSALD----------VESEGAINYTFGQL 654
            G  LSGGQK R+++ARA+  +    +LD+  +A+D          V     + +T  ++
Sbjct: 746 KGISLSGGQKARLSLARAVYSRADTYLLDDPLAAVDEHVARHLVEHVLGPNGLLHTKTKV 805

Query: 655 MKKKEMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELWDDPTSELSQLLNE 710
           +   +++++SIA  +S          L  +G +V+ G + E+  D +S LS+L+ E
Sbjct: 806 LATNKVSVLSIADSVS----------LLENGEIVQQGTYDEIMKDDSSPLSKLITE 851

>NDAI0J01150 Chr10 complement(262920..267473) [4554 bp, 1517 aa] {ON}
            Anc_8.303
          Length = 1517

 Score =  139 bits (350), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 134/493 (27%), Positives = 240/493 (48%), Gaps = 47/493 (9%)

Query: 241  FFDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGSVGIGMMXXXXXXXXXXXXVF 300
            FF+T  +G +++R  +D Y V   + +  S  F   +  S  IG++              
Sbjct: 1043 FFETTPIGRILNRFSNDIYKVDSVLGRTFSQFFVNAVKVSFTIGVICVTTWQFIFVIV-- 1100

Query: 301  TPPVILSASVFGKQISTTSRELQEATGHLTKVA-----EEQLSGIKTVQSFVAEQREINR 355
              P+ +    + +    TSREL+     +T+       +E L GI T++ +  +Q+  ++
Sbjct: 1101 --PLGVFYIYYQQYYLRTSRELRRLDS-ITRSPVYSHFQETLGGIVTIRGY-GQQKRFSQ 1156

Query: 356  YNFAIRDIFNIGKKAAVIN--AKFFSSTSAMGDLSF-------LTVLGFGSYLVL---QN 403
             N           +  V N  + F+ S +A   L++       + +LG  +  V+   Q 
Sbjct: 1157 IN-----------QCRVDNNMSAFYPSVNANRWLAYRLELIGSIIILGAATLSVMRLKQG 1205

Query: 404  SLTIGDLTAFMMYTEYTGNSIFGLSTFYSEIMQGAGAASRLFELTD---RVPSI-STTKG 459
            +LT G +   + Y      S+  +     E+     +  R+ E  D     P I    + 
Sbjct: 1206 TLTAGMVGLSLSYALQITQSLNWIVRMTVEVETNIVSVERIKEYADLKSEAPEIIEDHRP 1265

Query: 460  VKYKPGNGEIEFKNVSFAYPTRPS-NMIFKNLNFKIEAGSNVCIVGPSGRGKSTVALLLE 518
             +  P  G+I+F++ S  Y  RP  +++ K++NF I+    + IVG +G GKS++ L L 
Sbjct: 1266 QETWPEEGDIKFEHYSTRY--RPELDLVLKDINFHIKPKEKIGIVGRTGAGKSSLTLALF 1323

Query: 519  KYYKPSSGEILIDGQNINDLNSKSLRRHIGLVQQEPILMSGTIRDNIVYGLTEMPTKDEI 578
            +  + S G I+ID  +I+D+    LR  + ++ Q+  +  GTIR+NI    T   T ++I
Sbjct: 1324 RIIEASEGNIIIDNVDISDIGLYDLRHKLSIIPQDSQVFEGTIRENI--DPTNQYTDEQI 1381

Query: 579  RQVAKQCFCHNFI-TRFQSSYDTVIGPHGTLLSGGQKQRIAIARALIKKPRILILDEATS 637
             +V +     + I T      DT +   G+ LS GQ+Q + +ARAL+   +IL+LDEAT+
Sbjct: 1382 WRVLELSHLRDHIATMGGDGLDTKLNEGGSNLSVGQRQLMCLARALLVPSKILVLDEATA 1441

Query: 638  ALDVESEGAINYTFGQLMKKKEMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELW 697
            A+DVE++  +  T     K +  TI++IAHR++TI  ++ ++VL  +GS+ E  + K+L 
Sbjct: 1442 AVDVETDKVLQETIRTSFKDR--TILTIAHRINTIMDNDRIMVLD-NGSIKEFDEPKKLL 1498

Query: 698  DDPTSELSQLLNE 710
            ++ +S    L  E
Sbjct: 1499 ENKSSLFYSLCEE 1511

 Score = 82.0 bits (201), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 92/414 (22%), Positives = 182/414 (43%), Gaps = 48/414 (11%)

Query: 318 TSRELQEATGHL----TKVAEEQLSGIKTVQSFVAE-----QREINRYNFAIRDIFNIGK 368
           T ++LQ++        T+V  E L+ IK+++ +  E     + E  R N  ++++  +G 
Sbjct: 467 TQKKLQKSQMQFKDERTRVISEILNNIKSLKLYAWETPYKAKLENVRNNKELKNLTKLGC 526

Query: 369 KAAVINAKFFSSTSAMGDLSFLTVLGFGSYLVLQNSLTIGDLTAFMMYTEYTGNSIFGLS 428
             A+++ +F +    +   S   V  +     L   L    LT F +        +  + 
Sbjct: 527 YMALMSFQF-NVVPFLVSCSTFAVFVYTEDRPLTTDLVFPALTLFNL----LHFPLMVIP 581

Query: 429 TFYSEIMQGAGAASRLFEL----------TDRVPSISTTKGVKYKPGNGEIEFKNVSFAY 478
              + +++ + +  RLF              R+P ++    V    G+      + +F +
Sbjct: 582 NVLTALIECSVSVGRLFSFLTNEELQKDSVQRLPKVTEIGDVAINVGD------DATFLW 635

Query: 479 PTRPSNMI-FKNLNFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPSSGEILIDGQNIND 537
             +P   +  KN+NF+ + G   CIVG  G GKS +              IL D   +  
Sbjct: 636 QRKPEYKVALKNVNFQAKKGELTCIVGRVGSGKSALI-----------QSILGDLFRVKG 684

Query: 538 LNSKSLRRHIGLVQQEPILMSGTIRDNIVYGLTEMPTKDEIRQVAKQCFCHNFITRFQSS 597
               ++  ++  V Q   +M+GT++DNI++G       +   +  K C     ++     
Sbjct: 685 F--ATIHGNVAYVSQVAWIMNGTVKDNILFG--HKYDAEFYEKTIKACALTIDLSVLVDG 740

Query: 598 YDTVIGPHGTLLSGGQKQRIAIARALIKKPRILILDEATSALDVE-SEGAINYTFGQLMK 656
             T++G  G  LSGGQK R+++ARA+  +    +LD+  +A+D   +   I +  G    
Sbjct: 741 DQTLVGEKGISLSGGQKARLSLARAVYSRADTYLLDDPLAAVDEHVARHLIEHVLGPNGL 800

Query: 657 KKEMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELWDDPTSELSQLLNE 710
               T V   +++S +  +++V +L  +G +V+ G + E+  D  S+L++L+ E
Sbjct: 801 LHTKTKVLATNKVSVLSVADSVSLL-ENGEIVQQGSYDEIMKDGASQLNKLIME 853

>KNAG0E01120 Chr5 (214592..219745) [5154 bp, 1717 aa] {ON} Anc_4.6
            YHL035C
          Length = 1717

 Score =  139 bits (350), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 146/539 (27%), Positives = 235/539 (43%), Gaps = 95/539 (17%)

Query: 225  RLRATVIKKTIHQDAEFFDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALI-CGSVGI 283
            ++ A ++ K IH    FFDT  +G +++R   D   V + +T  ++  F + + C S  I
Sbjct: 1193 KIFAMLLNKVIHSKLRFFDTTPIGRIMNRFSKDIESVDQELTPYLTGAFYSFVECFSTII 1252

Query: 284  GMMXXXXXXXXXXXXVFTPPVILSASVF--GKQISTTSRELQE----ATGHLTKVAEEQL 337
                            F   +++S   +  G      SREL+         + +   E L
Sbjct: 1253 -------LISWITPQFFVVAILISIMYYLVGYFYMAGSRELKRLDSITKSPIYQHFSETL 1305

Query: 338  SGIKTVQSFVAEQREINRYNFAIRDIFNIGKKAAVINAKFFSSTSAMGDLSF-------L 390
             G+ T+++F  E R      F   ++F I +     N  FF    A   LSF        
Sbjct: 1306 VGVTTIRAFGDEMR------FLKENLFKIDEN----NKPFFYLWVANRWLSFRIDMIGSF 1355

Query: 391  TVLGFGSYLV-----LQNSLTIGDLTAFMMYTEYTGNSIFGLSTFYSEIMQGAGAASRL- 444
             V G G +++     + + +    LT  + +TE        L  FYSE+     +  R+ 
Sbjct: 1356 VVFGAGVFILADIKNIDSGMAGISLTYAISFTE----GALWLVRFYSEVEMNMNSVERIK 1411

Query: 445  ---------FELTDRVPSISTTKGVKYKPGNGEIEFKNVSFAYPTRPSNMIFKNLNFKIE 495
                     +++ D +     T      P  G+IE  ++S  Y      +I KN++F +E
Sbjct: 1412 EYMSVEQEPYDIKDEIVRTPPTVW----PDEGKIEVNDLSLRYAANLPRVI-KNVSFTVE 1466

Query: 496  AGSNVCIVGPSGRGKSTVALLLEKYYKPSSGEILIDGQNINDLNSKSLRRHIGLVQQEPI 555
              S V +VG +G GKST+   L ++  P SG I ID  +I  +    LRR I ++ Q+P 
Sbjct: 1467 PNSKVGVVGRTGAGKSTIITALFRFLDPESGYIKIDNMDITTIPLTRLRRAITIIPQDPT 1526

Query: 556  LMSGTIRDN-----------IVYGLTEM------PTKDEIRQVAKQCFCH-NFITRFQSS 597
            L +GT++ N           I   LT +          E   V+ Q   H N   RF   
Sbjct: 1527 LFAGTLKFNLDPYDEYNDKDIFAALTRVNLVSGEELNGETTAVSDQGSMHSNNENRFLDL 1586

Query: 598  YDTVIGPHGTLLSGGQKQRIAIARALIKKPRILILDEATSALDVESEGAINYT----FGQ 653
             + +    G  LS GQ+Q I +AR+L++ P+IL+LDEAT+++D ES+  +  T    FG 
Sbjct: 1587 SNEITEGGGN-LSQGQRQLICLARSLLRNPKILLLDEATASIDYESDARLQATIRGEFGN 1645

Query: 654  LMKKKEMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELWDDPTSELSQLLNEKS 712
                   TI++IAHRL ++   + ++V+   G V+E       +D P    S LLN  S
Sbjct: 1646 ------STILTIAHRLRSVIDYDKILVMDA-GEVIE-------YDHP---YSLLLNRNS 1687

 Score = 89.4 bits (220), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 67/238 (28%), Positives = 116/238 (48%), Gaps = 13/238 (5%)

Query: 468 EIEFKNVSFAYPTRPSNMIFKNLNFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPSSGE 527
           ++ F N + ++ T  S    +NLN   + G    ++G +G GK+++ + L        G 
Sbjct: 758 KLAFDNSTTSWDTNGSGFKLRNLNIDFKVGKLNVVIGATGSGKTSLLMALLGEMHICQGR 817

Query: 528 ILI---DGQNINDLNSKSLRRHIGLVQQEPILMSGTIRDNIVYGLTEMPTKDEIR--QVA 582
           I++   + ++    NS      I    Q   L++ T+R+NI++      + DE R  +V 
Sbjct: 818 IIVPSLEPRSSLTANSDGFTNSIAYCSQAAWLLNDTVRNNILFN----SSFDENRYHKVV 873

Query: 583 KQCFCHNFITRFQSSYDTVIGPHGTLLSGGQKQRIAIARALIKKPRILILDEATSALDVE 642
           + C         ++   T IG  G  LSGGQKQRI++ARAL    + L+LD+  SA+D  
Sbjct: 874 EACGLKRDFDILKAGDLTEIGEKGITLSGGQKQRISLARALYSDSKHLLLDDCLSAVDSH 933

Query: 643 SEGAI--NYTFGQLMKKKEMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELWD 698
           +   I  N   G LM  +  T + ++H ++   R+  ++V+  DG V + G    L+D
Sbjct: 934 TASWIYDNCITGPLMVGR--TCILVSHNIALTLRNAELVVILEDGRVKDQGDPLNLFD 989

>Smik_8.6 Chr8 complement(11717..16474) [4758 bp, 1585 aa] {ON}
            YHL035C (REAL)
          Length = 1585

 Score =  139 bits (350), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 146/530 (27%), Positives = 243/530 (45%), Gaps = 80/530 (15%)

Query: 229  TVIKKTIHQDAEFFDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALI-CGSVGIGMMX 287
            +++   +H    FFD   VG +++R   D   + + +   +      LI C S+ + ++ 
Sbjct: 1077 SMLDLVLHAKIRFFDVTPVGRIMNRFSKDIEGIDQELIPYLEVTVFCLIQCSSILLLIVV 1136

Query: 288  XXXXXXXXXXXVFTPPVILSASVFGKQISTTSRELQEATGHLTKVA-----EEQLSGIKT 342
                       VF    IL   V GK     SR+L+     +TK        E L G+ T
Sbjct: 1137 ITPRFFSVAVIVF----ILYYFV-GKWYLKASRDLKRIDS-ITKSPIFQHFSETLVGVCT 1190

Query: 343  VQSFVAEQREINRYNFAIRDIFNIGKKAAVINAKFFSSTSAMGDLSF-------LTVLGF 395
            +++F  E+R      F + ++  I +     N  FF  + A+   +F         VLG 
Sbjct: 1191 IRAFGDEKR------FILENMEKIDQN----NKAFFYLSVAVKWFAFRVDMIGAFIVLGS 1240

Query: 396  GSYLVLQ-NSLTIGDLTAFMMYTEYTGNSIFGLSTFYSEIMQGAGAASRLFELTDRVPSI 454
            GS+++   +++  G     + Y     +S   L   YS       +  RL E +    SI
Sbjct: 1241 GSFILFNIDNIDSGLAGISLTYAILFTDSALWLVQLYSRFEMNMNSVERLKEYS----SI 1296

Query: 455  STTKGVKYK------------PGNGEIEFKNVSFAYPTRPSNMIFKNLNFKIEAGSNVCI 502
               K + Y             P +G+IE +N+S  Y +    ++ KN+ FK++  S V I
Sbjct: 1297 VQEKYLGYDEDHIQALNDSSWPKHGKIEVENLSLRYASNLP-LVLKNVCFKVDPQSKVGI 1355

Query: 503  VGPSGRGKSTVALLLEKYYKPSSGEILIDGQNINDLNSKSLRRHIGLVQQEPILMSGTIR 562
            VG +G GKST+   L +  +P +G I ID Q+I+ ++  +LRR I ++ Q+P+L +GTI+
Sbjct: 1356 VGRTGAGKSTIIAALFRLLEPVTGCIKIDDQDISKIDLITLRRSITIIPQDPVLFAGTIK 1415

Query: 563  DNI-------------VYGLTEMPTKDEIRQV--AKQCF-CHNFITRFQSSYDTVIGPHG 606
             NI             V     + +  E +QV   K+ F  HN     QS     I   G
Sbjct: 1416 SNIDPHDEYDERRIFKVLLQVNLISSLEFKQVFNLKENFNIHNKFLNLQSE----IVEGG 1471

Query: 607  TLLSGGQKQRIAIARALIKKPRILILDEATSALDVESEGAINYTFGQLMKKKEMTIVSIA 666
              LS G++Q + IAR+L+++ +I++LDEATS++D +S+  I         K   TI++IA
Sbjct: 1472 LNLSQGERQLLFIARSLLRESKIILLDEATSSIDYDSDHLIQSIIRSKFNKS--TILTIA 1529

Query: 667  HRLSTIRRSENVIVLGHDGSVVEMGKFKELWDDPTSELSQLLNEKSTPHQ 716
            HRL ++   + ++V+   G + E G   EL          L NE+ST ++
Sbjct: 1530 HRLRSVIYYDKILVMDA-GEIKEYGHPYEL----------LKNERSTFYR 1568

 Score = 85.1 bits (209), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 73/241 (30%), Positives = 116/241 (48%), Gaps = 12/241 (4%)

Query: 464 PGNGEIEFKNVSFAYPTRPSNM-IFK--NLNFKIEAGSNVCIVGPSGRGKSTVALLLEKY 520
           P   +IEFK  +  +    +++  FK  +LN     G    ++G +G GKS + + L   
Sbjct: 659 PDRNKIEFKKANLVWNENDNDINKFKLCDLNIIFSIGKLNLVLGSTGSGKSALLMSLLGE 718

Query: 521 YKPSSGEILIDG-QNINDL--NSKSLRRHIGLVQQEPILMSGTIRDNIVYGLTEMPTKDE 577
               SG I+I G +  +DL  +   L        Q   L+S TI++NIV+  +    K  
Sbjct: 719 LDLVSGFIIIPGLEPRHDLIPDHDGLTNSFAYCSQSAWLVSDTIKNNIVFNGSY--DKSR 776

Query: 578 IRQVAKQCFCHNFITRFQSSYDTVIGPHGTLLSGGQKQRIAIARALIKKPRILILDEATS 637
            ++V   C  +  +    +   T IG  G  LSGGQKQRI++ARA+    + ++LD+  S
Sbjct: 777 YKKVIDACGLNRDLNILPAGDLTEIGEKGITLSGGQKQRISLARAVYSHAKHVLLDDCLS 836

Query: 638 ALDVESEGAI--NYTFGQLMKKKEMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKE 695
           A+D  +   I  N   GQLMK +  T + + H +    R+ +  ++  DG V   G  KE
Sbjct: 837 AVDSHTAVWIYENCITGQLMKNR--TCILVTHNVPLAIRNAHFAIILEDGKVKNQGTIKE 894

Query: 696 L 696
           L
Sbjct: 895 L 895

>KAFR0B05630 Chr2 complement(1156621..1161168) [4548 bp, 1515 aa] {ON}
            Anc_8.303 YDR135C
          Length = 1515

 Score =  139 bits (349), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 141/498 (28%), Positives = 234/498 (46%), Gaps = 57/498 (11%)

Query: 241  FFDTHKVGDLISRLGSDAY----VVSRSMTQKVSDGFK-----ALICGSVGIGMMXXXXX 291
            FF+T  +G +++R  +D Y    ++ R+ +Q   +  K     A+IC +           
Sbjct: 1039 FFETTPIGRILNRFSNDIYKIDSILGRTFSQFFVNAVKVVFVMAVICATTW--------- 1089

Query: 292  XXXXXXXVFTPPVILSASVF----GKQISTTSRELQEATGHLTKVA-----EEQLSGIKT 342
                   +F   VI+   VF     +    TSREL+     +T+       +E L GI T
Sbjct: 1090 -----QFIF---VIIPLGVFYIYYQQYYLRTSRELRRLDS-ITRSPVYSHFQETLGGITT 1140

Query: 343  VQSFVAEQR--EINRYNFAIRDIFNIGKKAAVINAKFFSS--TSAMGDLSFLTVLGFGSY 398
            ++ +  E+R   IN+     R   N+      INA  + +     +G +  L       +
Sbjct: 1141 IRGYNQEKRFGHINQ----CRVDNNMSAFYPSINANRWLAFRLELIGSIIILGAATLSIF 1196

Query: 399  LVLQNSLTIGDLTAFMMYTEYTGNSIFGLSTFYSEIMQGAGAASRLFE---LTDRVPSIS 455
             + + +LT G +   + Y      ++  +     E+     +  R+ E   L    P I 
Sbjct: 1197 RLKEGTLTPGMVGLSLSYALQITQTLNWIVRMTVEVETNIVSVERVKEYAQLESEAPRIV 1256

Query: 456  TTKGV-KYKPGNGEIEFKNVSFAYPTRPS-NMIFKNLNFKIEAGSNVCIVGPSGRGKSTV 513
              K   +  P  G+I+F+N S  Y  RP  +++ KN+N  I     V IVG +G GKS++
Sbjct: 1257 EEKRPDEMWPTEGDIKFENYSTRY--RPELDLVLKNINVHIRPTEKVGIVGRTGAGKSSL 1314

Query: 514  ALLLEKYYKPSSGEILIDGQNINDLNSKSLRRHIGLVQQEPILMSGTIRDNIVYGLTEMP 573
             L L +  + ++G I+IDG  IN++    LR  + ++ Q+  +  GT+R+NI    T + 
Sbjct: 1315 TLALFRIIEATAGNIIIDGIPINEIGLYDLRHKLSIIPQDSQVFEGTLRENI--DPTNLF 1372

Query: 574  TKDEIRQVAKQCFCHNFITRFQSS-YDTVIGPHGTLLSGGQKQRIAIARALIKKPRILIL 632
            T +EI +V +       +    +   D  +   G+ LS GQ+Q + +ARAL+   +IL+L
Sbjct: 1373 TDEEIWRVLELSHLKEHVLSMGADGLDVQLTEGGSNLSVGQRQLMCLARALLIPSKILVL 1432

Query: 633  DEATSALDVESEGAINYTFGQLMKKKEMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGK 692
            DEAT+A+DVE++  +  T     K +  TI++IAHRL+TI  S+ +IVL   G +VE   
Sbjct: 1433 DEATAAVDVETDKIVQETIRTAFKDR--TILTIAHRLNTIMDSDRIIVLD-KGEIVEFDT 1489

Query: 693  FKELWDDPTSELSQLLNE 710
              EL   P S    L NE
Sbjct: 1490 PDELLAKPESLFYSLCNE 1507

 Score = 83.6 bits (205), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 92/407 (22%), Positives = 179/407 (43%), Gaps = 62/407 (15%)

Query: 330 TKVAEEQLSGIKTVQSFVAE---QREIN--RYNFAIRDIFNIGKKAAVINAKFFSSTSAM 384
           T V  E L+ IK+++ +  E   Q ++N  R +  + ++  +G   AV + +F       
Sbjct: 481 TGVISEILNNIKSLKLYAWEVPYQTKLNHVRNDKELHNLTKLGCYMAVTSFQF------- 533

Query: 385 GDLSFL-TVLGFGSYLVLQNSLTIGDLTAFMMYTEYTGNSIFGLSTF--------YSEIM 435
             + FL +   F  ++  +N     DL        +   ++F L +F         +  +
Sbjct: 534 NIVPFLVSCATFAVFVYTENKPLTTDLV-------FPALTLFNLLSFPLMVVPNVITSFV 586

Query: 436 QGAGAASRLFEL----------TDRVPSISTTKGVKYKPGNGEIEFKNVSFAYPTRPSNM 485
           + + + +RLF              R+P +     V    G+      N +F +  +P   
Sbjct: 587 EASVSVNRLFSFLTNEELQKDSIQRLPKVENKGDVAINLGD------NATFLWKRKPEYK 640

Query: 486 I-FKNLNFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPSSGEILIDGQNINDLNSKSLR 544
           +  KN+NF+ + G   CIVG  G GKS +              IL D   +      ++ 
Sbjct: 641 VALKNINFQAKKGDLTCIVGKVGSGKSALI-----------QSILGDLFRVKGF--ATVH 687

Query: 545 RHIGLVQQEPILMSGTIRDNIVYGLTEMPTKDEIRQVAKQCFCHNFITRFQSSYDTVIGP 604
            ++  V Q P +M+GT+++NI++G      ++   +  K C     +        T++G 
Sbjct: 688 GNVAYVSQVPWIMNGTVKENILFG--HKYDQEFYEKTIKACALTIDLGILVDGDQTLVGE 745

Query: 605 HGTLLSGGQKQRIAIARALIKKPRILILDEATSALDVE-SEGAINYTFGQLMKKKEMTIV 663
            G  LSGGQK R+++ARA+  +    +LD+  +A+D   S+  + +  G        T V
Sbjct: 746 KGISLSGGQKARLSLARAVYSRADTYLLDDPLAAVDEHVSKHLVEHVLGPTGLLHSKTKV 805

Query: 664 SIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELWDDPTSELSQLLNE 710
              +++S +  ++++ +L  +G +V+ G ++E+  D  S L +L+ E
Sbjct: 806 LCTNKISVLSIADSITLL-ENGEIVQQGSYEEVNSDEDSPLFKLIKE 851

>CAGL0G00242g Chr7 complement(20428..24861) [4434 bp, 1477 aa] {ON}
            highly similar to uniprot|P53049 Saccharomyces cerevisiae
            YGR281w YOR1 ATP-binding cassette transporter protein
          Length = 1477

 Score =  139 bits (349), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 123/506 (24%), Positives = 228/506 (45%), Gaps = 44/506 (8%)

Query: 226  LRATVIKKTIHQDAEFFDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGSVGIGM 285
            L    +K+ +H    + DT  +G +++R   D    + S+  ++++  + ++     I  
Sbjct: 968  LNLKAVKRILHAPMSYLDTTPLGRILNRFTKD----TDSLDNELTENIRLMMSQFANIIG 1023

Query: 286  MXXXXXXXXXXXXVFTPPVILSASVFGKQISTTSRELQEATG----HLTKVAEEQLSGIK 341
            +            +  P ++L   +      +  RE++         +     E L G+ 
Sbjct: 1024 VCVLCIVYLPWFAIAIPFLLLVFVLIADHYQSAGREIKRLEAIQRSFVYNNLIEVLGGMD 1083

Query: 342  TVQSFVAEQREINRYNFAIRDIFNIGKKAAVIN--AKFFSSTSAMGDLSFLTVLGFGSYL 399
            T++++ ++ R + + +F I  +  +      +      F    A+     +++L      
Sbjct: 1084 TIKAYKSQDRYMTKMDFLINKMNEVSYMVVSVQRWVAIFLDMIAVAFALIISLLCVTRQF 1143

Query: 400  VLQNSLTIGDLTAFMMYTEYTGNSIFGLSTFYSEIMQGAGAASRLFELTDRVPSISTTKG 459
             +  S  +G L  +++      N++    T   +      +A RL      +P  +  + 
Sbjct: 1144 HISPS-AVGVLLTYVLQLPGLLNTVLRALT---QTENDMNSAERLVTYATELPQEAAYRK 1199

Query: 460  VKYKP-----GNGEIEFKNVSFAY-PTRPSNMIFKNLNFKIEAGSNVCIVGPSGRGKSTV 513
              Y P      NGE+ F++VSFAY P  P+  + KN+N  I  G  + I G +G GKST+
Sbjct: 1200 SDYSPPDNWPTNGEVIFEDVSFAYRPGLPT--VLKNVNLSIAGGEKIGICGRTGAGKSTI 1257

Query: 514  ALLLEKYYKPSSGEILIDGQNINDLNSKSLRRHIGLVQQEPILMSGTIRDN--------- 564
               L +  + +SG I IDG +   L    LRR + ++ Q+P+L  GTIR N         
Sbjct: 1258 MTALYRLNELTSGRIFIDGIDTFKLGLYDLRRKLSIIPQDPVLFRGTIRKNLDPFNEFSD 1317

Query: 565  -------IVYGLTEMPTKDEIR-QVAKQCFCHNFITRFQSSYDTVIGPHGTLLSGGQKQR 616
                   I  G  E    ++I+ Q   +   +N + +F    D ++   G   S G++Q 
Sbjct: 1318 DSLWNSLIRGGAIEKDDLEDIKHQKPDKNGSYNNMHKFH--LDQIVEEDGANFSLGERQV 1375

Query: 617  IAIARALIKKPRILILDEATSALDVESEGAINYTFGQLMKKKEMTIVSIAHRLSTIRRSE 676
            +A+ RAL+++ +ILILDEATS++D E++G I        + ++ TI+ IAHRL TI   +
Sbjct: 1376 LALTRALVRQSKILILDEATSSVDYETDGKIQTRIAT--EFQDCTILCIAHRLKTILNYD 1433

Query: 677  NVIVLGHDGSVVEMGKFKELWDDPTS 702
             ++VL   G V E  K + L+++  S
Sbjct: 1434 RILVL-EKGEVAEFDKPEILFNNEKS 1458

 Score = 96.3 bits (238), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 68/211 (32%), Positives = 113/211 (53%), Gaps = 20/211 (9%)

Query: 487 FKNLNFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPSSGEILIDGQNINDLNSKSLRRH 546
           F NLNF+I+ G  + I GP G GKS++   +  +   ++GE+ I+G             H
Sbjct: 617 FSNLNFEIKKGEFIMITGPIGTGKSSLLNAMAGFMPQTTGELDING-------------H 663

Query: 547 IGLVQQEPILMSGTIRDNIVYGLTEMPTKDEIRQVAKQCFCHNFITRFQSSYDTVIGPHG 606
           + L+   P + + T+RDNI++G      +++ ++V + C     I    +   T IG  G
Sbjct: 664 M-LLCGYPWIQNATVRDNIIFG--SPYDREKYKEVIRVCSLQADIDILPAGDMTEIGERG 720

Query: 607 TLLSGGQKQRIAIARALIKKPRILILDEATSALDVE-SEGAINYTFGQLMKKKEMTIVSI 665
             LSGGQK RI +AR++ K   I + D+  SA+D    +  ++  F Q ++ K  T +  
Sbjct: 721 ITLSGGQKARINLARSVYKNKDIYLFDDVLSAVDSRVGKHIMDECFLQTLQSK--TRILA 778

Query: 666 AHRLSTIRRSENVIVLGHDGSVVEMGKFKEL 696
            H+LS I +++ VIVL  +GS V++G  +EL
Sbjct: 779 THQLSLIEKADRVIVLSTNGS-VDIGTVEEL 808

>Smik_12.48 Chr12 (103624..108297) [4674 bp, 1557 aa] {ON} YLL015W
            (REAL)
          Length = 1557

 Score =  139 bits (349), Expect = 8e-33,   Method: Compositional matrix adjust.
 Identities = 152/555 (27%), Positives = 252/555 (45%), Gaps = 94/555 (16%)

Query: 203  VGIAA--NYGRIILLRVLSERLVARLRATVIKKTIHQDAEFFDTHKVGDLISRLGSDAYV 260
            VG AA  N   I++L   S R   +L  ++ K  I     FF+T  VG +I+R  SD   
Sbjct: 1029 VGSAAFNNLRSIMMLLYCSIRGSKKLHESMAKSVIKSPMIFFETTPVGRIINRFSSDMDA 1088

Query: 261  VSRSMTQKVSDGFKALICGSVGIGMMXXXXXXXXXXXXVFTPPVILSASVFGKQIS---- 316
            V  S+    S  FK+++   V + ++             +  P  L  ++F   I     
Sbjct: 1089 VDSSLQYIFSFFFKSILTYLVTVILVG------------YNMPWFLVFNMFLLGIYIYYQ 1136

Query: 317  ----TTSRELQE----ATGHLTKVAEEQLSGIKTVQSFVAEQREI----NRYNFAIRDIF 364
                  SREL+     +   +  +  E L+G   + ++   +R I     +  + I  +F
Sbjct: 1137 TFYIVLSRELKRLISISYSPIMSLMSESLNGYSIIDAYDHFERFIYLNYEKIQYNIDFVF 1196

Query: 365  NIGKKAAVINAKFFSSTSAMGDLSFLTVLGFGSYLVL------------QNSLTIGDLTA 412
            N            F ST+    +   T+   G+ +VL            +  L+ G +  
Sbjct: 1197 N------------FRSTNRWLSVRLQTI---GATIVLATAMLTLATMNTKKQLSSGMVGL 1241

Query: 413  FMMYT-EYTGNSIFGLSTFYSEIMQGAGAAS-----RLFELTDRVPSISTTKGV-KYKPG 465
             M Y+ E TG+  + + T    +M      S        EL     SI+  K   K  P 
Sbjct: 1242 LMSYSLEVTGSLTWIVRT---TVMIETNIVSVERIVEYCELPSEAQSINPEKRPDKNWPS 1298

Query: 466  NGEIEFKNVSFAYPTRPSNMIFKNLNFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPSS 525
             G IEFK+ S  Y     + + K++N KIE    V IVG +G GKST++L L +  +P+ 
Sbjct: 1299 RGSIEFKDYSTKY-RENLDPVLKDINVKIEPCEKVGIVGRTGAGKSTLSLALFRILEPTE 1357

Query: 526  GEILIDGQNINDLNSKSLRRHIGLVQQEPILMSGTIRDNIVYGLTEMPTKDEIRQVAKQC 585
            G+I+IDG NI+DL    LR H+ ++ Q+     GT++ N+        ++DE+++  +  
Sbjct: 1358 GKIIIDGINISDLGLFDLRSHLAIIPQDAQAFEGTVKTNL--DPFNRYSEDELKKAVELA 1415

Query: 586  FCHNFITRF--------------QSSYDTVIGPHGTLLSGGQKQRIAIARALIKKPRILI 631
                 + +               +   D  I  +G+ LS GQ+Q + +ARAL+ + +IL+
Sbjct: 1416 HLKPHLEKMLENEPSDSEESCDIKDILDVKINENGSNLSVGQRQLLCLARALLNRSKILV 1475

Query: 632  LDEATSALDVESEGAINYTFGQLMKKKEMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMG 691
            LDEAT+++D+E++  I  T  +  K +  TI++IAHR+ T+  S+ +IVL  +GSV E  
Sbjct: 1476 LDEATASIDMETDKIIQDTIRREFKDR--TILTIAHRIDTVLDSDKIIVL-DEGSVKE-- 1530

Query: 692  KFKELWDDPTSELSQ 706
                 +D P+  LS 
Sbjct: 1531 -----FDSPSKLLSN 1540

 Score = 84.0 bits (206), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 102/423 (24%), Positives = 187/423 (44%), Gaps = 56/423 (13%)

Query: 331 KVAEEQLSGIKTVQSFVAEQREINRYNFAIRD--IFNIGKKAAVINAKFFSSTSA--MGD 386
           K   E L+ IK+++ +  E+  + R N    D  + N  K   V N  +F+      M  
Sbjct: 473 KTITELLNAIKSIKLYAWEEPMMKRLNHVRNDMELKNFRKIGIVSNLIYFAWNCVPLMVA 532

Query: 387 LSFLTVLGFGSYLVLQNSLTIGDLTAFMMYTEYTGNSIFGLSTFYSEIMQGAGAASRL-- 444
            S   +    +   L  ++    L+ F +      ++I+ + +  + I++ + +  RL  
Sbjct: 533 CSTFGLFSLFNDSPLSPAIVFPSLSLFNI----LNSAIYSVPSMINTIIETSVSMKRLKS 588

Query: 445 FELTDRVPSISTTKGVKYKPGNGE-----IEFKNVSFAYPTR------------------ 481
           F L+D    I  +   +  P   E     IE  N++F + ++                  
Sbjct: 589 FLLSDE---IDDSFIERIDPSVDERTLPVIEMNNITFLWKSKEALASSQLENNSRADEES 645

Query: 482 ---PSNMIFKNLN-FKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPSSGEILIDGQNIND 537
               S +  KN++ F+ + G+ VCIVG  G GKST       + K   G++     +   
Sbjct: 646 AMGSSQIALKNIDHFEAKRGNLVCIVGRVGAGKST-------FLKAILGQLPCMSGSKES 698

Query: 538 LNSKSLRRH--IGLVQQEPILMSGTIRDNIVYGLTEMPTKDEIRQVAKQCFCHNFITRFQ 595
           +  K + R   +    QE  +M+ ++++NI++G      K       K C     +    
Sbjct: 699 IPPKLIIRSSSLAYCSQESWIMNASVKENILFG--HKFDKAYYDLTIKACQLLPDLRILP 756

Query: 596 SSYDTVIGPHGTLLSGGQKQRIAIARALIKKPRILILDEATSALDVE-SEGAINYTF-GQ 653
              +T++G  G  LSGGQK R+++ARA+  +  I +LD+  SA+D E S+  I Y   G+
Sbjct: 757 DGDETLVGEKGISLSGGQKARLSLARAVYSRADIYLLDDILSAVDAEVSKNIIEYVLIGK 816

Query: 654 LMKKKEMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELW--DDPTSELSQLLNEK 711
               K  TI+   + +S ++ S+ +  L  +G +VE G +  +   ++ TS+L +LL E 
Sbjct: 817 KALLKNKTIILTTNTVSILKHSQMIYAL-ENGEIVEQGNYDSVMNRENSTSKLKKLLEEF 875

Query: 712 STP 714
            +P
Sbjct: 876 DSP 878

>Suva_7.577 Chr7 (1007741..1012177) [4437 bp, 1478 aa] {ON} YGR281W
            (REAL)
          Length = 1478

 Score =  138 bits (348), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 136/524 (25%), Positives = 233/524 (44%), Gaps = 79/524 (15%)

Query: 226  LRATVIKKTIHQDAEFFDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGSVGIGM 285
            L    +K+ +H    + DT  +G +++R   D    + S+  ++++  + +      I  
Sbjct: 968  LNLKAVKRILHTPMSYIDTTPLGRILNRFTKD----TDSLDNELTESLRLMTSQFANIVG 1023

Query: 286  MXXXXXXXXXXXXVFTPPVILSASVFGKQISTTSRELQ--EAT--GHLTKVAEEQLSGIK 341
            +            +  P +++   +      ++ RE++  EA     +     E L G+ 
Sbjct: 1024 VCVMCIVYLPWFAIAIPFLLIIFVLIADHYQSSGREIKRLEAVQRSFVYNNLNEVLGGMD 1083

Query: 342  TVQSFVAEQREINRYNFAIRDIFNIGKKAAVIN--AKFFSSTSAMGDLSFLTVL------ 393
            T++++ +++R + + +F I  +   G    V+      F    A+     +T+L      
Sbjct: 1084 TIKAYRSQERFLAKSDFLINKMNEAGYLVVVLQRWVGIFLDMVAIVFALIITLLCVTRAF 1143

Query: 394  -------GFGSYLVLQNSLTIGDLTAFMMYTEYTGNSIFGLSTFYSEIMQGAGAASRLFE 446
                   G     VLQ    +  L   +  TE   NS   L ++ +E+           E
Sbjct: 1144 PISAASVGVMLTYVLQLPGLLNTLLRALTQTENDMNSAERLVSYATELP---------LE 1194

Query: 447  LTDRVPSISTTKGVKYKPGNGEIEFKNVSFAY-PTRPSNMIFKNLNFKIEAGSNVCIVGP 505
               R P ++  +     P  GEI FKNV F+Y P  P  ++ KNLN  I++G  + I G 
Sbjct: 1195 ADYRKPEMAPPESW---PSKGEIAFKNVDFSYRPGLP--VVLKNLNLNIKSGEKIGICGR 1249

Query: 506  SGRGKSTVALLLEKYYKPSSGEILIDGQNINDLNSKSLRRHIGLVQQEPILMSGTIRDNI 565
            +G GKST+   L +  + S GEILID  NI+ +    LRR + ++ Q+P+L  GTIR N+
Sbjct: 1250 TGAGKSTIMSALYRLNELSGGEILIDDVNISQIGLFDLRRKLAIIPQDPVLFRGTIRKNL 1309

Query: 566  VYGLTEMPTKDEIR-------------------QVAKQCFCHNFITRFQSSYDTVIGPHG 606
                    T+DE+                    Q  ++   H  + +F    D  +   G
Sbjct: 1310 --DPFNERTEDELWDALVRGGAIAKNDLPEVKLQKPEENGTHGKMHKFH--LDQAVEEEG 1365

Query: 607  TLLSGGQKQRIAIARALIKKPRILILDEATSALDVESEGAINY----TFGQLMKKKEMTI 662
            +  S G++Q +A+ RAL+++ +ILILDEATS++D E++G I       FG      + TI
Sbjct: 1366 SNFSLGERQLLALTRALVRQSKILILDEATSSVDYETDGKIQVRIVEEFG------DCTI 1419

Query: 663  VSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELWDDPTSELSQ 706
            + IAHRL TI   + ++VL   G V E       +D P +  SQ
Sbjct: 1420 LCIAHRLKTIVNYDRILVL-EKGEVAE-------FDTPWALFSQ 1455

 Score = 88.6 bits (218), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 67/211 (31%), Positives = 109/211 (51%), Gaps = 20/211 (9%)

Query: 487 FKNLNFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPSSGEILIDGQNINDLNSKSLRRH 546
           FK+L+F+I+ G  + I GP G GKS++   +    + + G+I ++G    DL        
Sbjct: 604 FKDLDFEIKKGEFIMITGPIGTGKSSLLNAMAGSMRKTDGKIEVNG----DL-------- 651

Query: 547 IGLVQQEPILMSGTIRDNIVYGLTEMPTKDEIRQVAKQCFCHNFITRFQSSYDTVIGPHG 606
             L+   P + + T++DNI++G      K++  +V   C     +    +   T IG  G
Sbjct: 652 --LMCGYPWIQNATVKDNIIFG--SPFNKEKYDEVIHVCSLKADLDILPAGDMTEIGERG 707

Query: 607 TLLSGGQKQRIAIARALIKKPRILILDEATSALDVE-SEGAINYTFGQLMKKKEMTIVSI 665
             LSGGQK RI +AR++ K+  I + D+  SA+D    +  ++     L++ K  T V  
Sbjct: 708 ITLSGGQKARINLARSVYKRKDIYLFDDVLSAVDSRVGKHIMDECLTGLLENK--TRVLA 765

Query: 666 AHRLSTIRRSENVIVLGHDGSVVEMGKFKEL 696
            H+LS I ++  VIVLG DG  V++G   EL
Sbjct: 766 THQLSLIEKASRVIVLGTDGD-VDIGTVDEL 795

>SAKL0H16016g Chr8 (1396707..1401206) [4500 bp, 1499 aa] {ON} similar
            to uniprot|P39109 Saccharomyces cerevisiae YDR135C
          Length = 1499

 Score =  137 bits (346), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 126/482 (26%), Positives = 221/482 (45%), Gaps = 25/482 (5%)

Query: 241  FFDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGSVGIGMMXXXXXXXXXXXXVF 300
            FF+T  +G +++R  +D Y V   + +  S  F       V +               + 
Sbjct: 1025 FFETTPIGRILNRFSNDIYKVDELLGRTFSQFF----VNVVKVTFTIVVICTSTWQFILV 1080

Query: 301  TPPVILSASVFGKQISTTSRELQE----ATGHLTKVAEEQLSGIKTVQSFVAEQREINRY 356
              P+ +    + +    TSREL+         +    +E L G+ T++ +  +Q+     
Sbjct: 1081 VLPLSVLYIYYQQYYLRTSRELRRLDSVTRSPIYAHFQETLGGVSTIRGY-GQQKRFAHI 1139

Query: 357  NFAIRDIFNIGKKAAVINAKFFSS--TSAMGDLSFLTVLGFGSYLVLQNSLTIGDLTAFM 414
            N A  D  N+      +NA  + +     +G +  L       + + Q +LT G +   +
Sbjct: 1140 NQARID-NNMSAFYPAVNANRWLAFRLEFLGSIIILGAATLSVFRLKQGTLTAGMIGLSL 1198

Query: 415  MYTEYTGNSIFGLSTFYSEIMQGAGAASRLFELTDRVPS----ISTTKGVKYKPGNGEIE 470
             Y      S+  +     E+     +  R+ E  +  P     I +++  K  P  G+I 
Sbjct: 1199 SYALQITQSLNWIVRMTVEVETNIVSVERIKEYAELKPEAPAIIESSRPPKGWPSQGDIR 1258

Query: 471  FKNVSFAYPTRPS-NMIFKNLNFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPSSGEIL 529
            F++ S  Y  RP   +I +++N  I+A   V IVG +G GKS++ L L +  + + G I 
Sbjct: 1259 FEHYSTRY--RPELQLILRDVNLHIKAREKVGIVGRTGAGKSSLTLALFRIIEAAEGHIF 1316

Query: 530  IDGQNINDLNSKSLRRHIGLVQQEPILMSGTIRDNIVYGLTEMPTKDEIRQVAKQCFCHN 589
            IDG + + +    LR  + ++ Q+  + +GT+R+N+    TE  T +EI    +      
Sbjct: 1317 IDGLSTDTIGLADLRHKLSIIPQDSQVFAGTLRENV--DPTEEFTDEEIWHALELSHLKE 1374

Query: 590  FITRF-QSSYDTVIGPHGTLLSGGQKQRIAIARALIKKPRILILDEATSALDVESEGAIN 648
             +         T++   G+ LS GQ+Q + +ARAL+   +IL+LDEAT+A+DVE++  I 
Sbjct: 1375 HVMSMGNDGLQTMLTECGSNLSVGQRQLLCLARALLIPSKILVLDEATAAVDVETDRVIQ 1434

Query: 649  YTFGQLMKKKEMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELWDDPTSELSQLL 708
             T     K +  TI++IAHR++TI  S+ +IVL ++G V E    + L   P S    L 
Sbjct: 1435 ETIRTAFKNR--TILTIAHRINTIMDSDKIIVL-NEGQVAEFDTPENLLQRPDSLFYSLC 1491

Query: 709  NE 710
             E
Sbjct: 1492 KE 1493

 Score = 87.4 bits (215), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 70/272 (25%), Positives = 130/272 (47%), Gaps = 42/272 (15%)

Query: 450 RVPSISTTKGVKYKPGNGEIEFKNVSFAYPTRPSNMI-FKNLNFKIEAGSNVCIVGPSGR 508
           R PS+++   +  K G       + +F +  +P   +  KN+NF+ + G   CIVG  G 
Sbjct: 606 REPSVTSKGDIAVKVGG------DATFLWQRKPEYKVALKNINFQAKKGELTCIVGRVGS 659

Query: 509 GKSTVALLLEKYYKPSSGEILIDGQNINDLNSKSLRRHIGLVQQEPILMSGTIRDNIVYG 568
           GKS +              IL D   +      ++   +  V Q P +M+GT+++NI++G
Sbjct: 660 GKSALI-----------QSILGDLFRVKGF--ATIHGSVAYVSQIPWIMNGTVKENILFG 706

Query: 569 LTEMPTKDEIRQVAKQCFCHNFITRFQSSYDTVIGPHGTLLSGGQKQRIAIARALIKKPR 628
               P+  E  +  K C  +  ++       T++G  G  LSGGQK R+++ARA+  +  
Sbjct: 707 HKYDPSFYE--KTVKACALNVDLSILPQGDQTLVGEKGISLSGGQKARLSLARAVYSRAD 764

Query: 629 ILILDEATSALDVE-SEGAINYTFG---------QLMKKKEMTIVSIAHRLSTIRRSENV 678
             +LD+  +A+D   ++  ++   G         +++   ++T++SIA          + 
Sbjct: 765 TYLLDDPLAAVDEHVAKHLVDNVLGVTGLLHSKTKVLATNKITVLSIA----------DS 814

Query: 679 IVLGHDGSVVEMGKFKELWDDPTSELSQLLNE 710
           I L  +G +V+ G + E+  D  S LS+L++E
Sbjct: 815 IALLENGEIVQQGSYDEVVRDDGSALSKLIHE 846

>NCAS0E04160 Chr5 (818254..822774) [4521 bp, 1506 aa] {ON} Anc_5.10
          Length = 1506

 Score =  137 bits (345), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 138/532 (25%), Positives = 238/532 (44%), Gaps = 71/532 (13%)

Query: 207  ANYGRIILLRVLSERLVARLRATVIKKTIHQDAEFFDTHKVGDLISRLGSDAYVVSRSMT 266
            + +  +  + VLS + +  LRA  +K+ +H    + DT  +G +++R   D    + S+ 
Sbjct: 983  SQFTLLCCIGVLSSKWL-NLRA--VKRILHTPMSYLDTTPLGRILNRFTKD----TDSLD 1035

Query: 267  QKVSDGFKALICGSVGIGMMXXXXXXXXXXXXVFTPPVILSASVFGKQISTTSRELQEAT 326
             ++++  + L+     I  +            +  P + +   +      ++ RE++   
Sbjct: 1036 NELTESVRMLLYQFANIVGVCIMCIIYLPWFAIAIPFLFVGFVLIADHYQSSGREIKRLE 1095

Query: 327  G----HLTKVAEEQLSGIKTVQSFVAEQREINRYNFAIRDIFNIGKKAAVIN--AKFFSS 380
                  +     E L G+ T++S+ +E R I + +F I  +   G     +      F  
Sbjct: 1096 AIQRSFVYNNFNEVLGGMDTIKSYRSENRFIAKSDFLIDKMNEAGYLVVAVQRWVAIFLD 1155

Query: 381  TSAMGDLSFLTVL-------------GFGSYLVLQNSLTIGDLTAFMMYTEYTGNSIFGL 427
              A+     +T+L             G     VLQ    +  +   +  TE   NS   L
Sbjct: 1156 VIAVCFALIITLLCVTRAFPISAASVGVLLTYVLQLPGLLNGVLRSLTQTENDMNSAERL 1215

Query: 428  STFYSEIMQGAGAASRLFELTDRVPSISTTKGVKYKPGNGEIEFKNVSFAY-PTRPSNMI 486
             T+ +E+           E   R P +S  +     P  GEI F+NV F+Y P  P+  +
Sbjct: 1216 VTYATELP---------LEADYRKPEVSPPEEW---PTKGEIHFENVDFSYRPGLPT--V 1261

Query: 487  FKNLNFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPSSGEILIDGQNINDLNSKSLRRH 546
             KNL+  I++G  + I G +G GKST+   L +  + SSG+++ID  +I+ +    LRR 
Sbjct: 1262 LKNLSLDIKSGEKIGICGRTGAGKSTIMSALYRLNEISSGKMIIDDVDISTIGLYDLRRK 1321

Query: 547  IGLVQQEPILMSGTIRDN----------------IVYGLTEMPTKDEIR-QVAKQCFCHN 589
            + ++ Q+P+L  GTIR N                +  G  E    +EI+ Q   +   H+
Sbjct: 1322 LAIIPQDPVLFRGTIRKNLDPFNEHQDEHLWNALVRGGAIEQKELNEIKAQKPDEKGNHS 1381

Query: 590  FITRFQSSYDTVIGPHGTLLSGGQKQRIAIARALIKKPRILILDEATSALDVESEGAINY 649
             + +F    D ++   G   S G++Q +A+ RAL+++ RILILDEATS++D E++G I  
Sbjct: 1382 EMYKFH--LDQLVEEEGANFSLGERQLLALTRALVRQARILILDEATSSVDYETDGKIQA 1439

Query: 650  ----TFGQLMKKKEMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELW 697
                 FG        TI+ IAHRL TI   + ++VL   G V E    K L+
Sbjct: 1440 RIVEEFGHC------TILCIAHRLKTILTYDRILVL-EKGEVAEFDTPKTLF 1484

 Score = 92.0 bits (227), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 68/211 (32%), Positives = 111/211 (52%), Gaps = 20/211 (9%)

Query: 487 FKNLNFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPSSGEILIDGQNINDLNSKSLRRH 546
           F +LNF+I+ G  + +VGP G GK+++      +    SG I I+G    DL        
Sbjct: 649 FHDLNFEIKKGEFIIMVGPIGTGKTSLLNAFAGFMNKVSGRIQING----DL-------- 696

Query: 547 IGLVQQEPILMSGTIRDNIVYGLTEMPTKDEIRQVAKQCFCHNFITRFQSSYDTVIGPHG 606
             L+   P + + +++DNI++G      K +  +V + C   + +    +   T IG  G
Sbjct: 697 --LLCGYPWIQNASVKDNIIFG--SPYNKAKYDEVIRVCSLKSDLDILPAGDLTEIGERG 752

Query: 607 TLLSGGQKQRIAIARALIKKPRILILDEATSALDVE-SEGAINYTFGQLMKKKEMTIVSI 665
             LSGGQK RI +AR++ K+  I + D+  SA+D    +  ++  F  L+K K  T +  
Sbjct: 753 ITLSGGQKARINLARSVYKQKDIYLFDDVLSAVDSRVGKHIMDECFLGLLKDK--TRILA 810

Query: 666 AHRLSTIRRSENVIVLGHDGSVVEMGKFKEL 696
            H+LS + R+  VIVLG+DGS  ++G  +EL
Sbjct: 811 THQLSLLERASRVIVLGNDGS-FDIGTVEEL 840

>YGR281W Chr7 (1052824..1057257) [4434 bp, 1477 aa] {ON}  YOR1Plasma
            membrane ATP-binding cassette (ABC) transporter,
            multidrug transporter mediates export of many different
            organic anions including oligomycin; similar to human
            cystic fibrosis transmembrane receptor (CFTR)
          Length = 1477

 Score =  137 bits (345), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 139/524 (26%), Positives = 238/524 (45%), Gaps = 81/524 (15%)

Query: 226  LRATVIKKTIHQDAEFFDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGSVGIGM 285
            LRA  +K+ +H    + DT  +G +++R   D    + S+  ++++  + +      I  
Sbjct: 969  LRA--VKRILHTPMSYIDTTPLGRILNRFTKD----TDSLDNELTESLRLMTSQFANIVG 1022

Query: 286  MXXXXXXXXXXXXVFTPPVILSASVFGKQISTTSRELQ--EAT--GHLTKVAEEQLSGIK 341
            +            +  P +++   +      ++ RE++  EA     +     E L G+ 
Sbjct: 1023 VCVMCIVYLPWFAIAIPFLLVIFVLIADHYQSSGREIKRLEAVQRSFVYNNLNEVLGGMD 1082

Query: 342  TVQSFVAEQREINRYNFAIRDIFNIGKKAAVIN--AKFFSSTSAMGDLSFLTVL------ 393
            T++++ +++R + + +F I  +   G    V+      F    A+     +T+L      
Sbjct: 1083 TIKAYRSQERFLAKSDFLINKMNEAGYLVVVLQRWVGIFLDMVAIAFALIITLLCVTRAF 1142

Query: 394  -------GFGSYLVLQNSLTIGDLTAFMMYTEYTGNSIFGLSTFYSEIMQGAGAASRLFE 446
                   G     VLQ    +  +   M  TE   NS   L T+ +E+           E
Sbjct: 1143 PISAASVGVLLTYVLQLPGLLNTILRAMTQTENDMNSAERLVTYATELP---------LE 1193

Query: 447  LTDRVPSISTTKGVKYKPGNGEIEFKNVSFAY-PTRPSNMIFKNLNFKIEAGSNVCIVGP 505
             + R P ++  +     P  GEI F+NV FAY P  P  ++ KNLN  I++G  + I G 
Sbjct: 1194 ASYRKPEMTPPESW---PSMGEIIFENVDFAYRPGLP--IVLKNLNLNIKSGEKIGICGR 1248

Query: 506  SGRGKSTVALLLEKYYKPSSGEILIDGQNINDLNSKSLRRHIGLVQQEPILMSGTIRDNI 565
            +G GKST+   L +  + ++G+ILID  +I+ L    LRR + ++ Q+P+L  GTIR N+
Sbjct: 1249 TGAGKSTIMSALYRLNELTAGKILIDNVDISQLGLFDLRRKLAIIPQDPVLFRGTIRKNL 1308

Query: 566  ---------------VYGLTEMPTKDEIRQVAKQ----CFCHNFITRFQSSYDTVIGPHG 606
                           V G      KD++ +V  Q       H  + +F    D  +   G
Sbjct: 1309 DPFNERTDDELWDALVRG--GAIAKDDLPEVKLQKPDENGTHGKMHKFH--LDQAVEEEG 1364

Query: 607  TLLSGGQKQRIAIARALIKKPRILILDEATSALDVESEGAINY----TFGQLMKKKEMTI 662
            +  S G++Q +A+ RAL+++ +ILILDEATS++D E++G I       FG      + TI
Sbjct: 1365 SNFSLGERQLLALTRALVRQSKILILDEATSSVDYETDGKIQTRIVEEFG------DCTI 1418

Query: 663  VSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELWDDPTSELSQ 706
            + IAHRL TI   + ++VL   G V E       +D P +  SQ
Sbjct: 1419 LCIAHRLKTIVNYDRILVL-EKGEVAE-------FDTPWTLFSQ 1454

 Score = 91.3 bits (225), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 71/213 (33%), Positives = 107/213 (50%), Gaps = 24/213 (11%)

Query: 487 FKNLNFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPSSGEILIDGQNINDLNSKSLRRH 546
           FK+LNF I+ G  + I GP G GKS++   +    + + G++ ++G    DL        
Sbjct: 604 FKDLNFDIKKGEFIMITGPIGTGKSSLLNAMAGSMRKTDGKVEVNG----DL-------- 651

Query: 547 IGLVQQEPILMSGTIRDNIVYGLTEMP-TKDEIRQVAKQCFCHNFITRFQSSYDTVIGPH 605
             L+   P + + ++RDNI++G    P  K++  +V + C     +    +   T IG  
Sbjct: 652 --LMCGYPWIQNASVRDNIIFG---SPFNKEKYDEVVRVCSLKADLDILPAGDMTEIGER 706

Query: 606 GTLLSGGQKQRIAIARALIKKPRILILDEATSALDVESEGAI--NYTFGQLMKKKEMTIV 663
           G  LSGGQK RI +AR++ KK  I + D+  SA+D      I      G L  K   T +
Sbjct: 707 GITLSGGQKARINLARSVYKKKDIYLFDDVLSAVDSRVGKHIMDECLTGMLANK---TRI 763

Query: 664 SIAHRLSTIRRSENVIVLGHDGSVVEMGKFKEL 696
              H+LS I R+  VIVLG DG  V++G   EL
Sbjct: 764 LATHQLSLIERASRVIVLGTDGQ-VDIGTVDEL 795

>KNAG0I00990 Chr9 (188695..193302) [4608 bp, 1535 aa] {ON} Anc_8.303
            YDR135C
          Length = 1535

 Score =  137 bits (345), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 134/495 (27%), Positives = 229/495 (46%), Gaps = 51/495 (10%)

Query: 241  FFDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGSVGIGMMXXXXXXXXXXXXVF 300
            FF+T  +G +++R  +D Y V   + +     F   +  +V +                 
Sbjct: 1045 FFETTPIGRILNRFSNDIYKVDSLLGRT----FSQFLVNAVKVVFTMIVICWTTWQFIFI 1100

Query: 301  TPPVILSASVFGKQISTTSRELQE----ATGHLTKVAEEQLSGIKTVQSFVAEQREINRY 356
              P+ +    + +    TSREL+         +    +E L G+ T++ +  +QR  +  
Sbjct: 1101 IGPLGVLYIYYQQYYLRTSRELRRLDSITRSPIYSHFQETLGGMSTIRGY-NQQRRFDHI 1159

Query: 357  NFAIRDIFNIGKKAAVINAKFFSS--TSAMGDLSFLTVLGFGSYLVLQNSLTIGDLTAFM 414
            N    D  N+      INA  + +    ++G +  L       Y + Q +LT G +   +
Sbjct: 1160 NHCRIDN-NMSAFYPSINANRWLAFRLESIGSVIILGAATLSIYRLGQGTLTAGMVGLSL 1218

Query: 415  MYTEYTGNSIFGLSTFYSEIMQGAGAASRL---FELTDRVP-SISTTKGVKYKPGNGEIE 470
             Y      ++  +     E+     +  R+    EL    P  I   +   + P +G+I 
Sbjct: 1219 SYALQITQTLNWIVRMTVEVETNIVSVERIKEYSELKSEAPLVIEEKRPAAHWPDSGDIR 1278

Query: 471  FKNVSFAYPTRPS-NMIFKNLNFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPSSGEIL 529
            F + S  Y  RP  +++ +++N  I+    + IVG +G GKS++ L L +  + SSG I+
Sbjct: 1279 FDHYSTRY--RPELDLVLRDVNLHIKPREKIGIVGRTGAGKSSLTLALFRIVEASSGGIV 1336

Query: 530  IDGQNINDLNSKSLRRHIGLVQQEPILMSGTIRDNIVYGLTEMPTKDEIRQVAKQCFCHN 589
            IDG  I+++    LR ++ ++ Q+  +  GTIR+N+    TE  T DEI +V +    + 
Sbjct: 1337 IDGVRIDEIGLHDLRHNLSIIPQDSQVFQGTIRENV--DPTETYTDDEIWRVLELSHLNR 1394

Query: 590  FITRFQSSYDTVIGPHGTL---------LSGGQKQRIAIARALIKKPRILILDEATSALD 640
             +          +GP G L         LS GQ+Q + +ARAL+   +ILILDEAT+A+D
Sbjct: 1395 HVES--------MGPRGLLNEVNEGGSNLSVGQRQLMCLARALLVPSKILILDEATAAVD 1446

Query: 641  VESEGAINYTFGQLMKKKEMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELWDDP 700
            VE++  I  T     + +  TI++IAHR++TI  S+ ++VL  DG     G+  E  D P
Sbjct: 1447 VETDQVIQETIRSAFRDR--TILTIAHRINTIMDSDRIVVL--DG-----GRVTEF-DTP 1496

Query: 701  TSELSQLLNEKSTPH 715
            T+ L    NE S  H
Sbjct: 1497 TNLLR---NEGSQFH 1508

 Score = 83.6 bits (205), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 90/407 (22%), Positives = 174/407 (42%), Gaps = 62/407 (15%)

Query: 330 TKVAEEQLSGIKTVQSFVAEQ-----REINRYNFAIRDIFNIGKKAAVINAKFFSSTSAM 384
           T V  E L+ IK+++ +  E+      E  R +  ++++  +G   A+ + +F      +
Sbjct: 483 TSVISEILNNIKSLKLYAWEEPYKKKLEHVRNDKELKNLTKLGCFMAITSFQFNVVPFLV 542

Query: 385 GDLSFLTVLGFGSYLVLQNSLTIGDLTAFMMYTEYTGNSIFGLSTFYSEIMQGAGAASRL 444
              +F  V  +     L   L    LT F + +      +F +    +  ++ + + +RL
Sbjct: 543 SCCTF-AVFVYTEDRALTVDLVFPALTLFNLLS----FPLFVIPNVMTSFIEASVSVTRL 597

Query: 445 FEL----------TDRVPSISTTKGVKYKPGNGEIEFKNVSFAYPTRPSNMI-FKNLNFK 493
           F              R+P ++    V  K G+      + +F +  +P   +  KN+NF+
Sbjct: 598 FNFLTNEELQKDSVQRLPKVTNVGDVAVKVGD------DATFLWRRKPEYKVALKNINFE 651

Query: 494 IEAGSNVCIVGPSGRGKSTVALLLEKYYKPSSGEILIDGQNINDLNSKSLRRHIGLVQQE 553
            + G   C+VG  G GKS +   L        G   + G              +  V Q 
Sbjct: 652 AKKGQLTCVVGRVGSGKSALIQSLSGDLFRVKGFATVHGS-------------VAYVSQV 698

Query: 554 PILMSGTIRDNIVYGLTEMPTKDEIRQVAKQCFCHNFITRFQSSYDTVIGPHGTLLSGGQ 613
             +M+GT+++NI++G    P  +   +  K C     +       +T++G  G  LSGGQ
Sbjct: 699 AWIMNGTVKENILFGHRYDP--EFYDKTIKACALTIDLAVLVDGDETLVGEKGISLSGGQ 756

Query: 614 KQRIAIARALIKKPRILILDEATSALDVE-SEGAINYTFG---------QLMKKKEMTIV 663
           K R+++ARA+  +    +LD+  +A+D    +  + +  G         +++   +++++
Sbjct: 757 KARLSLARAVYARADTYLLDDPLAAVDEHVGKHLLEHVLGPTGLLRTKTKILATNKISVL 816

Query: 664 SIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELWDDPTSELSQLLNE 710
           SIA R          I L  +G +VE G + E+  D  S LS+L+ +
Sbjct: 817 SIADR----------IALLENGEIVEQGSYDEVTADGDSALSKLIRD 853

>KNAG0J02730 Chr10 complement(512373..516986) [4614 bp, 1537 aa] {ON} 
          Length = 1537

 Score =  137 bits (344), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 139/541 (25%), Positives = 250/541 (46%), Gaps = 58/541 (10%)

Query: 203  VGIAA----NYGRIILLRVLSERLVARLRATVIKKTIHQDAEFFDTHKVGDLISRLGSDA 258
            +GIA+    N   IILL   + R   +L   +    ++   +FF+T  +G +++R  +D 
Sbjct: 1013 IGIASAAFNNLRTIILLVYCTIRGAKKLHDNMAHAIVYSSMQFFETTPIGRILNRFSADI 1072

Query: 259  YVVSRSMTQKVSDGFKALICGSVGIGMMXXXXXXXXXXXXVFTPPVILSASVFGKQISTT 318
              V  ++       FK++    + + ++            VF   +++    + K     
Sbjct: 1073 DTVDSTLQMVFMVFFKSIFSYLITVILITISMPLFL----VFCLFLMVIYIYYQKLFIVQ 1128

Query: 319  SRELQEATG----HLTKVAEEQLSGIKTVQSF--VAEQREIN--RYNFAIRDIFNIGKKA 370
            SREL+  T      +  +  E L G+  ++++   +  + +N  R  F I  +F+     
Sbjct: 1129 SRELKRMTSISYSPIMSLVGESLGGLAVIRAYKHFSMFKYLNNERVQFNINCVFDYRSTN 1188

Query: 371  AVINAKFFSSTSAMGDLSFLTVLGFGSYLVLQNS--LTIGDLTAFMMYTEYTGNSIFGLS 428
              ++ +       +G L  L + G  S   + +S  LT G +   M Y      S+  + 
Sbjct: 1189 RWLSIRL----QTIGALMVL-ITGMLSLSTISSSKPLTAGMVGLLMSYVLQVTTSLMWIV 1243

Query: 429  TFYSEIMQGAGAASRLFELTDRVPSISTTKGVKYKPGN-----GEIEFKNVSFAYPTRPS 483
                 I  G  +  R+ E  + +PS +      Y+P +     G I+FKN S  Y     
Sbjct: 1244 RSSVMIETGIVSVERIMEYCE-LPSEAEQIVDDYRPASNWPSKGAIQFKNYSTRYRAN-L 1301

Query: 484  NMIFKNLNFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPSSGEILIDGQNINDLNSKSL 543
            + + KN++  I  G  V IVG +G GKST+ L L +  +P  G I+IDG +I+ +    L
Sbjct: 1302 DPVLKNISININPGEKVGIVGRTGAGKSTLTLALFRLLEPIEGTIIIDGMDISKIGISDL 1361

Query: 544  RRHIGLVQQEPILMSGTIRDNI----VYGLTEMPT-------KDEIRQVAKQCFCHNFIT 592
            R H+ ++ Q+     GT+R N+    ++   E+ T       K  ++++ ++        
Sbjct: 1362 RSHLAIIPQDAQAFEGTVRSNLDPFNMFSDKELDTAITLSHLKPHLKKLMEESGSE---L 1418

Query: 593  RFQSSYDTVIGPHGTLLSGGQKQRIAIARALIKKPRILILDEATSALDVESEGAINYTFG 652
                  +  I   G+ LS GQ+Q + +ARAL+ + +IL+LDEAT+++DVE++  I  T  
Sbjct: 1419 PLNDYLELGIKESGSSLSVGQRQLLCLARALLNRSKILVLDEATASVDVETDKIIQATIR 1478

Query: 653  QLMKKKEMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELWDDPTSELSQLLNEKS 712
            +    +  TI++IAHR+ T+  S+ ++VL       E G+ KE ++ P S    LL +KS
Sbjct: 1479 ESFSDR--TIITIAHRIDTVLDSDRILVL-------EQGEVKE-FNSPAS----LLADKS 1524

Query: 713  T 713
            T
Sbjct: 1525 T 1525

 Score = 62.8 bits (151), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 91/401 (22%), Positives = 168/401 (41%), Gaps = 50/401 (12%)

Query: 331 KVAEEQLSGIKTVQSFVAEQREINRYNFAIRDI--FNIGKKAAVINAKFFSSTSAMGDLS 388
           K   E L+ +K+++ +  E+  + R ++   D+   N+ K     N  +F+         
Sbjct: 473 KTTSEMLNSMKSIKLYAWEKPMLKRLSYIRNDLELANLKKIGIATNLIYFAWNCVP---L 529

Query: 389 FLTVLGFGSY-LVLQNSLTIGDLTAFMMYTEYTGNSIFGLSTFYSEIMQGAGAASR---- 443
            +T   F  Y L+  N LT   +   +       ++I+ +    S+I++   +  R    
Sbjct: 530 VVTCSTFAIYSLITDNPLTPELVFPSLSLFNILNDAIYTIPATISQIIETNVSIGRVKKF 589

Query: 444 -LFELTDRVPSISTTKGVKYKPGNGEIEFKNVSFAYPTRPS----------------NMI 486
            L E  DR  S       K+      +E  N +F + ++ S                 + 
Sbjct: 590 LLGEELDR--SFIEEIADKHDESPFAVEILNATFLWKSKASLQAGDGTDEETSIGSTVVA 647

Query: 487 FKNLNFKIEAGSNV--CIVGPSGRGKSTVALLLEKYYKPSSGEILIDGQNINDLNSKSLR 544
            K+++F   A  NV  C+VG  G GK+T+        K   G++     +   +  K + 
Sbjct: 648 LKDIDF-FRAKKNVLTCVVGRVGSGKTTLL-------KSILGQLPCTSGSQKAIPPKLII 699

Query: 545 R--HIGLVQQEPILMSGTIRDNIVYGLTEMPTKDEIRQVAKQCFCHNFITRFQSSYDTVI 602
           R   +    QE  +M+ +I++NI++G     T   +    K C             +T++
Sbjct: 700 RGESVAYCPQEAWIMNDSIKENILFGHRYDETFYNL--TVKACELRPDFKILPDGDNTLV 757

Query: 603 GPHGTLLSGGQKQRIAIARALIKKPRILILDEATSALDVESEGAINYTFGQ----LMKKK 658
           G  G  LSGGQK R+++ARA+  +  I +LD+  SA+D     +I +        L+K K
Sbjct: 758 GEKGITLSGGQKARLSLARAVYSRSDIYLLDDVLSAVDAGVRKSIIHRVLDSDTGLLKNK 817

Query: 659 EMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELWDD 699
              I+   + +S +  S+ + VL  DG ++E   + E  +D
Sbjct: 818 --AIILTTNDISVLEHSDRIYVL-QDGRIIEESTYAEAIED 855

>KNAG0K00170 Chr11 complement(15700..20028) [4329 bp, 1442 aa] {ON}
            Anc_5.10 YGR281W
          Length = 1442

 Score =  136 bits (343), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 138/531 (25%), Positives = 242/531 (45%), Gaps = 70/531 (13%)

Query: 214  LLRVLSERLVARLRATVIKKTIHQDAEFFDTHKVGDLISRLGSDAYVVSRSMTQKVSDGF 273
            LL  L  R    L    +++ +H    + DT  +G +++R   D   +   +T+ +    
Sbjct: 921  LLCTLGLRASKWLNLKAVERILHTPMSYLDTTPLGRILNRFTKDTDSLDNELTESIR--- 977

Query: 274  KALICGSVG--IGMMXXXXXXXXXXXXVFTPPVILSASVFGKQISTTSRELQ--EAT--G 327
              L+   VG  IG++            +  P +++   +      +T RE++  EA    
Sbjct: 978  --LMLSQVGNLIGVIVMCIVYLPWFA-IAVPFLLIIFVLICDHYQSTGREIKRLEAVQRS 1034

Query: 328  HLTKVAEEQLSGIKTVQSFVAEQREINRYNFAIRDIFNIGKKAAVIN---AKFFSSTSAM 384
             +     E L G+ T++++ +++R + + ++ I  +   G     +    A    S + +
Sbjct: 1035 FVYNNFNEVLGGMDTIKAYGSQERFLAKTDYLINKMNEAGYLIVAVQRWVAILLDSVAVV 1094

Query: 385  GDL--SFLTV----------LGFGSYLVLQNSLTIGDLTAFMMYTEYTGNSIFGLSTFYS 432
              L  + L V          +G     VLQ    +  +   +  TE   NS   L T+ +
Sbjct: 1095 FALIITLLCVTRAFPISAGSVGVLLTYVLQLPGLLNTILRALTQTENDMNSAERLVTYAT 1154

Query: 433  EIMQGAGAASRLFELTDRVPSISTTKGVKYKPGNGEIEFKNVSFAY-PTRPSNMIFKNLN 491
            E+           E   R P +S  +     P  G+I+F +V+FAY P  P  ++ KN+N
Sbjct: 1155 ELP---------LEAAYRKPEVSPPESW---PEKGDIDFIDVNFAYRPGLP--VVLKNMN 1200

Query: 492  FKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPSSGEILIDGQNINDLNSKSLRRHIGLVQ 551
             KI  G  + I G +G GKST+   L +  + S G+I+IDG +I  +    LR+ + ++ 
Sbjct: 1201 LKINNGEKIGICGRTGAGKSTIMSALYRLNELSDGKIVIDGVDIRKIGLYDLRKKLTIIP 1260

Query: 552  QEPILMSGTIRDN----------------IVYGLTEMPTKDEIRQVAKQCFCHNFITRFQ 595
            Q+P+L  GTIR N                I  G+ E    ++I+ + K    +++    +
Sbjct: 1261 QDPVLFRGTIRKNLDPFKECSDDLLWDALIRTGVVERENLNDIK-LEKPDENNSYSNMHK 1319

Query: 596  SSYDTVIGPHGTLLSGGQKQRIAIARALIKKPRILILDEATSALDVESEGAIN----YTF 651
               D ++   G+  S G++Q +A+ RAL++  +ILILDEATS++D E++G I       F
Sbjct: 1320 FHLDELVEEEGSNFSLGERQMLALTRALVRNSKILILDEATSSVDYETDGKIQSRIVSEF 1379

Query: 652  GQLMKKKEMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELWDDPTS 702
            G      + TI+ IAHRL TI   + ++VL   G + E  K  EL++D  S
Sbjct: 1380 G------DCTILCIAHRLKTILSYDKILVL-EKGVIAEYEKPWELFNDKNS 1423

 Score = 84.7 bits (208), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 64/212 (30%), Positives = 107/212 (50%), Gaps = 22/212 (10%)

Query: 487 FKNLNFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPSSGEILIDGQNINDLNSKSLRRH 546
           F +LN +I  G  + + GP G GK+++   +  + K +SG + ++G+             
Sbjct: 581 FTDLNLEIFKGEFIIVTGPIGTGKTSLLNAMAGFMKQTSGRVEVNGE------------- 627

Query: 547 IGLVQQEPILMSGTIRDNIVYGLT-EMPTKDEIRQVAKQCFCHNFITRFQSSYDTVIGPH 605
             L+   P +++ T+RDNI++G   E    +EI +V   C     +    +   T IG  
Sbjct: 628 -LLLCGYPWILNATVRDNILFGSPYEEARYNEIVEV---CSLDADLKILPAGDRTEIGER 683

Query: 606 GTLLSGGQKQRIAIARALIKKPRILILDEATSALDVE-SEGAINYTFGQLMKKKEMTIVS 664
           G  LSGGQK RI +ARA+ K   I + D+  SA+D    +  ++     ++K K  T + 
Sbjct: 684 GITLSGGQKARINLARAVYKNKDIFLFDDVLSAVDSRVGKHIMDDCLLGILKGK--TRIL 741

Query: 665 IAHRLSTIRRSENVIVLGHDGSVVEMGKFKEL 696
             H+LS I R++ +IV+G +GS  + G   EL
Sbjct: 742 ATHQLSVIERADRIIVVGPNGS-FDFGTLDEL 772

>Suva_10.23 Chr10 complement(44719..49704) [4986 bp, 1661 aa] {ON}
            YLL048C (REAL)
          Length = 1661

 Score =  136 bits (342), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 143/539 (26%), Positives = 245/539 (45%), Gaps = 106/539 (19%)

Query: 230  VIKKTIHQDAEFFDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALI-CGSVGIGMMXX 288
            ++ K +H    FFD    G +++R   D   + + +T  +   F +LI C S  I +   
Sbjct: 1141 ILNKVLHSKLRFFDATPTGRIMNRFSKDIEAIDQELTPYIQGAFYSLIECLSTVILI--- 1197

Query: 289  XXXXXXXXXXVFTPPVILSASV--------FGKQISTTSRELQE----ATGHLTKVAEEQ 336
                       F  P  LS ++         G      SREL+     +   + +   E 
Sbjct: 1198 ----------TFITPQFLSVAIVVSIMYYFIGYFYMAGSRELKRYESISRSPIYQHFSET 1247

Query: 337  LSGIKTVQSFVAEQREINRYNFAIRDIFNIGKKAAVINAKFFSSTSAMGDLSF------- 389
            L G+ T+++F  E R      F   ++  I +     N  FF    A   L+F       
Sbjct: 1248 LVGVTTIRAFGDEGR------FMQENLQKIDEN----NKPFFYLWVANRWLAFRIDMIGS 1297

Query: 390  LTVLGFGSYLV-----LQNSLTIGDLTAFMMYTEYTGNSIFGLSTFYSEIMQGAGAASRL 444
            L + G G +++     L + +    LT  + +TE        L   YSE+     +  R+
Sbjct: 1298 LVIFGAGLFILSNIDHLDSGMAGISLTYAISFTE----GALWLVRLYSEVEMNMNSVERV 1353

Query: 445  FELTDRVPSISTTKGVKYK-------PGNGEIEFKNVSFAY-PTRPSNMIFKNLNFKIEA 496
             E  +    I      ++K       P +G+IE  ++S  Y P  P   + KN++F ++A
Sbjct: 1354 KEYME----IEQEPYNQHKEVPPPQWPQDGKIEVNDLSLRYAPNLPR--VIKNVSFSVDA 1407

Query: 497  GSNVCIVGPSGRGKSTVALLLEKYYKPSSGEILIDGQNINDLNSKSLRRHIGLVQQEPIL 556
             S V IVG +G GKST+   L ++ +P +G I ID  +I++++ + LRR I ++ Q+P L
Sbjct: 1408 QSKVGIVGRTGAGKSTIITALFRFLEPDTGHIKIDNIDISNVDLQRLRRSITIIPQDPTL 1467

Query: 557  MSGTIRDN-----------IVYGLTEMPTKDE-------IRQVAKQCFCHNF--ITRFQS 596
             SGTI+ N           I   L  +    E       +R+VA      +   + +F  
Sbjct: 1468 FSGTIKTNLDPYNEFSNQKIFEALKRVNLVSEEQLQQGTVREVATDTSSADSENVNKFL- 1526

Query: 597  SYDTVIGPHGTLLSGGQKQRIAIARALIKKPRILILDEATSALDVESEGAINYTFGQLMK 656
              ++ +   G+ LS GQ+Q + +AR+L++ P+I++LDEAT+++D  S+  I  T      
Sbjct: 1527 DLESEVSEGGSNLSQGQRQLMCLARSLLRSPKIILLDEATASIDYSSDAKIQETI----- 1581

Query: 657  KKEM---TIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELWDDPTSELSQLLNEKS 712
            +KE    TI++IAHRL ++   + ++V+       + G+ KE +D P    S LLN++S
Sbjct: 1582 RKEFQGSTILTIAHRLRSVIDYDKILVM-------DAGEVKE-YDHP---YSLLLNKQS 1629

 Score = 87.4 bits (215), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 64/235 (27%), Positives = 117/235 (49%), Gaps = 13/235 (5%)

Query: 464 PGNGEIEFKNVSFAYPTRPSNMIFKNLNFKIEAGSNVCIVGPSGRGKSTV--ALLLEKYY 521
           P      F+N + ++     +   K+LN + + G    ++GP+G GK+++  ALL E Y 
Sbjct: 689 PNGKRFAFENSTISWDKDNQDFKLKDLNIEFKTGKLNVVIGPTGSGKTSLLMALLGEMYL 748

Query: 522 KPSSGEILI---DGQNINDLNSKSLRRHIGLVQQEPILMSGTIRDNIVYGLTEMPTKDEI 578
              +G++++   D +    + +      I    Q   L++ T+++NI++      T+   
Sbjct: 749 L--NGKVVVPALDPRQELVVEANGTTNSIAYCSQAAWLLNDTVKNNILFNSQFNETR--Y 804

Query: 579 RQVAKQCFCHNFITRFQSSYDTVIGPHGTLLSGGQKQRIAIARALIKKPRILILDEATSA 638
           + V + C         ++   T IG  G  LSGGQKQR+++ARAL    R ++LD+  SA
Sbjct: 805 KAVVEACGLKRDFEILKAGDLTEIGEKGITLSGGQKQRVSLARALYSNARHVLLDDCLSA 864

Query: 639 LDVESEGAI--NYTFGQLMKKKEMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMG 691
           +D  +   I  N   G LM+ +  T + ++H ++   R+  ++VL  DG V + G
Sbjct: 865 VDSHTASWIYDNCITGPLMEDR--TCILVSHNIALTLRNAELVVLLEDGRVKDQG 917

>NCAS0J00160 Chr10 complement(12361..17325) [4965 bp, 1654 aa] {ON} 
          Length = 1654

 Score =  136 bits (342), Expect = 7e-32,   Method: Compositional matrix adjust.
 Identities = 136/522 (26%), Positives = 230/522 (44%), Gaps = 79/522 (15%)

Query: 230  VIKKTIHQDAEFFDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGSVGIGMMXXX 289
            ++KK +H    FFD+  +G +++R   D   + + +   V   F +L+     I ++   
Sbjct: 1145 LLKKVMHSKLRFFDSTPIGRIMNRFSKDIEAIDQELAPVVQGAFYSLVSCVTTILLI--- 1201

Query: 290  XXXXXXXXXVFTPPVILSASVF--------GKQISTTSRELQE----ATGHLTKVAEEQL 337
                      F  P  LS ++         G      SRE +         + +   E L
Sbjct: 1202 ---------TFITPQFLSVAILVTGLYYLIGYFYLAASREFKRFDSITKSPIYQHFSETL 1252

Query: 338  SGIKTVQSFVAEQREINRYNFAIRDIFNIGKKAAVINAKFFSSTSAMGDLSF-------L 390
             G+ T+++F  E R      F   ++  I +     N  FF    A   LSF       L
Sbjct: 1253 VGVTTIRAFGDEGR------FMQENLSKIDEN----NRPFFYLWVANRWLSFRIDMVGAL 1302

Query: 391  TVLGFGSYLVLQ-NSLTIGDLTAFMMYTEYTGNSIFGLSTFYSEIMQGAGAASRLFELT- 448
             V G GS+++    ++  G     + Y          L   YS +     +  RL E   
Sbjct: 1303 VVFGSGSFIIWNIKNIDAGMAGISLTYAISFTEGALWLVRLYSNVEMNMNSVERLKEYMK 1362

Query: 449  -DRVP-SISTTKGVKYKPGNGEIEFKNVSFAYPTRPSNMIFKNLNFKIEAGSNVCIVGPS 506
             ++ P   +T       P  G+IE  ++S  Y      +I KN+ F +   + + IVG +
Sbjct: 1363 IEQEPYEDATCTPPPEWPQEGKIEVCDLSLRYAEGLPRVI-KNVTFTVAPKAKIGIVGRT 1421

Query: 507  GRGKSTVALLLEKYYKPSSGEILIDGQNINDLNSKSLRRHIGLVQQEPILMSGTIRDNI- 565
            G GKST+   L ++  P +G I ID  +I  +N   LRR I ++ Q+P L +GTI+ N+ 
Sbjct: 1422 GAGKSTIITALFRFLDPETGYIKIDNIDITSINLNKLRRSINIIPQDPTLFTGTIKSNLD 1481

Query: 566  ---VYGLTEMPT---------KDEIRQVAKQCFCHNFITRFQSSYDTVIGPHGTLLSGGQ 613
                Y   +M T         +D    +  +      + +F  + +  I   G+ LS GQ
Sbjct: 1482 PYGEYSDEDMFTALRRVNLVPEDVSSNIETESISSQNVNKFL-NLNNEISEGGSNLSQGQ 1540

Query: 614  KQRIAIARALIKKPRILILDEATSALDVESEGAINYTFGQLMKKKEM---TIVSIAHRLS 670
            +Q + +AR+L++ P+I++LDEAT+++D  S+  I  T      +KE    TI++IAHRL 
Sbjct: 1541 RQLVCLARSLLRSPKIMLLDEATASIDYNSDAKIQETI-----RKEFNSSTILTIAHRLR 1595

Query: 671  TIRRSENVIVLGHDGSVVEMGKFKELWDDPTSELSQLLNEKS 712
            ++   + ++V+       + G+ KE +D P    S LLN+KS
Sbjct: 1596 SVIDYDKILVM-------DAGEVKE-YDHP---YSLLLNKKS 1626

 Score = 97.8 bits (242), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 101/417 (24%), Positives = 187/417 (44%), Gaps = 45/417 (10%)

Query: 304 VILSASVFGKQISTTSRELQEATGHLT----KVAEEQLSGIKTVQSFVAEQREINRYNFA 359
           VIL A+      +T   ++Q+AT  +T    +   E L  I+ ++ F  E    + +  +
Sbjct: 542 VILIAAPANYYFATLLGKIQKATLLVTDKRIQKLNESLQAIRIIKFFSWE----DNFEKS 597

Query: 360 IRDI------FNIGKKAAVINAKFFSSTSAMGDLSFLTVLGFGSYLVLQNSL--TIGDLT 411
           I D+        + +  A + + F    +     S +T   F  Y+ +Q  +  T    T
Sbjct: 598 INDVREQELQLLLKRSMAWVCSSFVWFVTP----SLVTAAAFAFYIYVQKEVLTTPIAFT 653

Query: 412 AFMMYTEYTGNSIFGLSTFYSEIMQGAGAASRLFELTDRVPSISTTKGVKYK-----PGN 466
           A  ++T    N +  LS   S ++Q   +  R+ +       +  T   KY      P  
Sbjct: 654 ALSLFT-LLRNPLDQLSDMLSFVIQSKVSLDRIRDF------LLETDTAKYDQLTVAPQG 706

Query: 467 GEIEFKNVSFAYPTRPSNMIFKNLNFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPSSG 526
            ++EFKN + ++ +   +   K+LN   + G    ++GP+G GK+++ + L    K   G
Sbjct: 707 DQLEFKNTTVSWDSSAQDFKLKDLNIDFKIGKLNVVIGPTGSGKTSLLMALLGEMKIMEG 766

Query: 527 EILIDGQNIND---LNSKSLRRHIGLVQQEPILMSGTIRDNIVYGLTEMPTKDEIR--QV 581
           EI++   +  +   ++       I    Q   L++ T+R+NI++        +E R   V
Sbjct: 767 EIIVPSLDPREDLVVDENGTTNSIAYCSQAAWLLNDTVRNNILFN----SPYNEARYTSV 822

Query: 582 AKQCFCHNFITRFQSSYDTVIGPHGTLLSGGQKQRIAIARALIKKPRILILDEATSALDV 641
            + C         ++   T IG  G  LSGGQKQR+++ARA+    R ++LD+  SA+D 
Sbjct: 823 IEACGLKRDFEILKAGDMTEIGEKGITLSGGQKQRVSLARAMYSNSRHILLDDCLSAVDS 882

Query: 642 ESEGAI--NYTFGQLMKKKEMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKEL 696
            +   I  N   G LM  +  T + ++H ++   ++ +++V+  DG V + G   EL
Sbjct: 883 HTALWIYDNCITGPLMDGR--TCILVSHNIALTLKNADLVVILEDGKVKDQGDPMEL 937

>YLL048C Chr12 complement(41280..46265) [4986 bp, 1661 aa] {ON}
            YBT1Transporter of the ATP-binding cassette (ABC) family
            involved in bile acid transport; similar to mammalian
            bile transporters
          Length = 1661

 Score =  135 bits (341), Expect = 8e-32,   Method: Compositional matrix adjust.
 Identities = 147/545 (26%), Positives = 245/545 (44%), Gaps = 118/545 (21%)

Query: 230  VIKKTIHQDAEFFDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALI-CGSVGIGMMXX 288
            ++ K +H    FFD    G +++R   D   + + +T  +   F +LI C S  I +   
Sbjct: 1141 ILNKVLHSKIRFFDATPTGRIMNRFSKDIEAIDQELTPYIQGAFYSLIECLSTVILI--- 1197

Query: 289  XXXXXXXXXXVFTPPVILSASVF--------GKQISTTSRELQE----ATGHLTKVAEEQ 336
                       F  P  LS ++         G      SREL+     +   + +   E 
Sbjct: 1198 ----------TFITPQFLSVAIVVSILYYFVGYFYMAGSRELKRFESISRSPIYQHFSET 1247

Query: 337  LSGIKTVQSFVAEQREINRYNFAIRDIFNIGKKAAVINAKFFSSTSAMGDLSF------- 389
            L G+ T+++F  E R      F   ++  I +     N  FF    A   L+F       
Sbjct: 1248 LVGVTTIRAFGDEGR------FMQENLHKIDEN----NKPFFYLWVANRWLAFRIDMIGS 1297

Query: 390  LTVLGFGSYLVLQ-NSLTIG----DLTAFMMYTEYTGNSIFGLSTFYSEIMQGAGAASRL 444
            L + G G +++   N+L  G     LT  + +TE        L   YSE+     +  R+
Sbjct: 1298 LVIFGAGLFILFNINNLDSGMAGISLTYAISFTE----GALWLVRLYSEVEMNMNSVERV 1353

Query: 445  FELTDRVPSISTTKGVKYK-------PGNGEIEFKNVSFAY-PTRPSNMIFKNLNFKIEA 496
             E  +    I      ++K       P +G+IE  ++S  Y P  P   + KN++F ++A
Sbjct: 1354 KEYME----IEQEPYNEHKEIPPPQWPQDGKIEVNDLSLRYAPNLPR--VIKNVSFSVDA 1407

Query: 497  GSNVCIVGPSGRGKSTVALLLEKYYKPSSGEILIDGQNINDLNSKSLRRHIGLVQQEPIL 556
             S + IVG +G GKST+   L ++ +P +G I ID  +I+ ++ + LRR I ++ Q+P L
Sbjct: 1408 QSKIGIVGRTGAGKSTIITALFRFLEPETGHIKIDNIDISGVDLQRLRRSITIIPQDPTL 1467

Query: 557  MSGTIRDNIVYGLTEMPTKDEI--RQVAKQCFCHNFITRFQ-------------SSYD-- 599
             SGTI+ N       +   DE   RQ+ +     N I+  Q             SS +  
Sbjct: 1468 FSGTIKTN-------LDPYDEFSDRQIFEALKRVNLISEEQLQQGATRETSNEASSTNSE 1520

Query: 600  ---------TVIGPHGTLLSGGQKQRIAIARALIKKPRILILDEATSALDVESEGAINYT 650
                     + I   G+ LS GQ+Q + +AR+L++ P+I++LDEAT+++D  S+  I  T
Sbjct: 1521 NVNKFLDLSSEISEGGSNLSQGQRQLMCLARSLLRSPKIILLDEATASIDYSSDAKIQET 1580

Query: 651  FGQLMKKKEM---TIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELWDDPTSELSQL 707
                  +KE    TI++IAHRL ++   + ++V+       + G+ KE +D P    S L
Sbjct: 1581 I-----RKEFQGSTILTIAHRLRSVIDYDKILVM-------DAGEVKE-YDHP---YSLL 1624

Query: 708  LNEKS 712
            LN++S
Sbjct: 1625 LNKQS 1629

 Score = 87.0 bits (214), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 105/477 (22%), Positives = 210/477 (44%), Gaps = 36/477 (7%)

Query: 232 KKTIHQDAEFFDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGSVGIGMMXXXXX 291
           +K+I+ D E   +  +G +I+ +  DA+ VS  +   +    +A +   V + ++     
Sbjct: 460 QKSINGDEESTSSANLGAIINLMAIDAFKVSE-ICGYLHSFLEAFVMTVVALALLYRLLG 518

Query: 292 XXXXXXXVFTPPVILSASVFGKQISTTSRELQEATGHLTKVAEEQLSGIKTVQSFVAEQR 351
                  +    ++       K I    ++    T +  +   E    I+ ++ F  E+ 
Sbjct: 519 FAAIVGVLIIVAMLPLNYKLAKYIGDLQKKNLAVTDNRIQKLNEAFQAIRIIKYFSWEE- 577

Query: 352 EINRYNFAIRDIFNIGKKAA---VINAKFFSSTSAMGDLS--FLTVLGFGSYLVLQNSL- 405
                NF  +DI  I +      ++ +  +S +S +  ++   +T   F  Y+ +Q  + 
Sbjct: 578 -----NFE-KDINTIRENELSLLLMRSIVWSISSFLWFVTPTIVTAASFAYYIYVQGEVL 631

Query: 406 -TIGDLTAFMMYTEYTGNSIFGLSTFYSEIMQGAGAASRLFELTDRVPSISTTKGVKYKP 464
            T    TA  ++T    + +  LS   S ++Q   +  R+ +  +   +      +   P
Sbjct: 632 TTPVAFTALSLFT-LLRDPLDRLSDMLSFVVQSKVSLDRVQDFLNENDT-KKYDQLTIDP 689

Query: 465 GNGEIEFKNVSFAYPTRPSNMIFKNLNFKIEAGSNVCIVGPSGRGKSTV--ALLLEKYYK 522
                 F+N + ++     +   K+LN + + G    ++GP+G GK+++  ALL E Y  
Sbjct: 690 NGNRFAFENSTISWDKDNQDFKLKDLNIEFKTGKLNVVIGPTGSGKTSLLMALLGEMYLL 749

Query: 523 PSSGEILIDG-----QNINDLNSKSLRRHIGLVQQEPILMSGTIRDNIVYGLTEMPTKD- 576
             +G++++       + I D N  +    I    Q   L++ T+++NI++     P  + 
Sbjct: 750 --NGKVVVPALEPRQELIVDANGTT--NSIAYCSQAAWLLNDTVKNNILFN---SPFNEA 802

Query: 577 EIRQVAKQCFCHNFITRFQSSYDTVIGPHGTLLSGGQKQRIAIARALIKKPRILILDEAT 636
             + V + C         ++   T IG  G  LSGGQKQR+++ARAL    R ++LD+  
Sbjct: 803 RYKAVVEACGLKRDFEILKAGDLTEIGEKGITLSGGQKQRVSLARALYSNARHVLLDDCL 862

Query: 637 SALDVESEGAI--NYTFGQLMKKKEMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMG 691
           SA+D  +   I  N   G LM+ +  T + ++H ++   R+  ++VL  DG V + G
Sbjct: 863 SAVDSHTASWIYDNCITGPLMEDR--TCILVSHNIALTLRNAELVVLLEDGRVKDQG 917

>Skud_7.614 Chr7 (1027230..1031663) [4434 bp, 1477 aa] {ON} YGR281W
            (REAL)
          Length = 1477

 Score =  135 bits (339), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 139/535 (25%), Positives = 241/535 (45%), Gaps = 59/535 (11%)

Query: 210  GRIILLRVLSERLVARLRATVIKKTIHQDAEFFDTHKVGDLISRLGSDAYVVSRSMTQKV 269
            G+  +L V+       L    +K+ +H    + DT  +G +++R   D    + S+  ++
Sbjct: 951  GQYTILCVMGIMASKWLNLKAVKRILHTPMSYIDTTPLGRILNRFTKD----TDSLDNEL 1006

Query: 270  SDGFKALICGSVGIGMMXXXXXXXXXXXXVFTPPVILSASVFGKQISTTSRELQ--EAT- 326
            ++  + L      I  +            +  P +++   +      ++ RE++  EA  
Sbjct: 1007 TESLRLLTSQFANIVGVCVMCIVYLPWFAIAIPFLLVIFVLIADHYQSSGREIKRLEAVQ 1066

Query: 327  -GHLTKVAEEQLSGIKTVQSFVAEQREINRYNFAIRDIFNIGKKAAVIN--AKFFSSTSA 383
               +     E L G+ T++++ +++R + + +F I  +   G    V+      F    A
Sbjct: 1067 RSFVYNNLNEVLGGMDTIKAYRSQERFLAKSDFLINKMNEAGYLVVVLQRWVGVFLDMVA 1126

Query: 384  MGDLSFLTVLGFGSYLVLQNSLTIGDLTAFMMYTEYTGNSIFGLSTFYSEIMQGA----G 439
            +     +T+L       + ++ ++G L  +++      N+I    T     M  A     
Sbjct: 1127 IVFALIVTLLCVTRAFPI-SAASVGVLLTYVLQLPGLLNTILRAMTQTENDMNSAERLVS 1185

Query: 440  AASRL-FELTDRVPSISTTKGVKYKPGNGEIEFKNVSFAY-PTRPSNMIFKNLNFKIEAG 497
             A+ L  E   R P ++  +     P  GEI  +NV F+Y P  P  ++ KNLN  IE+G
Sbjct: 1186 YATELPLEADYRKPEMTPPESW---PSKGEIVLENVCFSYRPGLP--VVLKNLNLNIESG 1240

Query: 498  SNVCIVGPSGRGKSTVALLLEKYYKPSSGEILIDGQNINDLNSKSLRRHIGLVQQEPILM 557
              + I G +G GKST+   L +  + S+G+ILID  +I+ L    LRR + ++ Q+P+L 
Sbjct: 1241 EKIGICGRTGAGKSTIMSALYRLNELSAGKILIDDVDISKLGLFDLRRKLAIIPQDPVLF 1300

Query: 558  SGTIRDNIVYGLTEMPTKDEIRQ-------VAKQCF------------CHNFITRFQSSY 598
             GTIR N+     +  T DE+         +AK                H  + +F    
Sbjct: 1301 RGTIRKNL--DPFDERTDDELWDALVRGGAIAKNDLSEAKLQKPDKNGTHGRMHKFH--L 1356

Query: 599  DTVIGPHGTLLSGGQKQRIAIARALIKKPRILILDEATSALDVESEGAINY----TFGQL 654
            D  +   G+  S G++Q +A+ RAL+++ +ILILDEATS++D E++G I       FG  
Sbjct: 1357 DQAVEEEGSNFSLGERQLLALTRALVRQSKILILDEATSSVDYETDGKIQARIVEEFG-- 1414

Query: 655  MKKKEMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELWDDPTSELSQLLN 709
                + TI+ IAHRL TI   + ++VL   G V E   F   W   T E S   N
Sbjct: 1415 ----DCTILCIAHRLQTIVNYDRILVL-EKGEVAE---FDTPWTLFTQENSIFRN 1461

 Score = 90.9 bits (224), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 70/212 (33%), Positives = 107/212 (50%), Gaps = 22/212 (10%)

Query: 487 FKNLNFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPSSGEILIDGQNINDLNSKSLRRH 546
           FK+LNF+I+ G  + I GP G GKS++   +    + + G+I ++G    DL        
Sbjct: 604 FKDLNFEIKKGEFIMITGPIGTGKSSLLNAMAGSMRKTDGKIEVNG----DL-------- 651

Query: 547 IGLVQQEPILMSGTIRDNIVYGLTEMPTKDEIRQVAKQCFCHNFITRFQSSYDTVIGPHG 606
             L+   P + +  +RDNI++G   +  K++  +V + C     +    +   T IG  G
Sbjct: 652 --LMCGYPWIQNAPVRDNIIFGSPFI--KEKYNEVIRVCSLKADLDILPAGDMTEIGERG 707

Query: 607 TLLSGGQKQRIAIARALIKKPRILILDEATSALDVESEGAI--NYTFGQLMKKKEMTIVS 664
             LSGGQK RI +AR++ K+  I + D+  SA+D      I      G L  K   T + 
Sbjct: 708 ITLSGGQKARINLARSVYKRKEIYLFDDVLSAVDSRVGKHIMDECLTGMLANK---TRIL 764

Query: 665 IAHRLSTIRRSENVIVLGHDGSVVEMGKFKEL 696
             H+LS I R+  VIVLG DG  V++G   EL
Sbjct: 765 ATHQLSLIERASRVIVLGTDGQ-VDIGTVDEL 795

>Kwal_56.22747 s56 (262824..267440) [4617 bp, 1538 aa] {ON} YLL015W
            (BPT1) - ABC-type transmembrane transporter; highly
            homologous to human MRP1 and to C. elegans mrp-1 [contig
            184] FULL
          Length = 1538

 Score =  134 bits (338), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 144/535 (26%), Positives = 240/535 (44%), Gaps = 62/535 (11%)

Query: 204  GIAANYGRIILLRVLSERLVARLRATVIKKTIHQDAEFFDTHKVGDLISRLGSDAYVVSR 263
             + +N   I+LL V S +   +L  T+    I     FF+T  VG +I+R  SD   +  
Sbjct: 1019 ALLSNARTIVLLLVCSIKASRKLHDTMALAVIRSPMSFFETTPVGRIINRFSSDMNSLDD 1078

Query: 264  SMTQKVSDGFKALICGSVGIGMMXXXXXXXXXXXXVFTPPVILSASVFGKQIS--TTSRE 321
            S+ Q V   F   I     +  +                  +L    F  Q+   T SRE
Sbjct: 1079 SV-QYVMSFFLVSI-----LDYLVVVIIIGYQVPLFLIVNAVLLVIYFYYQVYYVTLSRE 1132

Query: 322  LQE----ATGHLTKVAEEQLSGIKTVQSFVAEQREINRYNFAIRDIFNIGKKAAVINAKF 377
            L+     +   +  +  E L+G   + +F    R  +R+     D  N+      IN  F
Sbjct: 1133 LKRLMSTSFSPIMSMLSETLAGHMIIDAF----RHSDRF-----DYLNVENVQFNINCLF 1183

Query: 378  -FSSTS--------AMGDLSFLTVLGFGSYLVLQN---SLTIGDLTAFMMYTEYTGNSIF 425
             F ST+        ++G L  LT       L  +N   +L+ G +   M Y     N + 
Sbjct: 1184 NFRSTNRWLSIRLESIGALMILTTALLS--LATKNGGHALSTGMVGLLMSYALQVTNKLM 1241

Query: 426  GLSTFYSEIMQGAGAASRLFELTDRVPS----ISTTKGVKYKPGNGEIEFKNVSFAYPTR 481
             +     ++     +  R+ E  D  P     I  ++  K  P  G I FKN S  Y   
Sbjct: 1242 WIVRMSVQLETNIVSVERIVEYCDLPPEAPPVIEDSRPPKNWPSQGLIRFKNYSTRYRAN 1301

Query: 482  PSNMIFKNLNFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPSSGEILIDGQNINDLNSK 541
              + + ++L+ +I+    + IVG +G GKST++L L +  +PS G I IDG +I+ +  K
Sbjct: 1302 -LDPVLRHLDLEIKPQEKIGIVGRTGAGKSTLSLALFRILEPSEGTIDIDGVDISKIGLK 1360

Query: 542  SLRRHIGLVQQEPILMSGTIRDNIVYGLTEMPTKDEIRQVAKQCFCHNFITRF------- 594
             LR ++ ++ Q+     GT+R N+     E  + +EI +  +       I +        
Sbjct: 1361 DLRSNLSIIPQDAQAFEGTVRTNL--DPFEQYSDEEIWKALELSHLKPHILKMAKDDADP 1418

Query: 595  ---QSSYDTVIGPHGTLLSGGQKQRIAIARALIKKPRILILDEATSALDVESEGAINYTF 651
               +    T I  +G+ LS GQ+Q + ++RAL+ + RIL+LDEAT+A+D E++  I  T 
Sbjct: 1419 EKKEDLLQTKISENGSNLSVGQRQLLCLSRALLNRSRILVLDEATAAVDSETDRLIQETI 1478

Query: 652  GQLMKKKEMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELWDDPTSELSQ 706
                K +  TI++IAHR+ T+  S+ ++VL       + G+ KE +D P++ L+Q
Sbjct: 1479 RAEFKDR--TILTIAHRIDTVMDSDKIMVL-------DKGEVKE-FDSPSNLLAQ 1523

 Score = 74.7 bits (182), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 62/237 (26%), Positives = 119/237 (50%), Gaps = 22/237 (9%)

Query: 483 SNMIFKNLN-FKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPSSGEI-LIDGQNINDLNS 540
           S +  KN++ F++  G  VC+VG  G GKST       + +   G++  I     +   +
Sbjct: 639 SQVALKNIDGFQVFKGQLVCVVGRVGAGKST-------FLQALLGQLPCISNSPSHASPT 691

Query: 541 KSLRRH-IGLVQQEPILMSGTIRDNIVYGLTEMPTKDEIRQVAKQCFCHNFITRFQSSYD 599
              R + + L  Q+  +M+ +++DN+++G      +   +   + C     +       +
Sbjct: 692 VHFRANSVALCSQQSWIMNASVKDNVLFG--HRFDEATYKATLEACQLVPDLEILADGDE 749

Query: 600 TVIGPHGTLLSGGQKQRIAIARALIKKPRILILDEATSALDVESEGAINYTFGQLMKK-- 657
           T++G  G  LSGGQK R+++ARA+  +  + +LD+  SA+D E    I     Q++ K  
Sbjct: 750 TLVGEKGISLSGGQKARLSLARAVYSRSDVYLLDDILSAVDAEVCKRI---IEQVLSKKT 806

Query: 658 ---KEMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELW-DDPTSELSQLLNE 710
              K  T++   + +S ++ S+++  L  DG +VE G F ++   D +S+L +L+ E
Sbjct: 807 GLLKNKTVILTTNSISVLKHSQSIYAL-EDGEIVESGSFNDIMRRDDSSKLKRLIVE 862

>CAGL0E03355g Chr5 complement(307479..312086) [4608 bp, 1535 aa] {ON}
            similar to uniprot|P14772 Saccharomyces cerevisiae
            YLL015w BPT1 or uniprot|P39109 Saccharomyces cerevisiae
            YDR135c YCF1
          Length = 1535

 Score =  134 bits (337), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 140/516 (27%), Positives = 235/516 (45%), Gaps = 60/516 (11%)

Query: 225  RLRATVIKKTIHQDAEFFDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGSVGIG 284
            +L   + K  +     FF+T   G +I+R  SD   V  ++    S  F++++   + + 
Sbjct: 1027 KLHNKMAKTIMRSPMSFFETTPTGRIINRFSSDMDSVDTTLQNVFSLFFRSILDYIITVI 1086

Query: 285  MMXXXXXXXXXXXXVFTPPV--ILSASV------FGKQISTTSRELQEATG----HLTKV 332
            ++             F  P+  +L+A +      +       SREL+  T      +  +
Sbjct: 1087 LV------------TFNMPLFFLLNAGLLVIYLYYQSFYIVLSRELKRLTSISYSPIMSL 1134

Query: 333  AEEQLSGIKTVQSFVAEQR----EINRYNFAIRDIFNIGKKAAVINAKFFSSTSAMGDLS 388
              E LSG  T+ ++   +R       R  F+I   FN       ++ +   S  A+  LS
Sbjct: 1135 MGESLSGHFTISAYEQIRRFSHLNYERIQFSINCFFNYRSSNRWLSVRL-QSIGALIVLS 1193

Query: 389  FLTVLGFGSYLVLQNSLTIGDLTAFMMYTEYTGNSIFGLSTFYSEIMQGAGAASRLFELT 448
              T L   S L   + L+ G +   M Y     +S+  +      I     +  R+ E  
Sbjct: 1194 --TGLLALSSLGTDHQLSSGLVGLLMSYALQVTSSLIWIIRSSVLIETNIVSVERIVEYC 1251

Query: 449  DRVPSISTTKGVKY----KPGNGEIEFKNVSFAYPTRPSNMIFKNLNFKIEAGSNVCIVG 504
            D  P     K         P  G+IEFKN S +Y     + + K++N  I  G  + +VG
Sbjct: 1252 DISPEAPEVKEEHRLDDNWPNQGQIEFKNYSTSY-RENLDPVLKHINLVISPGEKIGVVG 1310

Query: 505  PSGRGKSTVALLLEKYYKPSSGEILIDGQNINDLNSKSLRRHIGLVQQEPILMSGTIR-- 562
             +G GKST+++ L +  +P++G I ID  +I  +  + LR HI ++ Q+     GTIR  
Sbjct: 1311 RTGAGKSTLSMALFRLLEPTAGTISIDNIDITSIGLRDLRSHIAIIPQDAQAFEGTIRSN 1370

Query: 563  ---------DNIVYGLTEMPTKDEIRQVAKQCFC---HNFITRFQSSYDTVIGPHGTLLS 610
                     D++ + +     K  +  +AK+      ++  +R +S  D  +   G+ LS
Sbjct: 1371 LDPFEKFSDDDLWHAIELSHLKFHLETIAKEINDDSEYSDRSRLESPLDIPVREAGSNLS 1430

Query: 611  GGQKQRIAIARALIKKPRILILDEATSALDVESEGAINYTFGQLMKKKEMTIVSIAHRLS 670
             GQKQ + +ARAL+ K +IL+LDEAT+++DVE++  I  T  +    +  TI++IAHRL 
Sbjct: 1431 VGQKQLLCLARALLNKSKILVLDEATASVDVETDKIIQETIRKEFADR--TILTIAHRLD 1488

Query: 671  TIRRSENVIVLGHDGSVVEMGKFKELWDDPTSELSQ 706
            T+  S+ +IVL  DG     G+ KE  D P + L Q
Sbjct: 1489 TVFDSDRIIVL--DG-----GEVKEF-DKPETLLEQ 1516

 Score = 70.9 bits (172), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 62/230 (26%), Positives = 113/230 (49%), Gaps = 25/230 (10%)

Query: 491 NFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPSSGEILIDGQNINDLNSKSLRRH---I 547
           NF++   S +C+VG  G GKST+   +       SG         ND  S   + +   +
Sbjct: 639 NFEVPKSSLICVVGRVGAGKSTILKCILGQLPCISGN--------NDHLSPQFQINATTV 690

Query: 548 GLVQQEPILMSGTIRDNIVYGLTEMPTKDE--IRQVAKQCFCHNFITRFQSSYDTVIGPH 605
               QE  +M+ +++DNI++G       DE   +   K C     I       +T++G  
Sbjct: 691 AYCPQEAWIMNASVKDNILFG----HKYDEAFYKATIKACQLLPDIKVLPDGDETMVGEK 746

Query: 606 GTLLSGGQKQRIAIARALIKKPRILILDEATSALDVE-SEGAINYTFGQ---LMKKKEMT 661
           G +LSGGQK R+++ARA+  +  + +LD+  SA+D E  +  I     +   L+K K  +
Sbjct: 747 GIVLSGGQKTRLSLARAVYSRADLYLLDDILSAVDTEVCKTIIKEVLDEKTGLLKDK--S 804

Query: 662 IVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELWDDPT-SELSQLLNE 710
           IV   + +S ++ S  + +L  + S+ + G + ++ ++   S+L  +L+E
Sbjct: 805 IVLATNTISVLKHSTKIYLL-ENKSIAQEGNYDDIMNNQQDSKLKNILHE 853

>CAGL0C03289g Chr3 (328799..333745) [4947 bp, 1648 aa] {ON} similar to
            uniprot|P32386 Saccharomyces cerevisiae YLL048c YBT1
            yeast bile transporter
          Length = 1648

 Score =  134 bits (337), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 135/523 (25%), Positives = 243/523 (46%), Gaps = 74/523 (14%)

Query: 229  TVIKKTIHQDAEFFDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGSVGIGMMXX 288
            +++ + +H    FFD+  +G +++R   D      S+ Q++    +++   ++ +     
Sbjct: 1128 SLLDRVLHARVRFFDSTPIGRIMNRFSKDI----ESIDQEIPPNIQSVFYSAIEVFATLL 1183

Query: 289  XXXXXXXXXXVFTPPVILSASVFGKQISTTSRELQE----ATGHLTKVAEEQLSGIKTVQ 344
                           ++L  S+ G    TTSREL+     +   + +   E L G+ T++
Sbjct: 1184 LISYITPAFFPVAIIIVLGYSIVGFFYLTTSRELKRLDSISKSPIFQHFSETLVGVTTIR 1243

Query: 345  SFVAEQREINRYNFAIRDIFNIGKKAAVINAKFFSSTSAMGDLSF-------LTVLGFGS 397
            +F  EQR I + N ++ D  ++          FF        LSF       L +   G 
Sbjct: 1244 AFGDEQRFI-KENLSMIDQNSM---------PFFYLWVVNRWLSFRIDLIGALVIFSSGV 1293

Query: 398  YLVLQ-NSLTIG----DLTAFMMYTEYTGNSIFGLSTFYSEIMQGAGAASRLFELTD--- 449
            +++L  N++  G     LT  + +TE    +   L   YSE+     +  R+ E  +   
Sbjct: 1294 FILLNINNIDAGLAGISLTYAISFTE----AALWLVRQYSELEMNMNSVERVLEYMNIEQ 1349

Query: 450  ----RVPSISTTKGVKYKPGNGEIEFKNVSFAY-PTRPSNMIFKNLNFKIEAGSNVCIVG 504
                  P+ + T   ++ P +G++E  N+S  Y P  P   + K++ F IE    V IVG
Sbjct: 1350 EPLIADPANAVTPPPQW-PDSGKVEVNNLSLKYAPHLP--YVIKDVTFTIEPLEKVGIVG 1406

Query: 505  PSGRGKSTVALLLEKYYKPSSGEILIDGQNINDLNSKSLRRHIGLVQQEPILMSGTIRDN 564
             +G GKST+   L ++ +  +G I +DG NI +++ K LRR I ++ Q+P L +G+IR N
Sbjct: 1407 RTGAGKSTIITALFRFLEADTGSIKLDGVNIANIDLKRLRRSITIIPQDPTLFAGSIRSN 1466

Query: 565  I----VYGLTEMPT-----------KDEIRQVAKQCFCHNFITRFQSSYDTVIGPHGTLL 609
            +     Y   E+ T           + E      Q      + +F  + ++ I   G+  
Sbjct: 1467 LDPYDEYSDEEIFTALKRVNLVSTEEMEASTSEIQSNSSKNVNKFL-NLESEIAEGGSNF 1525

Query: 610  SGGQKQRIAIARALIKKPRILILDEATSALDVESEGAINYTFGQLMKKKEMTIVSIAHRL 669
            S GQ+Q + +AR+L++ P++++LDEAT+++D  S+  I  T  Q       T+++IAHRL
Sbjct: 1526 SQGQRQLMCLARSLLRMPKVILLDEATASIDYNSDAKIQETIRQEFNNS--TVLTIAHRL 1583

Query: 670  STIRRSENVIVLGHDGSVVEMGKFKELWDDPTSELSQLLNEKS 712
             +I   + ++V+       + G+ KE  D P    S LL +KS
Sbjct: 1584 RSIVDYDKILVM-------DAGEVKEF-DHP---YSLLLEKKS 1615

 Score = 83.2 bits (204), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 69/258 (26%), Positives = 125/258 (48%), Gaps = 19/258 (7%)

Query: 446 ELTDRVPSISTTKGVKYKPGNGEIEFKNVSFAYPTRPSNMIFKNLNFKIEAGSNVCIVGP 505
           E TD+   ++  K  K       + F+NV+  + +   + + +NL+ +   G    IVG 
Sbjct: 689 EETDKYDQLTVDKNGK------RLAFENVTLRWDSDKDSFVLRNLDIEFMTGKLNVIVGA 742

Query: 506 SGRGKSTVALLLEKYYKPSSGEILIDGQNI-NDLNSKS--LRRHIGLVQQEPILMSGTIR 562
           +G GK+++ + L    + S G+I++   +  ++  S++  +   I    Q   L++ T+R
Sbjct: 743 TGSGKTSILMGLLGEMQLSEGKIIVPSLSPRHEYQSQAGVINDSIAYCSQAAWLLNDTVR 802

Query: 563 DNIVYGLTEMPTKDEIR--QVAKQCFCHNFITRFQSSYDTVIGPHGTLLSGGQKQRIAIA 620
           +NI++        D+ R   V + C         ++   T IG  G  LSGGQKQR+++A
Sbjct: 803 NNILFN----APFDQARYDAVVEACSLKRDFQILKAGDSTEIGEKGITLSGGQKQRVSLA 858

Query: 621 RALIKKPRILILDEATSALDVESEGAI--NYTFGQLMKKKEMTIVSIAHRLSTIRRSENV 678
           RAL      L+LD+  SA+D  +   I      G LM+ +  T + + H ++   ++ + 
Sbjct: 859 RALYSSAGHLLLDDCLSAVDSHTALWIYDKCISGPLMEGR--TCILVTHNIALTMKNADF 916

Query: 679 IVLGHDGSVVEMGKFKEL 696
           +V+  DG V E G   EL
Sbjct: 917 VVMIEDGKVKEKGTPIEL 934

>SAKL0H00704g Chr8 (85322..89641) [4320 bp, 1439 aa] {ON} similar to
            uniprot|P53049 Saccharomyces cerevisiae YGR281W YOR1
            Plasma membrane transporter of the ATP- binding cassette
            (ABC) family mediates export of many different organic
            anions including oligomycin
          Length = 1439

 Score =  134 bits (337), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 131/514 (25%), Positives = 228/514 (44%), Gaps = 70/514 (13%)

Query: 226  LRATVIKKTIHQDAEFFDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGSVGIGM 285
            L    +K+ +H    F DT  +G +++R   D   +   +T+ V    +  +  +  I  
Sbjct: 928  LNLKAVKRLLHTPMSFMDTTPLGRVLNRFTKDTDTLDNELTESV----RLFVYQTANIAG 983

Query: 286  MXXXXXXXXXXXXVFTPPVILSASVFGKQISTTSRELQ--EAT--GHLTKVAEEQLSGIK 341
            +            +  P + L   +      ++ RE++  EA     +     E LSG+ 
Sbjct: 984  VIIMCIIYLPWFAIAVPFLGLIFIIVADHYQSSGREIKRLEAVQRSFVYNNFNEVLSGMD 1043

Query: 342  TVQSFVAEQREINRYNFAIRDIFNIGKKAAVINAKFFSSTSAMGDLSFLTVL-------- 393
            T++++ +E R + + +F I  +   G     +  ++ S +  M  ++F  ++        
Sbjct: 1044 TIKAYKSENRFLMKSDFLINRMSEAGYLVVAVQ-RWVSISLDMIAVAFALIITLLCVTRQ 1102

Query: 394  --------GFGSYLVLQNSLTIGDLTAFMMYTEYTGNSIFGLSTFYSEIMQGAGAASRLF 445
                    G     VLQ    +  L   M   E   NS+  +  + +E+ Q A  A R  
Sbjct: 1103 FDISAASVGVLLTYVLQLPGLLNGLLRAMTQAENDMNSVERIVNYATELPQEA--AYRKP 1160

Query: 446  ELTDRVPSISTTKGVKYKPGNGEIEFKNVSFAY-PTRPSNMIFKNLNFKIEAGSNVCIVG 504
            E+T + P           P NGE+ F NVS +Y P  P  ++ K ++  I+ G  + I G
Sbjct: 1161 EMTPQEPW----------PSNGEVVFDNVSLSYRPGLP--LVLKGVSLNIKGGEKIGICG 1208

Query: 505  PSGRGKSTVALLLEKYYKPSSGEILIDGQNINDLNSKSLRRHIGLVQQEPILMSGTIRDN 564
             +G GKST+   L +  + + G +LIDG + + L    LRR + ++ Q+P+L  G+IR N
Sbjct: 1209 RTGAGKSTIMSALYRLCELNEGRVLIDGVDTSKLGLYDLRRKLSIIPQDPVLFKGSIRKN 1268

Query: 565  I-VYGLTE------------MPTKDEIRQVAKQ--------CFCHNFITRFQSSYDTVIG 603
            +  +G  E                +E+ +V  Q           H F        D  + 
Sbjct: 1269 LDPFGEREDEELWSALVRSGTIEAEEVEKVKNQHRDESGSSTGLHKF------HLDQEVE 1322

Query: 604  PHGTLLSGGQKQRIAIARALIKKPRILILDEATSALDVESEGAINYTFGQLMKKKEMTIV 663
              GT  S G++Q +A+ RAL+++ +ILILDEATS++D E++  I     Q   +   TI+
Sbjct: 1323 DDGTNFSLGERQLLALTRALVRQSKILILDEATSSVDHETDAKIQSLIAQEFNR--CTIL 1380

Query: 664  SIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELW 697
             IAHRL TI   + ++VL  +G+V E    + L+
Sbjct: 1381 CIAHRLKTILNYDRLVVL-DNGTVKEFDTPRSLF 1413

 Score = 89.7 bits (221), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 83/258 (32%), Positives = 123/258 (47%), Gaps = 33/258 (12%)

Query: 445 FELTDRVPSISTTKGVKY--KPGNGEIEFKNVSFAYPTRPSNMIFKNLNFKIEAGSNVCI 502
           FE+ D     +  KG  +  KP    ++    +FA   + S   FKNLNF+I+ G  V I
Sbjct: 532 FEVED-AKETAKEKGEAFEEKPKGANVD----AFASSEKASFSGFKNLNFQIQKGELVII 586

Query: 503 VGPSGRGKSTVALLLEKYYKPSSGEILIDGQNINDLNSKSLRRHIGLVQQEPILMSGTIR 562
            G  G GKS++   L  + K + G+I  +G         SL     L+   P + + T+R
Sbjct: 587 TGSIGTGKSSLLNALAGFMKKTEGDIFKNG---------SL-----LLCGYPWIQNTTVR 632

Query: 563 DNIVYGLTEMPTKDEIR--QVAKQCFCHNFITRFQSSYDTVIGPHGTLLSGGQKQRIAIA 620
           DNI++G     + D++R  +V + C     +    +   T IG  G  LSGGQK RI +A
Sbjct: 633 DNILFG----SSFDDVRYKEVIRVCALQADLDILPAGDFTEIGERGITLSGGQKARINLA 688

Query: 621 RALIKKPRILILDEATSALDVESEGAI--NYTFGQLMKKKEMTIVSIAHRLSTIRRSENV 678
           R++ K   I + D+  SA+D      I      G L  K   T +   H+LS I R+  V
Sbjct: 689 RSVYKSMDIYLFDDVLSAVDARVGKHIMDECLMGMLDGK---TRILATHQLSLIERASRV 745

Query: 679 IVLGHDGSVVEMGKFKEL 696
           I LG  GS  ++G  +EL
Sbjct: 746 IFLGAGGS-FDIGTVEEL 762

>Smik_12.11 Chr12 complement(26055..31040) [4986 bp, 1661 aa] {ON}
            YLL048C (REAL)
          Length = 1661

 Score =  134 bits (337), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 144/545 (26%), Positives = 242/545 (44%), Gaps = 118/545 (21%)

Query: 230  VIKKTIHQDAEFFDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALI-CGSVGIGMMXX 288
            ++ K +H    FFD    G +++R   D   + + +T  +   F +LI C S  I +   
Sbjct: 1141 ILNKVLHSKIRFFDATPTGRIMNRFSKDIEAIDQELTPYIQGAFYSLIECLSTVILI--- 1197

Query: 289  XXXXXXXXXXVFTPPVILSASVF--------GKQISTTSRELQE----ATGHLTKVAEEQ 336
                       F  P  LS ++         G      SREL+     +   + +   E 
Sbjct: 1198 ----------TFITPQFLSVAIVVSILYYFVGYFYMAGSRELKRFESISRSPIYQHFSET 1247

Query: 337  LSGIKTVQSFVAEQREINRYNFAIRDIFNIGKKAAVINAKFFSSTSAMGDLSF------- 389
            L G+ T+++F  E R      F   ++  I +     N  FF    A   L+F       
Sbjct: 1248 LVGVTTIRAFGDEGR------FMQENLQKIDEN----NKPFFYLWVANRWLAFRIDMIGS 1297

Query: 390  LTVLGFGSYLVLQ-NSLTIG----DLTAFMMYTEYTGNSIFGLSTFYSEIMQGAGAASRL 444
            L + G G +++   N L  G     LT  + +TE        L   Y+E+     +  R+
Sbjct: 1298 LVIFGAGLFILFNINHLDSGMAGISLTYAISFTE----GALWLVRLYAEVEMNMNSVERV 1353

Query: 445  FELTDRVPSISTTKGVKYK-------PGNGEIEFKNVSFAY-PTRPSNMIFKNLNFKIEA 496
             E  +    I      ++K       P +G+IE  ++S  Y P  P   + KN++F ++A
Sbjct: 1354 KEYME----IEQEPYNQHKEVPPPQWPQDGKIEVNDLSLRYAPNLPR--VIKNVSFSVDA 1407

Query: 497  GSNVCIVGPSGRGKSTVALLLEKYYKPSSGEILIDGQNINDLNSKSLRRHIGLVQQEPIL 556
             S + IVG +G GKST+   L ++ +P +G I ID  +I+ ++ + LRR I ++ Q+P L
Sbjct: 1408 QSKIGIVGRTGAGKSTIITALFRFLEPETGHIKIDNIDISGVDLQRLRRSITIIPQDPTL 1467

Query: 557  MSGTIRDNIVYGLTEMPTKDEI--RQVAKQCFCHNFITRFQSSYDTV------------- 601
             SGTI+ N       +   DE   R++ +     N I+  QS   T              
Sbjct: 1468 FSGTIKTN-------LDPYDEFSDRKIFEALKRVNLISEEQSQQGTTREADNDNSSTNSE 1520

Query: 602  -----------IGPHGTLLSGGQKQRIAIARALIKKPRILILDEATSALDVESEGAINYT 650
                       +   G+ LS GQ+Q + +AR+L++ P+I++LDEAT+++D  S+  I  T
Sbjct: 1521 NVNKFLDLSSEVSEGGSNLSQGQRQLMCLARSLLRSPKIILLDEATASIDYGSDAKIQET 1580

Query: 651  FGQLMKKKEM---TIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELWDDPTSELSQL 707
                  +KE    TI++IAHRL ++   + ++V+       + G+ KE +D P    S L
Sbjct: 1581 I-----RKEFQGSTILTIAHRLRSVIDYDKILVM-------DAGEVKE-YDHP---YSLL 1624

Query: 708  LNEKS 712
            LN++S
Sbjct: 1625 LNKQS 1629

 Score = 86.7 bits (213), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 71/259 (27%), Positives = 123/259 (47%), Gaps = 25/259 (9%)

Query: 449 DRVPSISTTKGVK------YKPGNGEIEFKNVSFAYPTRPSNMIFKNLNFKIEAGSNVCI 502
           DRV      K  K        P      F+N + ++     +   K+LN + + G    +
Sbjct: 668 DRVQDFLNEKDTKKYDQLTIDPNGKRFAFENSTISWDKDNQDFKLKDLNIEFKTGKLNVV 727

Query: 503 VGPSGRGKSTV--ALLLEKYYKPSSGEILIDG-----QNINDLNSKSLRRHIGLVQQEPI 555
           +GP+G GK+++  ALL E Y    SG++++       + + D N  +    I    Q   
Sbjct: 728 IGPTGSGKTSLLMALLGEMYLL--SGKVVVPALEPRQELVVDANGTT--NAIAYCSQGAW 783

Query: 556 LMSGTIRDNIVYGLTEMPTKD-EIRQVAKQCFCHNFITRFQSSYDTVIGPHGTLLSGGQK 614
           L++ T+++NI++     P  +   + V + C         ++   T IG  G  LSGGQK
Sbjct: 784 LLNDTVKNNILFN---SPFNEARYKAVVEACGLKRDFEILKAGDLTEIGEKGITLSGGQK 840

Query: 615 QRIAIARALIKKPRILILDEATSALDVESEGAI--NYTFGQLMKKKEMTIVSIAHRLSTI 672
           QR+++ARAL    R ++LD+  SA+D  +   I  N   G LM+ +  T + ++H ++  
Sbjct: 841 QRVSLARALYSNARHVLLDDCLSAVDSHTASWIYDNCITGPLMEDR--TCILVSHNIALT 898

Query: 673 RRSENVIVLGHDGSVVEMG 691
            R+  ++VL  DG V + G
Sbjct: 899 LRNAELVVLLEDGRVKDQG 917

>Smik_16.27 Chr16 complement(40287..44720) [4434 bp, 1477 aa] {ON}
            YGR281W (REAL)
          Length = 1477

 Score =  133 bits (334), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 129/517 (24%), Positives = 237/517 (45%), Gaps = 67/517 (12%)

Query: 226  LRATVIKKTIHQDAEFFDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGSVGIGM 285
            LRA  +++ +H    + DT  +G +++R   D    + S+  ++++  + +      I  
Sbjct: 969  LRA--VRRILHTPMSYIDTTPLGRILNRFTKD----TDSLDNELTESLRLMTSQFANIVG 1022

Query: 286  MXXXXXXXXXXXXVFTPPVILSASVFGKQISTTSRELQ--EAT--GHLTKVAEEQLSGIK 341
            +            +  P +++   +      ++ RE++  EA     +     E L G+ 
Sbjct: 1023 VCVMCIVYLPWFAIAIPFLLVVFVLIADHYQSSGREIKRLEAVQRSFVYNNLNEVLGGMD 1082

Query: 342  TVQSFVAEQREINRYNFAIRDIFNIGKKAAVIN--AKFFSSTSAMGDLSFLTVLGFGSYL 399
            T++++ +++R + + +F I  +   G    V+      F    A+     +T+L      
Sbjct: 1083 TIKAYRSQERFLAKSDFLINKMNEAGYLVVVLQRWVGIFLDMVAIAFALIITLLCVTRAF 1142

Query: 400  VLQNSLTIGDLTAFMMYTEYTGNSIFGLSTFYSEIMQGA----GAASRL-FELTDRVPSI 454
             + ++ ++G L  +++      N+I    T     M  A      A++L  E   R P +
Sbjct: 1143 PI-SAASVGVLLTYVLQLPGLLNTILRAMTQTENDMNSAERLVSYATKLPLEADYRKPEM 1201

Query: 455  STTKGVKYKPGNGEIEFKNVSFAY-PTRPSNMIFKNLNFKIEAGSNVCIVGPSGRGKSTV 513
            +  +     P  G+I F+NV FAY P  P  ++ KN N  I++G  + I G +G GKST+
Sbjct: 1202 TPPESW---PSKGKIVFENVDFAYRPGLP--IVLKNFNLDIKSGEKIGICGRTGAGKSTI 1256

Query: 514  ALLLEKYYKPSSGEILIDGQNINDLNSKSLRRHIGLVQQEPILMSGTIRDNI-------- 565
               L +  + ++G+I ID  +I+ L    LR+ + ++ Q+P+L  GTIR N+        
Sbjct: 1257 MSALYRLNELTAGQIFIDDVDISQLGLFDLRKKLAIIPQDPVLFRGTIRKNLDPFDERTD 1316

Query: 566  -----------VYGLTEMPTKDEIR-QVAKQCFCHNFITRFQSSYDTVIGPHGTLLSGGQ 613
                            ++P   E+R Q   +   H  + +F    D  +   G+  S G+
Sbjct: 1317 DELWDALVRGGAIAKNDLP---EVRLQKPDENGTHGRMHKFH--LDQAVEEEGSNFSLGE 1371

Query: 614  KQRIAIARALIKKPRILILDEATSALDVESEGAINY----TFGQLMKKKEMTIVSIAHRL 669
            +Q +A+ RAL+++ +ILILDEATS++D E++G I       FG      + TI+ IAHRL
Sbjct: 1372 RQLLALTRALVRQSKILILDEATSSVDYETDGKIQTRIVEEFG------DCTILCIAHRL 1425

Query: 670  STIRRSENVIVLGHDGSVVEMGKFKELWDDPTSELSQ 706
             TI   + ++VL   G V E       +D P +  SQ
Sbjct: 1426 KTIVNYDRILVL-EKGEVAE-------YDTPWALFSQ 1454

 Score = 91.3 bits (225), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 69/211 (32%), Positives = 107/211 (50%), Gaps = 20/211 (9%)

Query: 487 FKNLNFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPSSGEILIDGQNINDLNSKSLRRH 546
           FK+LNF I+ G  + I GP G GKS++   +    +   G+I ++G    DL        
Sbjct: 604 FKDLNFDIQKGEFIMITGPIGTGKSSLLNAMAGSMRKVDGKIEVNG----DL-------- 651

Query: 547 IGLVQQEPILMSGTIRDNIVYGLTEMPTKDEIRQVAKQCFCHNFITRFQSSYDTVIGPHG 606
             L+   P + + T+RDNI++G      K++  +V   C     +    +   T IG  G
Sbjct: 652 --LMCGYPWIQNATVRDNIIFG--SPFNKEKYDEVIHVCSLKADLDILPAGDMTEIGERG 707

Query: 607 TLLSGGQKQRIAIARALIKKPRILILDEATSALDVE-SEGAINYTFGQLMKKKEMTIVSI 665
             LSGGQK RI +AR++ KK  I + D+  SA+D    +  ++     ++  K  T +  
Sbjct: 708 ITLSGGQKARINLARSVYKKKDIYLFDDVLSAVDSRVGKHIMDECLTGMLSNK--TRILA 765

Query: 666 AHRLSTIRRSENVIVLGHDGSVVEMGKFKEL 696
            H+LS I R+  VIVLG DG  V++G  +EL
Sbjct: 766 THQLSLIERASRVIVLGTDGK-VDIGTVEEL 795

>KLTH0C09240g Chr3 complement(766620..771260) [4641 bp, 1546 aa] {ON}
            similar to uniprot|P14772 Saccharomyces cerevisiae
            YLL015W BPT1 ABC type transmembrane transporter of
            MRP/CFTR family found in vacuolar membrane involved in
            the transport of unconjugated bilirubin and in heavy
            metal detoxification via glutathione conjugates along
            with Ycf1p
          Length = 1546

 Score =  133 bits (334), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 144/538 (26%), Positives = 239/538 (44%), Gaps = 75/538 (13%)

Query: 212  IILLRVLSERLVARLRATVIKKTIHQDAEFFDTHKVGDLISRLGSDAYVVSRSMTQKVSD 271
            I+LL V S R   +L  ++    +     FF+T  VG +I+R  SD           V D
Sbjct: 1036 IVLLLVCSIRASRKLHDSMAVAVLRSPMSFFETTPVGRIINRFSSD--------MNSVDD 1087

Query: 272  GFKALICGSVGIGMMXXXXXXXXXXXXVFTPPVIL--SASVFGKQIS------TTSRELQ 323
              + +I       ++             +  P+ L  +A++ G  +       T SREL+
Sbjct: 1088 NVQYVI----SFFLISILDYVVVVVIIGYQVPLFLLVNAALLGIYLYYQVFYVTLSRELK 1143

Query: 324  EATGHLTKVAEEQLSGIKTVQS-FVAEQREINRYN-FAIRDIFNIGKKAAVINAKF-FSS 380
                   ++     S I ++ S  +A    IN +N F+  D  NI      IN  F F S
Sbjct: 1144 -------RLMSTSFSPIMSMLSETLAGHMVINAFNHFSRFDYLNIEAVQFNINCVFNFRS 1196

Query: 381  TSAMGDLSFLTVLGFGSYLVLQNSL-----TIGD-------LTAFMMYTEYTGNSIFGLS 428
            T+    +   ++   G+ ++L  +L     T GD       +   M Y     N +  + 
Sbjct: 1197 TNRWLSIRLESI---GALMILTTALLSLATTTGDKALSTGMVGLLMSYALQVTNKLMWIV 1253

Query: 429  TFYSEIMQGAGAASRLFELTDRVPS----ISTTKGVKYKPGNGEIEFKNVSFAYPTRPSN 484
                ++     +  R+ E  D  P     I   +  K  P  G + FK+ S  Y     +
Sbjct: 1254 RMSVQLETNVVSVERIVEYCDLPPEAPPVIEDCRPEKNWPAQGHVVFKDYSARY-RENLD 1312

Query: 485  MIFKNLNFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPSSGEILIDGQNINDLNSKSLR 544
             + K LN +I     + IVG +G GKST++L L +  +P  G I+IDG +I  +    LR
Sbjct: 1313 PVLKKLNVEINPQEKIGIVGRTGAGKSTLSLALFRILEPCGGTIVIDGVDITKIGLADLR 1372

Query: 545  RHIGLVQQEPILMSGTIRDNIVYGLTEMPTKDEIRQVAKQCFCHNFITRFQSS------- 597
             H+ ++ Q+     G++R N+     E  + DEI +  +       I +  +        
Sbjct: 1373 SHLSIIPQDAQAFEGSVRSNL--DPFEQYSDDEIWRALELSHLKPHILKMANEEGPEKTK 1430

Query: 598  --YDTVIGPHGTLLSGGQKQRIAIARALIKKPRILILDEATSALDVESEGAINYTFGQLM 655
               +T I  +G+ LS GQ+Q + ++RAL+ + RIL+LDEAT+A+D E++  I  T     
Sbjct: 1431 NLLETKISENGSNLSVGQRQLLCLSRALLNRSRILVLDEATAAVDSETDRLIQETIRAEF 1490

Query: 656  KKKEMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELWDDPTSELSQLLNEKST 713
            K +  TI++IAHR+ T+  S+ ++VL       + G+ KE +D P    S LL +K+T
Sbjct: 1491 KDR--TILTIAHRIDTVMDSDKIMVL-------DQGEVKE-FDSP----SNLLADKNT 1534

 Score = 71.2 bits (173), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 64/238 (26%), Positives = 118/238 (49%), Gaps = 24/238 (10%)

Query: 483 SNMIFKNLN-FKIEAGSNVCIVGPSGRGKSTV--ALLLEKYYKPSSGEILIDGQNINDLN 539
           S +  KN++ F+   G  VC+VG  G GKST   ALL         G++     + +   
Sbjct: 648 SRVALKNIDGFQALKGQLVCVVGRVGAGKSTFLHALL---------GQLPCISSSHDQAT 698

Query: 540 SKSLRR--HIGLVQQEPILMSGTIRDNIVYGLTEMPTKDEIRQVAKQCFCHNFITRFQSS 597
            K   R   + L  Q+  +++ +++ N+++G      +   +   + C     +      
Sbjct: 699 PKMHFRCDSVALCSQQAWILNASVKYNVLFG--HKYDEASYKATIEACQLLPDLGILADG 756

Query: 598 YDTVIGPHGTLLSGGQKQRIAIARALIKKPRILILDEATSALDVE-SEGAINYTFGQ--- 653
            +T++G  G  LSGGQK RI++ARA+  +  + +LD+  SA+D E  +  I++   +   
Sbjct: 757 DETLVGEKGISLSGGQKARISLARAVYSRSDVYLLDDILSAVDAEVCKRIIDHVLSRKTG 816

Query: 654 LMKKKEMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELWD-DPTSELSQLLNE 710
           L+K K  T++   + +S ++ S+++  L  +G +VE G F E+   D  S+L  L+ E
Sbjct: 817 LLKNK--TVILTTNSISVLKHSQSIYAL-ENGEIVERGSFDEIMSKDAESKLKTLIAE 871

>Kpol_1033.28 s1033 complement(69924..74519) [4596 bp, 1531 aa] {ON}
            complement(69924..74519) [4596 nt, 1532 aa]
          Length = 1531

 Score =  133 bits (334), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 131/489 (26%), Positives = 227/489 (46%), Gaps = 41/489 (8%)

Query: 226  LRATVIKKTIHQDAEFFDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGSVGIGM 285
            L ++++   +     FF+T  +G +++R  +D Y +   + +  S  F      +V +  
Sbjct: 1033 LHSSMVSSILRAPMTFFETTPIGRILNRFSNDVYKIDEVLGRSFSQFF----VNAVKVSF 1088

Query: 286  MXXXXXXXXXXXXVFTPPVILSASVFGKQISTTSRELQEATGHLTKVA-----EEQLSGI 340
                         +   P+ +    + +    TSREL+     +TK       +E L G+
Sbjct: 1089 TILVICWNTWQFILLVIPMGVLYLYYQQYYLRTSRELRRLDS-ITKSPIYAHFQESLGGL 1147

Query: 341  KTVQSFVAEQREINRYNFAIRDIFNIGKKAAVINAKFFSSTSAMGDLSFLTVLGFGSYLV 400
             T++ +  ++R I+     + +  N+      IN+  + +   +  L  L + G  S  +
Sbjct: 1148 ATIRGYEQQKRFIHINQARVDN--NMSAYYPSINSNRWLAYR-LEFLGSLIIFGAASLSI 1204

Query: 401  LQNSLTIGDLTAFMM-----YTEYTGNSIFGLSTFYSEIMQGAGAASRL---FELTDRVP 452
            L+  L  G LTA M+     Y      S+  +     E+     +  R+    EL    P
Sbjct: 1205 LK--LRDGTLTAGMIGLSLSYALQVTQSLNWIVRMTVEVETNIVSVERIKEYAELKSEAP 1262

Query: 453  SISTTK-GVKYKPGNGEIEFKNVSFAYPTRPS-NMIFKNLNFKIEAGSNVCIVGPSGRGK 510
             I   K   +  P  G I+F+N S  Y  RP  +++ KN++  I+    V IVG +G GK
Sbjct: 1263 LIIEEKRPSENWPERGAIKFENYSTRY--RPDLDLVLKNISLDIKPQEKVGIVGRTGAGK 1320

Query: 511  STVALLLEKYYKPSSGEILIDGQNINDLNSKSLRRHIGLVQQEPILMSGTIRDNIVYGLT 570
            S++ L L +  + + G I++DG NI+++    LR  + ++ Q+  +  GTIR+NI    T
Sbjct: 1321 SSLTLALFRIIEAAEGSIIVDGLNISEIGLYDLRHKLSIIPQDSQVFEGTIRENI--DPT 1378

Query: 571  EMPTKDEIRQVAKQCFCHNFITRF---------QSSYDTVIGPHGTLLSGGQKQRIAIAR 621
             + T ++I    +       I R           ++  T +   G  LS GQ+Q + +AR
Sbjct: 1379 NIYTDEQIWNALELSHLKQHILRMNEESVNGSENNALYTRVTEGGNNLSVGQRQLMCLAR 1438

Query: 622  ALIKKPRILILDEATSALDVESEGAINYTFGQLMKKKEMTIVSIAHRLSTIRRSENVIVL 681
            AL+   +ILILDEAT+A+DVE++  I  T     K +  TI++IAHRL+TI  S+ ++VL
Sbjct: 1439 ALLVPSKILILDEATAAVDVETDSLIQETIRTAFKDR--TILTIAHRLNTIMDSDKIVVL 1496

Query: 682  GHDGSVVEM 690
               G V E 
Sbjct: 1497 D-KGEVAEF 1504

 Score = 93.6 bits (231), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 97/398 (24%), Positives = 177/398 (44%), Gaps = 44/398 (11%)

Query: 330 TKVAEEQLSGIKTVQSFVAEQ-----REINRYNFAIRDIFNIGKKAAVINAKFFSSTSAM 384
           T+V  E L+ IK+++ +  EQ      E  R    ++++  IG   A+ N +F +    +
Sbjct: 485 TRVINEILNNIKSLKLYAWEQPYKEKLEHVRNEKELKNLTRIGVFNAMTNFQF-NLVPFL 543

Query: 385 GDLSFLTVLGFGSYLVLQNSLTIGDLTAFMMYTEYTGNSIFGLSTFYSEIMQGAGAASRL 444
              S   V  +     L   L    LT F + T      +  L    +  ++ + + SRL
Sbjct: 544 VSCSTFAVFVYIEDKPLTTDLVFPALTLFNLLTF----PLAALPIVITAFIEASVSMSRL 599

Query: 445 FEL-------TD---RVPSISTTKGVKYKPGNGEIEFKNVSFAYPTRPSNMI-FKNLNFK 493
           F         TD   R+P +     +    G+      N +F +  +P   +  KN+ F+
Sbjct: 600 FSFMTNEELQTDAIQRLPPVKKQGDIAVNIGD------NATFLWKRKPEYKVALKNIEFQ 653

Query: 494 IEAGSNVCIVGPSGRGKSTVALLLEKYYKPSSGEILIDGQNINDLNSKSLRRHIGLVQQE 553
            + G   CIVG  G GKS                IL D   +      ++  ++  V Q 
Sbjct: 654 AKKGELACIVGKVGSGKSAFI-----------QSILGDLFRVKGF--ATIHGNVAYVSQL 700

Query: 554 PILMSGTIRDNIVYGLTEMPTKDEIRQVAKQCFCHNFITRFQSSYDTVIGPHGTLLSGGQ 613
           P +M+GT++DNI++G      ++   +  + C     ++       T++G  G  LSGGQ
Sbjct: 701 PWIMNGTVKDNILFG--HKYNQEFYEKTLRACALTIDLSILPDGDQTLVGEKGISLSGGQ 758

Query: 614 KQRIAIARALIKKPRILILDEATSALDVE-SEGAINYTFGQLMKKKEMTIVSIAHRLSTI 672
           K R+++ARA+  +  + +LD+  +A+D   S+  I +  G        T V   +++S +
Sbjct: 759 KARLSLARAVYARADVYLLDDPLAAVDEHVSKHLIQHVIGPNGLLHTKTRVLATNKISVL 818

Query: 673 RRSENVIVLGHDGSVVEMGKFKELWDDPTSELSQLLNE 710
             ++N+ +L  DG +V+ G + E+ D+  S L +L++E
Sbjct: 819 SIADNITLLD-DGEIVQQGTYNEVTDNINSPLCKLISE 855

>KAFR0L00190 Chr12 complement(21836..26797) [4962 bp, 1653 aa] {ON}
            Anc_4.6 YHL035C
          Length = 1653

 Score =  133 bits (334), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 144/525 (27%), Positives = 233/525 (44%), Gaps = 77/525 (14%)

Query: 230  VIKKTIHQDAEFFDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGSVGIGMMXXX 289
            ++ K +H    FFD+  +G +++R   D   + + +       F + I     I ++   
Sbjct: 1134 LLDKVLHAKLRFFDSTPIGRIMNRFSKDMEGIDQDLAPYFQGAFYSFIECITTIILITFI 1193

Query: 290  XXXXXXXXXVFTPPVILSASVFGKQISTTSRELQE----ATGHLTKVAEEQLSGIKTVQS 345
                     +    V +   + G    T SREL+         + +   E L G+ T+++
Sbjct: 1194 TPQFLSVAII----VGMLYYMIGYFYLTGSRELKRLDSITKSPIYQHFSETLVGVTTIRA 1249

Query: 346  FVAEQREINRYNFAIRDIFNIGKKAAVINAKFFSSTSAMGDLSF-LTVLG----FGS-YL 399
            F  E R      F   ++  I +     N  FF    A   LSF + V+G    FGS   
Sbjct: 1250 FGDESR------FLRENLLKIDEN----NRPFFYLWVANRWLSFRIDVIGALVVFGSGIF 1299

Query: 400  VLQNSLTIGD------LTAFMMYTEYTGNSIFGLSTFYSEIMQGAGAASRLFELT----- 448
            +L N  TI        LT  + +TE        L  FYSE+     +  R+ E       
Sbjct: 1300 ILTNINTIDSGMAGISLTYAISFTE----GALWLVRFYSEVEMNMNSVERVHEYMTIEQE 1355

Query: 449  --DRVPSISTTKGVKYKPGNGEIEFKNVSFAYPTRPSNMIFKNLNFKIEAGSNVCIVGPS 506
              D V  +S +K     P  G IE  ++S  Y      +I KN+ F ++  + V +VG +
Sbjct: 1356 PYDEV-QVSDSKVPADWPEEGRIEVSDLSLRYAAHLPKVI-KNVTFNVDPRAKVGVVGRT 1413

Query: 507  GRGKSTVALLLEKYYKPSSGEILIDGQNINDLNSKSLRRHIGLVQQEPILMSGTIRDNI- 565
            G GKST+   L ++ +  +G I IDG +I  +N   LRR I ++ Q+P L SGTI+ N+ 
Sbjct: 1414 GAGKSTIITALFRFLEAETGYIKIDGLDITSVNLTRLRRSITIIPQDPTLFSGTIKSNLD 1473

Query: 566  ------------------VYGLTEMPTKDEIRQVAKQCFCHNFITRFQSSYDTVIGPHGT 607
                              +    E+ ++ E           N I RF    ++ I   GT
Sbjct: 1474 PYDEYKDEEVFEALRRVNLVTEEELSSRTENNNDEASVSSKN-INRFLD-LESEIAEGGT 1531

Query: 608  LLSGGQKQRIAIARALIKKPRILILDEATSALDVESEGAINYTFGQLMKKKEMTIVSIAH 667
              S GQ+Q I +AR+L++ P+IL+LDEAT+++D +S+  +  T     +  E TI++IAH
Sbjct: 1532 NFSQGQRQLICLARSLLRSPKILLLDEATASIDYDSDAKVQETIRT--EFSESTILTIAH 1589

Query: 668  RLSTIRRSENVIVLGHDGSVVEMGKFKELWDDPTSELSQLLNEKS 712
            RL ++   + ++V+G        G+ KE +D P    S LLN+ S
Sbjct: 1590 RLRSVIDYDKILVMG-------AGEVKE-YDHP---YSLLLNKNS 1623

 Score = 96.3 bits (238), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 67/230 (29%), Positives = 114/230 (49%), Gaps = 9/230 (3%)

Query: 467 GEIEFKNVSFAYPTRPSNMIFKNLNFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPSSG 526
            +I FKN + A+     +   +NLN   + G    I+GP+G GK+++ + L        G
Sbjct: 699 NQIAFKNTTVAWDNSRDSFKLRNLNIDFKVGKLNVIIGPTGSGKTSLLMALLGEMNLLEG 758

Query: 527 EILIDGQNI-NDL--NSKSLRRHIGLVQQEPILMSGTIRDNIVYGLTEMPTKDEIRQVAK 583
           +I++   N  +DL   S      I    Q   L++ T+R+NI++      T+     V +
Sbjct: 759 QIVVPALNARHDLIVESDGTTNSIAYCSQAAWLLNDTVRNNILFNSPYNETR--YHNVVE 816

Query: 584 QCFCHNFITRFQSSYDTVIGPHGTLLSGGQKQRIAIARALIKKPRILILDEATSALDVES 643
            C         ++   T IG  G  LSGGQKQRI++ARAL    R ++LD+  SA+D  +
Sbjct: 817 ACGLRRDFEILKAGDMTEIGEKGIALSGGQKQRISLARALYSNSRHVLLDDCLSAVDAHT 876

Query: 644 EGAI--NYTFGQLMKKKEMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMG 691
              +  N   G LM+ +  T + ++H ++   R+ +++V+  DG V + G
Sbjct: 877 ALWVYDNCITGPLMEGR--TCILVSHNIALTLRNADLVVMLEDGQVKDQG 924

>Suva_10.59 Chr10 (121460..126142) [4683 bp, 1561 aa] {ON} YLL015W
            (REAL)
          Length = 1561

 Score =  133 bits (334), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 144/544 (26%), Positives = 243/544 (44%), Gaps = 70/544 (12%)

Query: 203  VGIAA--NYGRIILLRVLSERLVARLRATVIKKTIHQDAEFFDTHKVGDLISRLGSDAYV 260
            VG AA  N   II+L   S R   +L   + K  I     FF+T  VG +I+R  SD   
Sbjct: 1029 VGSAAFNNLRSIIMLLYCSIRGSKKLHENMAKSVIRSPMVFFETTPVGRIINRFSSDMDA 1088

Query: 261  VSRSMTQKVSDGFKALICGSVGIGMMXXXXXXXXXXXXVFTPPVILSASVFGKQISTTSR 320
            V  S+    S  FK+++   V I ++            VF   +++    +       SR
Sbjct: 1089 VDSSLQYVFSFFFKSILTYLVTIVLVGYNMPWFL----VFNMFLLVIYIYYQTFYIVLSR 1144

Query: 321  ELQE----ATGHLTKVAEEQLSGIKTVQSFVAEQREINRYNFAIRDIFNIGKKAAVINAK 376
            EL+     +   +  +  E L+G   + ++   +R I           N  K  + I+  
Sbjct: 1145 ELKRLISISYSPIMSLMSESLNGYSIIDAYNHYERFI---------YLNYDKIQSNIDLV 1195

Query: 377  F-FSSTSAMGDLSFLTVLGFGSYLVL------------QNSLTIGDLTAFMMYTEYTGNS 423
            F F S +    +   T+   G+ +VL            +N L+ G +   M Y+    +S
Sbjct: 1196 FNFRSINRWLSVRLQTI---GATIVLATALLALATINTKNQLSSGMVGLLMAYSFEVTSS 1252

Query: 424  IFGLSTFYSEIMQGAGAASRLFELTDRVPSISTTKGVKYK----PGNGEIEFKNVSFAYP 479
            +  +      I     +  R+ E  +  P   +    K      P  G IEFKN S  Y 
Sbjct: 1253 LTWIVRTTVMIETNIVSVERIVEYCELPPEAQSINPEKRPDENWPSEGRIEFKNYSTKY- 1311

Query: 480  TRPSNMIFKNLNFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPSSGEILIDGQNINDLN 539
                + + K++N  I+    + IVG +G GKST++L L +  +PS GEI+ID  NI++L 
Sbjct: 1312 RENLDPVLKDINVSIQPCEKIGIVGRTGAGKSTLSLALFRILEPSEGEIIIDDVNISELG 1371

Query: 540  SKSLRRHIGLVQQEPILMSGTIRDNIVYGLTEMPTKDEIRQVAKQCFCHNFITRF----- 594
               LR ++ ++ Q+     GT+R N+        ++DE+++  +     + + +      
Sbjct: 1372 LFDLRSNLAIIPQDAQAFEGTVRTNL--DPFNRYSEDELKRAIELAHLKSHLEKMLGNEA 1429

Query: 595  -------------QSSYDTVIGPHGTLLSGGQKQRIAIARALIKKPRILILDEATSALDV 641
                         +   D  I  +G+ LS GQ+Q + +ARAL+   +IL+LDEAT+++D+
Sbjct: 1430 ENNDINVEERGNAKDILDVKINENGSNLSVGQRQLLCLARALLSHSKILVLDEATASVDM 1489

Query: 642  ESEGAINYTFGQLMKKKEMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELWDDPT 701
            E++  I  T  +  K +  TI++IAHR+ T+  S+ +IVL       + G  KE +D P+
Sbjct: 1490 ETDKIIQDTIRREFKDR--TILTIAHRIDTVLDSDKIIVL-------DKGNVKE-FDSPS 1539

Query: 702  SELS 705
              LS
Sbjct: 1540 KLLS 1543

 Score = 85.5 bits (210), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 100/420 (23%), Positives = 185/420 (44%), Gaps = 50/420 (11%)

Query: 331 KVAEEQLSGIKTVQSFVAEQREINRYNFAIRD--IFNIGKKAAVINAKFFSSTSA--MGD 386
           K   E L+ IK+++ +  E+  + + N    D  + N  K   V N  +F+      M  
Sbjct: 473 KTITELLNAIKSIKLYAWEEPMMKKLNHVRNDMELKNFRKIGIVSNLIYFAWNCVPLMVT 532

Query: 387 LSFLTVLGFGSYLVLQNSLTIGDLTAFMMYTEYTGNSIFGLSTFYSEIMQGAGAASRL-- 444
            S   +    +   L  S+    L+ F +      ++I+ + +  + I++ + +  RL  
Sbjct: 533 CSTFGLFSLFNDTPLSPSIVFPSLSLFNI----LNSAIYSVPSMINSIIETSVSMERLKS 588

Query: 445 FELTDRVPS--ISTTKGVKYKPGNGEIEFKNVSFAYPTR--------------------- 481
           F L+D V    I  T           +E  N++F + ++                     
Sbjct: 589 FLLSDEVDDSFIERTNSPSSDSALPVLEMNNITFLWKSKEALASSQLENNSRTDEESIMG 648

Query: 482 PSNMIFKNL-NFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPSSGEILIDGQNINDLNS 540
            S +  KN+ +F+ + G  +C+VG  G GKST       + K   G++     +   L  
Sbjct: 649 SSQIALKNIEHFEAKRGDLICVVGRVGAGKST-------FLKAILGQLPCMSGSKESLAP 701

Query: 541 KSLRR--HIGLVQQEPILMSGTIRDNIVYGLTEMPTKDEIRQVAKQCFCHNFITRFQSSY 598
           K + R   +    QE  +M+ ++R+NI++G      K       K C     +       
Sbjct: 702 KLIIRASSLAYCSQESWIMNASVRENILFG--HKFDKAYYDLTIKACQLLPDLKILPDGD 759

Query: 599 DTVIGPHGTLLSGGQKQRIAIARALIKKPRILILDEATSALDVE-SEGAINYTF-GQLMK 656
           +T++G  G  LSGGQK R+++ARA+  +  I +LD+  SA+D E S+  I +   G+   
Sbjct: 760 ETLVGEKGISLSGGQKARLSLARAVYSRADIYLLDDILSAVDAEVSKNIIEHVLIGKTAL 819

Query: 657 KKEMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELW--DDPTSELSQLLNEKSTP 714
            K  TI+   + +S ++ S+ +  L  +G +VE G ++ +   ++ +S+L +LL E  TP
Sbjct: 820 LKNKTIILTTNTVSILKHSQMIYAL-ENGEIVEQGNYESVMKRENDSSKLKKLLEEFDTP 878

>Suva_10.60 Chr10 (123173..126145) [2973 bp, 990 aa] {ON} YLL015W
           (REAL)
          Length = 990

 Score =  132 bits (332), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 147/545 (26%), Positives = 244/545 (44%), Gaps = 72/545 (13%)

Query: 203 VGIAA--NYGRIILLRVLSERLVARLRATVIKKTIHQDAEFFDTHKVGDLISRLGSDAYV 260
           VG AA  N   II+L   S R   +L   + K  I     FF+T  VG +I+R  SD   
Sbjct: 458 VGSAAFNNLRSIIMLLYCSIRGSKKLHENMAKSVIRSPMVFFETTPVGRIINRFSSDMDA 517

Query: 261 VSRSMTQKVSDGFKALICGSVGIGMMXXXXXXXXXXXXVFTPPVILSASVFGKQISTTSR 320
           V  S+    S  FK+++   V I ++            VF   +++    +       SR
Sbjct: 518 VDSSLQYVFSFFFKSILTYLVTIVLVGYNMPWFL----VFNMFLLVIYIYYQTFYIVLSR 573

Query: 321 ELQE----ATGHLTKVAEEQLSGIKTVQSFVAEQREINRYNFAIRDIF-NIGKKAAVINA 375
           EL+     +   +  +  E L+G             I+ YN   R I+ N  K  + I+ 
Sbjct: 574 ELKRLISISYSPIMSLMSESLNGYSI----------IDAYNHYERFIYLNYDKIQSNIDL 623

Query: 376 KF-FSSTSAMGDLSFLTVLGFGSYLVL------------QNSLTIGDLTAFMMYTEYTGN 422
            F F S +    +   T+   G+ +VL            +N L+ G +   M Y+    +
Sbjct: 624 VFNFRSINRWLSVRLQTI---GATIVLATALLALATINTKNQLSSGMVGLLMAYSFEVTS 680

Query: 423 SIFGLSTFYSEIMQGAGAASRLFELTDRVPSISTTKGVKYK----PGNGEIEFKNVSFAY 478
           S+  +      I     +  R+ E  +  P   +    K      P  G IEFKN S  Y
Sbjct: 681 SLTWIVRTTVMIETNIVSVERIVEYCELPPEAQSINPEKRPDENWPSEGRIEFKNYSTKY 740

Query: 479 PTRPSNMIFKNLNFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPSSGEILIDGQNINDL 538
                + + K++N  I+    + IVG +G GKST++L L +  +PS GEI+ID  NI++L
Sbjct: 741 RENL-DPVLKDINVSIQPCEKIGIVGRTGAGKSTLSLALFRILEPSEGEIIIDDVNISEL 799

Query: 539 NSKSLRRHIGLVQQEPILMSGTIRDNIVYGLTEMPTKDEIRQVAKQCFCHNFITRF---- 594
               LR ++ ++ Q+     GT+R N+        ++DE+++  +     + + +     
Sbjct: 800 GLFDLRSNLAIIPQDAQAFEGTVRTNL--DPFNRYSEDELKRAIELAHLKSHLEKMLGNE 857

Query: 595 --------------QSSYDTVIGPHGTLLSGGQKQRIAIARALIKKPRILILDEATSALD 640
                         +   D  I  +G+ LS GQ+Q + +ARAL+   +IL+LDEAT+++D
Sbjct: 858 AENNDINVEERGNAKDILDVKINENGSNLSVGQRQLLCLARALLSHSKILVLDEATASVD 917

Query: 641 VESEGAINYTFGQLMKKKEMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELWDDP 700
           +E++  I  T  +  K +  TI++IAHR+ T+  S+ +IVL       + G  KE +D P
Sbjct: 918 METDKIIQDTIRREFKDR--TILTIAHRIDTVLDSDKIIVL-------DKGNVKE-FDSP 967

Query: 701 TSELS 705
           +  LS
Sbjct: 968 SKLLS 972

 Score = 81.6 bits (200), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 68/239 (28%), Positives = 120/239 (50%), Gaps = 17/239 (7%)

Query: 483 SNMIFKNL-NFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPSSGEILIDGQNINDLNSK 541
           S +  KN+ +F+ + G  +C+VG  G GKST       + K   G++     +   L  K
Sbjct: 79  SQIALKNIEHFEAKRGDLICVVGRVGAGKST-------FLKAILGQLPCMSGSKESLAPK 131

Query: 542 SLRR--HIGLVQQEPILMSGTIRDNIVYGLTEMPTKDEIRQVAKQCFCHNFITRFQSSYD 599
            + R   +    QE  +M+ ++R+NI++G      K       K C     +       +
Sbjct: 132 LIIRASSLAYCSQESWIMNASVRENILFG--HKFDKAYYDLTIKACQLLPDLKILPDGDE 189

Query: 600 TVIGPHGTLLSGGQKQRIAIARALIKKPRILILDEATSALDVE-SEGAINYTF-GQLMKK 657
           T++G  G  LSGGQK R+++ARA+  +  I +LD+  SA+D E S+  I +   G+    
Sbjct: 190 TLVGEKGISLSGGQKARLSLARAVYSRADIYLLDDILSAVDAEVSKNIIEHVLIGKTALL 249

Query: 658 KEMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELW--DDPTSELSQLLNEKSTP 714
           K  TI+   + +S ++ S+ +  L  +G +VE G ++ +   ++ +S+L +LL E  TP
Sbjct: 250 KNKTIILTTNTVSILKHSQMIYAL-ENGEIVEQGNYESVMKRENDSSKLKKLLEEFDTP 307

>KAFR0C06510 Chr3 (1306097..1310470) [4374 bp, 1457 aa] {ON} Anc_5.10
            YGR281W
          Length = 1457

 Score =  132 bits (333), Expect = 7e-31,   Method: Compositional matrix adjust.
 Identities = 125/506 (24%), Positives = 227/506 (44%), Gaps = 44/506 (8%)

Query: 226  LRATVIKKTIHQDAEFFDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGSVG-IG 284
            L    + + +H    + DT  +G +++R   D   +   +T+ V      L+   VG I 
Sbjct: 947  LNLNAVHRVLHAPMSYLDTTPLGRILNRFTKDTDSLDNELTESVR-----LMLFQVGNIV 1001

Query: 285  MMXXXXXXXXXXXXVFTPPVILSASVFGKQISTTSRELQEATG----HLTKVAEEQLSGI 340
             +            +  P +     +      +TSRE++         +     E L G+
Sbjct: 1002 AVIVMCIVYLPWFAIAVPFLFFMFVLIADHYQSTSREIKRLDAIQRSFVYNNLNEVLGGM 1061

Query: 341  KTVQSFVAEQREINRYNFAIRDIFNIGKKAAVIN--AKFFSSTSAMGDLSFLTVLGFGSY 398
             T++S+  ++R   + ++ I  +   G     +      F    A+     + +L     
Sbjct: 1062 DTIKSYKGQKRFQAKSDYLINKMNEAGYLLVSVQRWVSIFLDMVAIIFALIIALLSVTGV 1121

Query: 399  LVLQNSLTIGDLTAFMMYTEYTGNSIFGLSTFYSEIMQGAGAASRLFELTDRVPSISTTK 458
              L  S ++G L  +++      NS+    T   +      +A RL     ++P  +  K
Sbjct: 1122 FSLSAS-SVGVLLTYVLQLPGLLNSVLRALT---QTENDMNSAERLVNYATKLPLEAAYK 1177

Query: 459  GVKYKP-----GNGEIEFKNVSFAYPTRPSNMIFKNLNFKIEAGSNVCIVGPSGRGKSTV 513
              +  P       GEI F +V FAY +    ++ K LN  I++G  + I G +G GKST+
Sbjct: 1178 KPELSPPESWPSKGEIRFLDVDFAYRSGLP-VVLKGLNLDIKSGEKIGICGRTGAGKSTI 1236

Query: 514  ALLLEKYYKPSSGEILIDGQNINDLNSKSLRRHIGLVQQEPILMSGTIRDN--------- 564
               L +  + +SG+ILID  +I+ L    LRR + ++ Q+P+L  GTIR N         
Sbjct: 1237 MSALYRLNELTSGKILIDDVDISTLGLYDLRRKLSIIPQDPVLFKGTIRKNLDPFSNYDD 1296

Query: 565  -------IVYGLTEMPTKDEIR-QVAKQCFCHNFITRFQSSYDTVIGPHGTLLSGGQKQR 616
                   I  G  E  + ++++ ++  +   H  + +F    D ++   G+  S G++Q 
Sbjct: 1297 SLLWDALIRSGAIEKESVEKVKSEMVNEEGTHTDMHKFH--LDQLVEEEGSNFSLGERQV 1354

Query: 617  IAIARALIKKPRILILDEATSALDVESEGAINYTFGQLMKKKEMTIVSIAHRLSTIRRSE 676
            +A+ RAL+++ +ILILDEATS++D E++G I     +  +    TI+ IAHRL TI + +
Sbjct: 1355 LALTRALVRQSKILILDEATSSVDYETDGKIQKRIVE--EFDNCTILCIAHRLKTILQYD 1412

Query: 677  NVIVLGHDGSVVEMGKFKELWDDPTS 702
             ++VL   G + E  +  +L+ D  S
Sbjct: 1413 RILVL-EKGVIAEFDQPFKLFSDKDS 1437

 Score = 89.0 bits (219), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 71/231 (30%), Positives = 113/231 (48%), Gaps = 21/231 (9%)

Query: 487 FKNLNFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPSSGEILIDGQNINDLNSKSLRRH 546
           F NL+F+I  G  + I GP G GKS++      +   + G I ++G    DL        
Sbjct: 588 FSNLDFEIRKGEFIMITGPIGTGKSSLLNAFAGFMNKTEGRIQVNG----DL-------- 635

Query: 547 IGLVQQEPILMSGTIRDNIVYGLTEMPTKDEIRQVAKQCFCHNFITRFQSSYDTVIGPHG 606
             L    P + + T++DNI++G   +  K++   V + C     +    +   T IG  G
Sbjct: 636 --LFCGYPWIQNATVKDNILFGSPFI--KEKYENVLRVCSLDADLKVLPAGDKTEIGERG 691

Query: 607 TLLSGGQKQRIAIARALIKKPRILILDEATSALDVE-SEGAINYTFGQLMKKKEMTIVSI 665
             LSGGQK RI +ARA+ K   I + D+  SA+D    +  ++     L++ K  T +  
Sbjct: 692 INLSGGQKARINLARAVYKTKDIFLFDDVLSAVDSRVGKHIMDECLLDLLEGK--TRILA 749

Query: 666 AHRLSTIRRSENVIVLGHDGSVVEMGKFKELWDDPTSELSQLLNEKSTPHQ 716
            H+LS I +++ VIVLG DGS  ++G   EL       L+ LL+  +T  +
Sbjct: 750 THQLSLIEKADRVIVLGTDGS-FDIGTVDEL-KQRNQTLTNLLDYSTTERE 798

>Suva_8.16 Chr8 complement(29573..34372) [4800 bp, 1599 aa] {ON}
            YHL035C (REAL)
          Length = 1599

 Score =  132 bits (333), Expect = 8e-31,   Method: Compositional matrix adjust.
 Identities = 143/528 (27%), Positives = 233/528 (44%), Gaps = 95/528 (17%)

Query: 235  IHQDAEFFDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALI-CGSVGIGMMXXXXXXX 293
            +H    FFD   +G +++R   D   V + +T  +      LI C S+            
Sbjct: 1089 LHAKIRFFDVTPIGRIMNRFAKDIEGVDQELTPYLEVTMFCLIQCTSI------------ 1136

Query: 294  XXXXXVFTPPVILSASVF-------GKQISTTSRELQEATGHLTKVA-----EEQLSGIK 341
                 + TP  ++ A V        G    T SREL+     +TK        E L G+ 
Sbjct: 1137 IFLITIITPHFLIVAVVVFILYYFVGMWYLTASRELKRIDS-ITKSPIFQHFSETLVGVC 1195

Query: 342  TVQSFVAEQREINRYNFAIRDIFNIGKKAAVINAKFFSSTSAMGDLSF-------LTVLG 394
            T+++F  E+R      F + ++  I +     N  FF  + A+   +F         VL 
Sbjct: 1196 TIRAFGDEKR------FILENLDKIDQN----NRAFFYLSVAVKWFAFRVDIIGAFIVLA 1245

Query: 395  FGSYLVLQ-----NSLTIGDLTAFMMYTEYTGNSIFGLSTFYSEIMQGAGAASRLFELTD 449
             GS++++      + L    LT  +++T+        L   YS       +  RL E + 
Sbjct: 1246 SGSFILINIGNIDSGLAGISLTYAILFTD----GALWLVRLYSTFEMSMNSVERLKEYS- 1300

Query: 450  RVPSISTTKGVKYK------------PGNGEIEFKNVSFAYPTRPSNMIFKNLNFKIEAG 497
               SI       Y             P +G+IE  N+S  Y +    +I KN++F IE  
Sbjct: 1301 ---SIEQENYFDYNKDHIQELQQSSWPEHGQIEVDNLSLRYASNLPPVI-KNVSFTIEPQ 1356

Query: 498  SNVCIVGPSGRGKSTVALLLEKYYKPSSGEILIDGQNINDLNSKSLRRHIGLVQQEPILM 557
            S V IVG +G GKST+   L +  +P +G I IDG +I+ ++  +LRR I ++ Q+PIL 
Sbjct: 1357 SKVGIVGRTGAGKSTIITALFRLLEPETGHIKIDGYDISQIDLVTLRRAITIIPQDPILF 1416

Query: 558  SGTIRDNI-------------VYGLTEMPTKDEIRQVAKQCFCHNFITRFQSSYDTVIGP 604
            +GTI+ N+             V     + +  E+          N       +  T I  
Sbjct: 1417 TGTIKSNVDPCDEYDNKKIFKVLSQVNLISTGEMEAAQNMGDDSNTARNKFVNLQTEITE 1476

Query: 605  HGTLLSGGQKQRIAIARALIKKPRILILDEATSALDVESEGAINYTFGQLMKKKEMTIVS 664
             G  +S G++Q + IAR+L+++P+I++LDEATS++D ES+  I         K   TI++
Sbjct: 1477 GGQNISQGERQLLFIARSLLREPKIILLDEATSSIDYESDHLIQGIIRNEFNKS--TILT 1534

Query: 665  IAHRLSTIRRSENVIVLGHDGSVVEMGKFKELWDDPTSELSQLLNEKS 712
            IAHRL ++   + V+V+       + G+ KE +D P + L    NE+S
Sbjct: 1535 IAHRLRSVIDYDRVLVM-------DAGEIKE-YDHPYNLLK---NEQS 1571

 Score = 81.3 bits (199), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 70/243 (28%), Positives = 113/243 (46%), Gaps = 16/243 (6%)

Query: 464 PGNGEIEFKNVSFAYPTRPSN-MIFK--NLNFKIEAGSNVCIVGPSGRGKSTVALLLEKY 520
           P   +IEFKN +  +     +  IFK   LN   + G    I+G +G GKS + + L   
Sbjct: 661 PDENKIEFKNATLTWNENDKDSTIFKLCGLNITFQIGKLNLILGSTGSGKSALLMGLLGE 720

Query: 521 YKPSSGEILIDG-QNINDL--NSKSLRRHIGLVQQEPILMSGTIRDNIVYGLTEMPTKDE 577
               SG I + G +  +DL  +   L        Q   L++ T+++NI++        D+
Sbjct: 721 LHLISGSITVPGLEPRHDLIPDHNGLTNSFAYCSQSAWLLNDTVKNNIIFN----GAYDD 776

Query: 578 IR--QVAKQCFCHNFITRFQSSYDTVIGPHGTLLSGGQKQRIAIARALIKKPRILILDEA 635
           +R  +V   C     +    +   T IG  G  LSGGQKQRI++ARA+    + ++LD+ 
Sbjct: 777 VRYKEVIDACGLKRDLEILPAGDSTEIGEKGITLSGGQKQRISLARAVYSNAKHVLLDDC 836

Query: 636 TSALDVESEGAI--NYTFGQLMKKKEMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKF 693
            SA+D  +   I  N   G +M+ +  T + + H +S   R     V+  +G V   G  
Sbjct: 837 LSAVDSHTAVWIYENCITGPIMENR--TCILVTHNVSLTIREAYFAVILENGKVKNQGTI 894

Query: 694 KEL 696
           K+L
Sbjct: 895 KQL 897

>ZYRO0G22176g Chr7 (1822665..1827377) [4713 bp, 1570 aa] {ON} similar
            to uniprot|P14772 Saccharomyces cerevisiae YLL015W BPT1
            ABC type transmembrane transporter of MRP/CFTR family
            found in vacuolar membrane involved in the transport of
            unconjugated bilirubin and in heavy metal detoxification
            via glutathione conjugates along with Ycf1p
          Length = 1570

 Score =  132 bits (332), Expect = 9e-31,   Method: Compositional matrix adjust.
 Identities = 128/491 (26%), Positives = 225/491 (45%), Gaps = 45/491 (9%)

Query: 241  FFDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGSVGIGMMXXXXXXXXXXXXVF 300
            FF++  +G +I+R  SD   V R++    +  FK ++   V I ++            VF
Sbjct: 1077 FFESTPIGRIINRFSSDMSTVDRNLKYNFAFFFKCVLDYFVTILLIGYNMPWFL----VF 1132

Query: 301  TPPVILSASVFGKQISTTSRELQE----ATGHLTKVAEEQLSGIKTVQSFVAEQR----E 352
               +++    +     T SREL+     A   +  +  E L G   + +F   +R     
Sbjct: 1133 NAGLLVVYVYYQVFYVTLSRELKRLSSTAFSPIMSLFSETLGGHMVITAFRHSERFHFLN 1192

Query: 353  INRYNFAIRDIFNIGKKAAVINAKFFSSTSAMGDLS-FLTVLGFGSYLVLQNSLTIGDLT 411
             N+  F I   FN+      ++ +      AM  ++  LT+   G+    +  +T G + 
Sbjct: 1193 FNKTQFQIDAQFNLRSTNRWLSIRLQIIGGAMVLITALLTLATIGT----KKQMTAGLVG 1248

Query: 412  AFMMYTEYTGNSIFGLSTFYSEIMQGAGAASRLFELTDRVPS-----ISTTKGVKYKPGN 466
              M Y     NS+  +    + I     +  R++E   ++PS     I +++  K  P  
Sbjct: 1249 LLMSYVLQVTNSLMWIVRMTTMIETNIISVERIYEYC-QLPSEAPAIIESSRPEKSWPSM 1307

Query: 467  GEIEFKNVSFAYPTRPS-NMIFKNLNFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPSS 525
            GEI FK+ S  Y  RP  + + K +N  I+    + +VG +G GKS+++L L +  + + 
Sbjct: 1308 GEIIFKDYSTKY--RPELDPVLKKINLSIKPREKIGVVGRTGAGKSSLSLALFRLLESTG 1365

Query: 526  GEILIDGQNINDLNSKSLRRHIGLVQQEPILMSGTIRDNI----VYGLTEMPTKDEIRQV 581
            G I IDG +I+ +    LR H+ ++ Q+     GT+R N+     Y + E+    E+  +
Sbjct: 1366 GSIEIDGVDISKIGLYDLRSHLSIIPQDAQAFEGTVRSNLDPFNQYSVQEIWKAVELAHL 1425

Query: 582  AKQCFCHNFITRFQ----------SSYDTVIGPHGTLLSGGQKQRIAIARALIKKPRILI 631
                     +T             S+ D  I  +G  +S GQ+Q + ++RAL+ K ++L+
Sbjct: 1426 KPHII--KMMTDEDPDKSSPEDEISALDVKISENGNNMSMGQRQLLCLSRALLSKSKVLV 1483

Query: 632  LDEATSALDVESEGAINYTFGQLMKKKEMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMG 691
            LDEAT+A+D+E++  I  T     + K  TI++IAHR+ T+  S+ ++VL   G V E  
Sbjct: 1484 LDEATAAVDMETDQIIQETIRNEFQDK--TILTIAHRIDTVLDSDKILVLDK-GEVKEFE 1540

Query: 692  KFKELWDDPTS 702
                L  D  S
Sbjct: 1541 SPDTLLKDEKS 1551

 Score = 73.9 bits (180), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 61/216 (28%), Positives = 105/216 (48%), Gaps = 28/216 (12%)

Query: 491 NFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPSSG-------EILIDGQNINDLNSKSL 543
           +F+ + G+  C+VG  G GKST+   +       SG       EIL+             
Sbjct: 661 HFEAKKGALTCVVGRVGSGKSTLLRAILGQLPCRSGPKEFISPEILVRA----------- 709

Query: 544 RRHIGLVQQEPILMSGTIRDNIVYGLTEMPTKDEIRQVAKQCFCHNFITRFQSSYDTVIG 603
            R +    Q P +M+ +I+DNI++G     T   +    K C     +       +T++G
Sbjct: 710 -RSVAYCPQAPWVMNASIKDNILFGHRYDETYYNL--TIKACQLIPDLKILSEGDETLVG 766

Query: 604 PHGTLLSGGQKQRIAIARALIKKPRILILDEATSALDVE-SEGAINYTFGQ---LMKKKE 659
             G  LSGGQK R+++ARA+  +  + ++D+  SA+D E S+  I+   G+   L+K K 
Sbjct: 767 EKGISLSGGQKARLSLARAVYSRADLYLMDDILSAVDAEVSKNIIDKVLGEENGLLKHK- 825

Query: 660 MTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKE 695
            TI+   + +S ++ S N+I     G +VE G +++
Sbjct: 826 -TIILTTNAVSVLKHS-NMIYALQGGRIVEEGTYEQ 859

>TPHA0K02310 Chr11 (497267..502216) [4950 bp, 1649 aa] {ON} Anc_4.6
            YHL035C
          Length = 1649

 Score =  132 bits (331), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 130/492 (26%), Positives = 220/492 (44%), Gaps = 67/492 (13%)

Query: 230  VIKKTIHQDAEFFDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGSVGIGMMXXX 289
            ++ + ++    FFD   +G +++R   D  V+   +   + DG  +    +V   M+   
Sbjct: 1139 LLYRVVNSKLTFFDNTPIGRIMNRFSKDIQVLDSELAPFL-DGVFSCFIQAVTALMLIVF 1197

Query: 290  XXXXXXXXXVFTPPVILSASVFGKQISTTSRELQE--------ATGHLTKVAEEQLSGIK 341
                     +F   +I S+   G      SREL+            H T    E LSG+ 
Sbjct: 1198 ITPKFLIIAIF---IICSSITIGYLYLCCSRELKRFESSSKSPVYQHFT----ETLSGLV 1250

Query: 342  TVQSFVAEQREINRYNFAIRDIFNIGKKAAVINAKFFSSTSAMGDLSF-------LTVLG 394
            T+++F  E +      F   ++  I +     N  FF   S    LSF       +TV G
Sbjct: 1251 TIRAFGNEIK------FLKENLDFIDEN----NKFFFYMWSVNSWLSFRIDLLGAITVFG 1300

Query: 395  FGSYLVLQ-NSLTIG----DLTAFMMYTEYTGNSIFGLSTFYSEIMQGAGAASRLFELTD 449
             G++++L  + +  G     LT  + +TE+       +  FYS +     +  RL E  +
Sbjct: 1301 SGAFILLNADKIDAGLAGISLTYAVTFTEFC----LWMVKFYSTVEMSMNSVERLKEYME 1356

Query: 450  RVPSISTTKGV----KYKPGNGEIEFKNVSFAY-PTRPSNMIFKNLNFKIEAGSNVCIVG 504
                     G     +  P  G I F N S  Y P  P   + K LN KI+ GS + +VG
Sbjct: 1357 IEEEALADPGAITPSENWPVQGAITFANYSLRYAPKLPD--VLKQLNLKIDGGSKIGVVG 1414

Query: 505  PSGRGKSTVALLLEKYYKPSSGEILIDGQNINDLNSKSLRRHIGLVQQEPILMSGTIRDN 564
             +G GKST+   L ++   SSG+ILID  +I+++N + LR  + ++ Q+P L  GTIR N
Sbjct: 1415 RTGAGKSTIISALFRFLDCSSGKILIDDLDISEINLRRLRSCLTIIPQDPSLFVGTIRSN 1474

Query: 565  IVYGLTEMPTKDEIRQVAK-QCFCHNFITRFQS--------------SYDTVIGPHGTLL 609
            +     E   KD    + K      +++                   + D+ I   G  L
Sbjct: 1475 LDPN-EEYENKDIYDALVKVHLLTEDYLANLNYDANADVAYDENIFLNLDSPISEGGINL 1533

Query: 610  SGGQKQRIAIARALIKKPRILILDEATSALDVESEGAINYTFGQLMKKKEMTIVSIAHRL 669
            S GQ+Q I +AR+++   +I++LDEAT+++D +S+  +  T      +K  TI++IAHR+
Sbjct: 1534 SQGQRQLICLARSILHCSKIVLLDEATASIDYKSDFKVQETIRNEFSQK--TILTIAHRI 1591

Query: 670  STIRRSENVIVL 681
             ++   + ++VL
Sbjct: 1592 KSVIDYDKILVL 1603

 Score = 90.1 bits (222), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 67/230 (29%), Positives = 113/230 (49%), Gaps = 11/230 (4%)

Query: 469 IEFKNVSFAYPTRPSNMIFKNLNFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPSSGEI 528
           + F   +  +     +   +N+N + E G    ++GP+G GK+++ + L       SG++
Sbjct: 714 LAFSGATLGWCGNKKSFQLRNINAEFEMGKLNLVIGPTGSGKTSLLMALLGELHLFSGKV 773

Query: 529 LIDG--QNINDL-NSKSLRRHIGLVQQEPILMSGTIRDNIVYGLTEMPTKDEIRQVAKQC 585
            +       N +  S +L   I    Q P + + TIR+NI++ +     KD    V   C
Sbjct: 774 FVPNLESKFNLIPESDNLLNSIAYCSQLPWIFNDTIRNNIIFDMGY--DKDRYENVVIAC 831

Query: 586 FCHNFITRFQSSYDTVIGPHGTLLSGGQKQRIAIARALIKKPRILILDEATSALDVESEG 645
                         T++G  G+ LSGGQKQRI++ARAL  K R LILD+  SA+D  S  
Sbjct: 832 GLERDFQILNLGDKTIVGDKGSCLSGGQKQRISLARALYSKSRHLILDDCLSAVDSHSAK 891

Query: 646 AINYTF--GQLMKKKEMTIVSIAHRLS-TIRRSENVIVLGHDGSVVEMGK 692
            I      G LM+ +  T + ++H +S TI+++  V ++  +G +V  G+
Sbjct: 892 WIYNVCITGPLMQGR--TCILVSHNVSLTIKKASKVFMI-ENGYIVASGR 938

>AGR047W Chr7 (802679..807157) [4479 bp, 1492 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YDR135C (YCF1)
          Length = 1492

 Score =  131 bits (330), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 122/476 (25%), Positives = 216/476 (45%), Gaps = 23/476 (4%)

Query: 226  LRATVIKKTIHQDAEFFDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGSVGIGM 285
            L  +++   +     FF+T  +G +++R  +D Y V   + +  S  F      +  +  
Sbjct: 1003 LHESMLAAVLRAPMSFFETTPIGRILNRFSNDIYKVDELLARTFSQFF----ANTTRVSF 1058

Query: 286  MXXXXXXXXXXXXVFTPPVILSASVFGKQISTTSRELQEATGHLTKVA-----EEQLSGI 340
                          F  P+ +    + +    TSREL+     +TK       +E L+G+
Sbjct: 1059 TIIVICVTTWQFTFFVIPLAMLYIYYQQYYLKTSRELRRLDS-VTKSPVYAHFQETLNGV 1117

Query: 341  KTVQSFVAEQREINRYNFAIRDIFNIGKKAAVINAKFFSSTSAMGDLSFLTVLGFGSYLV 400
             +++ +    R I+     I +  +    +  +N         +G            + +
Sbjct: 1118 SSIRGYGQLDRFIHINQARINNNTSAYYPSMNVNRWLAYRLEFIGSCIIFFAATLSVFRL 1177

Query: 401  LQNSLTIGDLTAFMMYTEYTGNSIFGLSTFYSEIMQGAGAASRLFELTDRVPS----IST 456
               SLT G +   + Y      S+  +     E+     +  R+ E  +  P     I+ 
Sbjct: 1178 ASGSLTSGMVGLSLSYALQITQSLNWIVRMTVEVETNIVSVERIKEYAELEPEAPQFIAN 1237

Query: 457  TKGVKYKPGNGEIEFKNVSFAYPTRPS-NMIFKNLNFKIEAGSNVCIVGPSGRGKSTVAL 515
            +      P +GEI+F+N S  Y  RP  ++I + +N  I+    V IVG +G GKS++AL
Sbjct: 1238 SVPSGDWPKDGEIKFENYSTRY--RPGLDLILRGINLHIKPHERVGIVGRTGAGKSSLAL 1295

Query: 516  LLEKYYKPSSGEILIDGQNINDLNSKSLRRHIGLVQQEPILMSGTIRDNIVYGLTEMPTK 575
             L +  + + G I IDG  I+ +    LR+ + ++ Q+  +  GT+RDNI    T+  T 
Sbjct: 1296 SLFRIIEAAEGHISIDGVPIDTIGLTDLRKKLSIIPQDSQVFEGTVRDNI--DPTKQYTD 1353

Query: 576  DEIRQVAKQCFCHNFITRFQSS-YDTVIGPHGTLLSGGQKQRIAIARALIKKPRILILDE 634
            ++I +  +     + +    S   DT +   G  LS GQ+Q + +ARAL+   RIL+LDE
Sbjct: 1354 EQIWKALELSHLADHVKGMGSDGLDTPLTEGGKNLSVGQRQLMCLARALLIPFRILVLDE 1413

Query: 635  ATSALDVESEGAINYTFGQLMKKKEMTIVSIAHRLSTIRRSENVIVLGHDGSVVEM 690
            AT+A+DVE++  I  T       +  TI++IAHR++TI  S+ ++VL   G+V E 
Sbjct: 1414 ATAAIDVETDKVIQDTIRSSFNDR--TILTIAHRINTIMDSDKIVVLD-KGTVAEF 1466

 Score = 89.7 bits (221), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 115/522 (22%), Positives = 216/522 (41%), Gaps = 96/522 (18%)

Query: 230 VIKKTIHQDAEFFDTHKVGDLISRLGSDAYVVSRSMTQK----VSDGFKALICGSVGIGM 285
           + KK +H   E   T   GD+++ +  DA  + R +TQ      S  F+  +C    +  
Sbjct: 366 IYKKALHLSNEASGTSATGDIVNLMSVDAQRL-RDLTQWGNVIWSGPFQLCLC-LYSLHR 423

Query: 286 MXXXXXXXXXXXXVFTPPVILSASVFGKQISTTSRELQEATGHLTKVAEEQLSGIKTVQ- 344
           +            +FT P+    S   + +    +E  +     T++  E L+ IK+++ 
Sbjct: 424 LLGPCIWVGVVLLLFTLPL---NSYISRVLKRLQKEQMKNKDERTRLISEILNNIKSLKL 480

Query: 345 -----------SFVAEQREIN--------------RYNF-------AIRDIFNIGKKAAV 372
                       +V  Q+E+               +YN        +   +F + +K   
Sbjct: 481 YAWEIPYKEKLDYVRNQKELKTLRKMGLTTAFANFQYNIIPFLVSCSTFAVFVLTQKGRP 540

Query: 373 INAKF-FSSTSAMGDLSF-LTVLGFGSYLVLQNSLTIGDLTAFMMYTEYTGNSIFGLSTF 430
           +     F + +    LSF L VL       ++ S+ IG LT F+   E   ++I      
Sbjct: 541 LTTDLVFPALTLFNLLSFPLAVLPIAITSFIEASVAIGRLTNFLTAEELQRDAI------ 594

Query: 431 YSEIMQGAGAASRLFELTDRVPSISTTKGVKYKPGNGEIEFKNVSFAYPTRPSNMI-FKN 489
                              R P++    GV     +      N +F +  +P   +  KN
Sbjct: 595 ------------------TREPAVKAPGGVAVALAD------NATFLWQRKPEYKVALKN 630

Query: 490 LNFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPSSGEILIDGQNINDLNSKSLRRHIGL 549
           +NF+ +     CI+G  G GKS +              +L D   +N   S  +R ++  
Sbjct: 631 INFRAKKSELTCIIGKVGSGKSALI-----------QAMLGDLFRVN--GSAVVRGNVAY 677

Query: 550 VQQEPILMSGTIRDNIVYGLTEMPTKDEIRQVAKQCFCHNFITRFQSSYDTVIGPHGTLL 609
           V Q   +M+GT+RDNI++G          +Q  K C     ++      +T +G  G  L
Sbjct: 678 VSQVAWIMNGTVRDNILFG--HKYDAKFYQQTIKACALTVDLSILPDGDNTFVGEKGISL 735

Query: 610 SGGQKQRIAIARALIKKPRILILDEATSALDVE-SEGAINYTFGQ--LMKKKEMTIVSIA 666
           SGGQK R+++ARA+  +    +LD+  +A+D   ++  +   FG   L+K K   + +  
Sbjct: 736 SGGQKARLSLARAVYARADTYLLDDPLAAVDEHVAKHLLQNVFGPNGLLKSKARVLTT-- 793

Query: 667 HRLSTIRRSENVIVLGHDGSVVEMGKFKELWDDPTSELSQLL 708
           ++++ +  ++++++L  +G +V+ G F E+  D  S +S+L+
Sbjct: 794 NKITALEIADHIVLL-ENGEIVQQGTFSEVISDEDSAISKLV 834

>Smik_4.380 Chr4 complement(684148..688698) [4551 bp, 1516 aa] {ON}
            YDR135C (REAL)
          Length = 1516

 Score =  130 bits (328), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 123/470 (26%), Positives = 212/470 (45%), Gaps = 41/470 (8%)

Query: 241  FFDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGSVGIGMMXXXXXXXXXXXXVF 300
            FF+T  +G +++R  +D Y V   + +  S  F      +V +                 
Sbjct: 1041 FFETTPIGRILNRFSNDIYKVDALLGRTFSQFF----VNAVKVTFTITVICATTWQFIFI 1096

Query: 301  TPPVILSASVFGKQISTTSRELQE----ATGHLTKVAEEQLSGIKTVQSFVAEQREINRY 356
              P+ +    + +    TSREL+         +    +E L G+ TV+ + ++Q+  +  
Sbjct: 1097 IIPLGVFYIYYQQYYLRTSRELRRLDSITRSPIYSHFQETLGGLATVRGY-SQQKRFSHI 1155

Query: 357  NFAIRDIFNIGKKAAVINAKFFSS--TSAMGDLSFLTVLGFGSYLVLQNSLTIGDLTAFM 414
            N   R   N+      INA  + +     +G +  L       + + Q +LT G +   +
Sbjct: 1156 N-QCRIDNNMSAFYPSINANRWLAYRLELIGSIIILGAATLSVFRLKQGTLTSGMVGLSL 1214

Query: 415  MYTEYTGNSIFGLSTFYSEIMQGAGAASRLFELTD---RVPSI-STTKGVKYKPGNGEIE 470
             Y      ++  +     E+     +  R+ E  D     P I    +  K  P  G+I 
Sbjct: 1215 SYALQITQTLNWIVRMTVEVETNIVSVERIKEYADLKSEAPLIIEGHRPPKQWPAQGDIR 1274

Query: 471  FKNVSFAYPTRPS-NMIFKNLNFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPSSGEIL 529
            F N S  Y  RP  +++ K +N  I+    V IVG +G GKS++ L L +  + S G I+
Sbjct: 1275 FNNYSTRY--RPELDLVLKQINIHIKPNEKVGIVGRTGAGKSSLTLALFRMIEASEGNIV 1332

Query: 530  IDGQNINDLNSKSLRRHIGLVQQEPILMSGTIRDNIVYGLTEMPTKDEIRQVAKQCFC-- 587
            IDG +IN++    LR  + ++ Q+  +  GT+R+NI          D I Q + +     
Sbjct: 1333 IDGVSINEIGLYDLRHKLSIIPQDSQVFEGTVRENI----------DPINQYSDEAIWRA 1382

Query: 588  -------HNFITRFQSSYDTVIGPHGTLLSGGQKQRIAIARALIKKPRILILDEATSALD 640
                    + ++      D  +   G+ LS GQ+Q + +ARA++   +IL+LDEAT+A+D
Sbjct: 1383 LELSHLKEHVLSMSNDGLDAQLSEGGSNLSVGQRQLLCLARAMLVPSKILVLDEATAAVD 1442

Query: 641  VESEGAINYTFGQLMKKKEMTIVSIAHRLSTIRRSENVIVLGHDGSVVEM 690
            VE++  +  T     K +  TI++IAHRL+TI  S+ +IVL  +G V E 
Sbjct: 1443 VETDKVVQETIRTAFKDR--TILTIAHRLNTIMDSDRIIVLD-NGKVAEF 1489

 Score = 77.4 bits (189), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 86/408 (21%), Positives = 178/408 (43%), Gaps = 64/408 (15%)

Query: 330 TKVAEEQLSGIKTVQSFVAEQ-----REINRYNFAIRDIFNIGKKAAVINAKFFSSTSAM 384
           T+V  E L+ IK+++ +  E+      E  R N  ++++  +G   AV + +F       
Sbjct: 485 TRVISEILNNIKSLKLYAWEKPYREKLEEVRNNKELKNLTKLGCYMAVTSFQF------- 537

Query: 385 GDLSFL-TVLGFGSYLVLQNSLTIGDLTAFMMYTEYTGNSIFGLSTF--------YSEIM 435
             + FL +   F  ++  ++     DL        +   ++F L +F         +  +
Sbjct: 538 NIVPFLVSCCTFAVFVYTEDRALTTDLV-------FPALTLFNLLSFPLMIIPMVLNSFI 590

Query: 436 QGAGAASRLFEL----------TDRVPSISTTKGVKYKPGNGEIEFKNVSFAYPTRPSNM 485
           + + +  RLF              R+P++     +    G+      + +F +  +P   
Sbjct: 591 EASVSIGRLFSFFTNEELQPDSVQRLPNVENIGDIAINIGD------DATFLWQRKPEYK 644

Query: 486 I-FKNLNFKIEAGSNVCIVGPSGRGKSTV-ALLLEKYYKPSSGEILIDGQNINDLNSKSL 543
           +  KN++F+   G+  CIVG  G GK+ + + +L   ++   G   + G           
Sbjct: 645 VALKNIDFQATKGNLTCIVGKVGSGKTALLSCMLGDLFR-VKGFATVHG----------- 692

Query: 544 RRHIGLVQQEPILMSGTIRDNIVYGLTEMPTKDEIRQVAKQCFCHNFITRFQSSYDTVIG 603
              I  V Q P +M+GT+++NI++G       +   +  K C     +        T++G
Sbjct: 693 --CIAYVSQVPWIMNGTVKENILFG--HKYDAEFYEKTIKACALTIDLAILMDGDKTLVG 748

Query: 604 PHGTLLSGGQKQRIAIARALIKKPRILILDEATSALDVE-SEGAINYTFGQLMKKKEMTI 662
             G  LSGGQK R+++ARA+  +    +LD+  +A+D   +   I +  G        T 
Sbjct: 749 EKGISLSGGQKARLSLARAVYSRADTYLLDDPLAAVDEHVARHLIEHVLGPNGLLHTKTR 808

Query: 663 VSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELWDDPTSELSQLLNE 710
           +   +++S +  ++++ +L  +G +++ G + ++  D  S L +LLN+
Sbjct: 809 ILATNKVSALSIADSIALLD-NGEIIQQGAYSDITKDADSPLWKLLND 855

>Skud_4.395 Chr4 complement(694806..699356) [4551 bp, 1516 aa] {ON}
            YDR135C (REAL)
          Length = 1516

 Score =  130 bits (328), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 130/487 (26%), Positives = 223/487 (45%), Gaps = 35/487 (7%)

Query: 241  FFDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGSVGIGMMXXXXXXXXXXXXVF 300
            FF+T  +G +++R  +D Y V   + +  S  F      +V +                 
Sbjct: 1041 FFETTPIGRILNRFSNDIYKVDALLGRTFSQFF----VNAVKVIFTITVICATTWQFIFI 1096

Query: 301  TPPVILSASVFGKQISTTSRELQE----ATGHLTKVAEEQLSGIKTVQSFVAEQREINRY 356
              P+ +    + +    TSREL+         +    +E L G+ TV+ + ++Q+  +  
Sbjct: 1097 IIPLGVCYIYYQQYYLRTSRELRRLDSITRSPIYSHFQETLGGLATVRGY-SQQKRFSHI 1155

Query: 357  NFAIRDIFNIGKKAAVINAKFFSS--TSAMGDLSFLTVLGFGSYLVLQNSLTIGDLTAFM 414
            N   R   N+      INA  + +     +G +  L       + + Q +LT G     +
Sbjct: 1156 N-QCRIDNNMSAFYPSINANRWLAYRLELIGSIIILGAATLSVFRLKQGTLTAGMAGISL 1214

Query: 415  MYTEYTGNSIFGLSTFYSEIMQGAGAASRLFELTD---RVP-SISTTKGVKYKPGNGEIE 470
             Y      ++  +     E+     +  R+ E  D     P +I      K  P  G+I+
Sbjct: 1215 SYALQITQTLNWIVRMTVEVETNIVSVERIKEYADLKSEAPLTIEGHMPPKEWPSQGDIK 1274

Query: 471  FKNVSFAYPTRPS-NMIFKNLNFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPSSGEIL 529
            F N S  Y  RP  +++ K++N  I+    + IVG +G GKS++ L L +  + S+G I+
Sbjct: 1275 FNNYSTRY--RPELDLVLKHINIHIKPNEKIGIVGRTGAGKSSLTLALFRMIEASAGNIV 1332

Query: 530  IDGQNINDLNSKSLRRHIGLVQQEPILMSGTIRDNIVYGLTEMPTKDEI-RQVAKQCFCH 588
            IDG  IN++    LR  + ++ Q+  +  G++R+NI    T   T + I R +       
Sbjct: 1333 IDGIAINEIGLYDLRHRLSIIPQDSQVFEGSLRENI--DPTNQYTDEAIWRALELSHLKE 1390

Query: 589  NFITRFQSSYDTVIGPHGTLLSGGQKQRIAIARALIKKPRILILDEATSALDVESEGAIN 648
            + ++      D  +   G  LS GQ+Q + +ARA++   +ILILDEAT+A+DVE++  + 
Sbjct: 1391 HVLSMSNDGLDAQLTEGGGNLSVGQRQLLCLARAMLVPSKILILDEATAAVDVETDKVVQ 1450

Query: 649  YTFGQLMKKKEMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELWDDPTSELSQLL 708
             T     K +  TI++IAHRL+TI  S+ +IVL  +G+V E        D P+  LS   
Sbjct: 1451 ETIRTAFKDR--TILTIAHRLNTIMDSDRIIVLD-NGTVAEF-------DSPSQLLS--- 1497

Query: 709  NEKSTPH 715
            N +S  H
Sbjct: 1498 NSESLFH 1504

 Score = 77.4 bits (189), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 89/410 (21%), Positives = 179/410 (43%), Gaps = 68/410 (16%)

Query: 330 TKVAEEQLSGIKTVQSFVAEQ-----REINRYNFAIRDIFNIGKKAAVINAKFFSSTSAM 384
           T+V  E L+ IK+++ +  E+      E  R N  ++++  +G   AV + +F       
Sbjct: 485 TRVISEILNNIKSLKLYAWEKPYREKLEDIRNNKELKNLTRLGCYMAVTSFQF------- 537

Query: 385 GDLSFL-TVLGFGSYLVLQNSLTIGDLTAFMMYTEYTGNSIFGLSTF--------YSEIM 435
             + FL +   F  ++  ++     DL        +   ++F L +F         +  +
Sbjct: 538 NIVPFLVSCCTFAVFVYTEDRALTTDLV-------FPALTLFNLLSFPLMIIPMVLNSFI 590

Query: 436 QGAGAASRLFEL----------TDRVPSISTTKGVKYKPGNGEIEFKNVSFAYPTRPSNM 485
           + + +  RLF              R+P +     V    G+      + +F +  +P   
Sbjct: 591 EASVSIGRLFTFFTNEELQPDSVQRLPKVENFGDVAINVGD------DATFLWQRKPEYK 644

Query: 486 I-FKNLNFKIEAGSNVCIVGPSGRGKSTV-ALLLEKYYKPSSGEILIDGQNINDLNSKSL 543
           +  KN+NF+ + G   C+VG  G GK+ + + +L   ++   G   + G           
Sbjct: 645 VALKNINFQAKKGELTCVVGKVGSGKTALLSCMLGDLFR-VKGFATVHGS---------- 693

Query: 544 RRHIGLVQQEPILMSGTIRDNIVYGLTEMPTKDEIRQVAKQCFCHNFITRFQSSYDTVIG 603
              +  V Q P +M+GT+ +NI++G       +   +  K C     +        T++G
Sbjct: 694 ---VAYVSQVPWIMNGTVMENILFG--HKYDVEFYEKTIKACALTIDLAILMDGDKTLVG 748

Query: 604 PHGTLLSGGQKQRIAIARALIKKPRILILDEATSALDVE-SEGAINYTFGQ--LMKKKEM 660
             G  LSGGQK R+++ARA+  +    +LD+  +A+D   +   I +  G   L+  K  
Sbjct: 749 EKGISLSGGQKARLSLARAVYSRADTYLLDDPLAAVDEHVARHLIEHVLGPNGLLHTKTR 808

Query: 661 TIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELWDDPTSELSQLLNE 710
            + +  +++S +  +++V +L  +G +++ G + E+  D  S L +LLN+
Sbjct: 809 LLAT--NKVSALSIADSVALLD-NGEIIQKGTYDEITKDADSPLWKLLND 855

>SAKL0H26026g Chr8 (2287664..2292625) [4962 bp, 1653 aa] {ON} similar
            to uniprot|P32386 Saccharomyces cerevisiae YLL048C
          Length = 1653

 Score =  130 bits (328), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 139/529 (26%), Positives = 238/529 (44%), Gaps = 89/529 (16%)

Query: 230  VIKKTIHQDAEFFDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALI-CGSVGIGMMXX 288
            V+KK ++    FFD+  +G +++R   D   V + +T  V   F +L+ C S  I +   
Sbjct: 1138 VLKKVLYAKLRFFDSTPIGRIMNRFSKDIEAVDQELTPFVEGAFVSLVQCLSTVILI--- 1194

Query: 289  XXXXXXXXXXVFTPPVILSASVF--------GKQISTTSRELQE----ATGHLTKVAEEQ 336
                       +  P  L  ++F        G      SREL+     +   + +   E 
Sbjct: 1195 ----------AYITPGFLVVAIFIGFLYYLVGYFYMAGSRELKRFESVSRSPIHQHFSET 1244

Query: 337  LSGIKTVQSFVAEQREINRYNFAIRDIFNIGKKAAVINAKFFSSTSAMGDLSF------- 389
            L GI T+++F  E+R      F + ++  I +     N  FF    A   L+F       
Sbjct: 1245 LVGITTIRAFGDERR------FMLENLQKIDEN----NKPFFYLWVANRWLAFRIDMIGA 1294

Query: 390  LTVLGFGSYLVLQ-----NSLTIGDLTAFMMYTEYTGNSIFGLSTFYSEIMQGAGAASRL 444
              V   G +++L      + L    LT  + +TE        L   YS +     +  RL
Sbjct: 1295 CVVFAAGVFILLNIKKLDSGLAGISLTYAISFTE----GALWLVRLYSNVEMTMNSVERL 1350

Query: 445  FE--LTDRVPSI--STTKGVKYKPGNGEIEFKNVSFAYPTRPSNMIFKNLNFKIEAGSNV 500
             E  + ++ PS   +    +++ P  G+IE  ++S  Y T    +I KN++F ++    V
Sbjct: 1351 KEYMVIEQEPSNDGAFNPPIEW-PDQGKIEVNDLSLRYATNLPRVI-KNVSFTVDPKCKV 1408

Query: 501  CIVGPSGRGKSTVALLLEKYYKPSSGEILIDGQNINDLNSKSLRRHIGLVQQEPILMSGT 560
             IVG +G GKST+   L ++  P +G I ID  +I  +  K LR+ I ++ Q+P L SGT
Sbjct: 1409 GIVGRTGAGKSTIITALFRFLDPETGHIKIDNVDITSIGLKRLRQSITIIPQDPTLFSGT 1468

Query: 561  IRDNI-------------VYGLTEMPTKDEIRQVAKQC----FCHNFITRFQSSYDTVIG 603
            ++ N+                   + T DE+  V             + +F    +  I 
Sbjct: 1469 VKSNLDPYDEYTDEQIFKALKRVNLVTADELDHVPDSADNASVNSENVNKFLDLRNE-IT 1527

Query: 604  PHGTLLSGGQKQRIAIARALIKKPRILILDEATSALDVESEGAINYTFGQLMKKKEMTIV 663
              G  LS GQ+Q + +AR+L++ P+I++LDEAT+++D  S+  I  T  +  +  + TI+
Sbjct: 1528 EGGANLSQGQRQLVCLARSLLRSPKIILLDEATASIDYSSDAKIQQTIRE--EFGDSTIL 1585

Query: 664  SIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELWDDPTSELSQLLNEKS 712
            +IAHRL +I   + ++V+       + G+ +E +D P    S LLN+ S
Sbjct: 1586 TIAHRLRSIIDYDKILVM-------DAGEVRE-YDHP---YSLLLNKSS 1623

 Score = 93.6 bits (231), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 87/318 (27%), Positives = 153/318 (48%), Gaps = 27/318 (8%)

Query: 388 SFLTVLGFGSYLVLQNSL--TIGDLTAFMMYTEYTGNSIFGLSTFYSEIMQGAGAASRLF 445
           S +T + F  Y+ +Q  +  T    TA  ++T    N +  LS   S ++Q   +  R+ 
Sbjct: 613 SIVTSVSFAFYIYVQGEVLTTPIAFTALSLFT-LLRNPLDQLSDMLSFVIQSKVSLDRVQ 671

Query: 446 ELTDRVPSISTTKGVKYKPGNGEIEFKNVSFAYPTRPSNMIFKNLNFKIEAGSNVCIVGP 505
           E  D      T K  +      +I F+N +FA+  +  +   KNLN + + G    ++G 
Sbjct: 672 EFLDEE---ETEKYNQLTISRNKIAFENATFAWDKKNPSFKLKNLNVEFKLGKLNVVIGS 728

Query: 506 SGRGKSTVAL-------LLE-KYYKPSSGEILIDGQNINDLNSKSLRRHIGLVQQEPILM 557
           +G GK+++ +       L+E K Y PS     +D +    + S  +   I    Q   L+
Sbjct: 729 TGSGKTSLLMGLLGEMDLIEGKVYVPS-----LDPREELVIESDGMTNSIAYCSQAAWLL 783

Query: 558 SGTIRDNIVYGLTEMPTKDEIRQVAKQCFCHNFITRFQSSYDTVIGPHGTLLSGGQKQRI 617
           + T+R+NI++      T+   + V + C          +   T IG  G  LSGGQKQR+
Sbjct: 784 NDTVRNNILFNSPYNETR--YKAVVEACGLKRDFEILSAGDQTEIGEKGITLSGGQKQRV 841

Query: 618 AIARALIKKPRILILDEATSALDVESEGAI--NYTFGQLMKKKEMTIVSIAHRLS-TIRR 674
           ++ARAL    R ++LD+  SA+D  +   I  N   G LM+ +  T + ++H ++ T++ 
Sbjct: 842 SLARALYSSSRHVLLDDCLSAVDSHTALWIYENCITGPLMQGR--TCILVSHNVALTLKN 899

Query: 675 SENVIVLGHDGSVVEMGK 692
           +E V+VL  +G + + G+
Sbjct: 900 AEWVVVLD-NGRIKDQGE 916

>KAFR0I01300 Chr9 complement(262852..267462) [4611 bp, 1536 aa] {ON}
            Anc_4.52 YLL015W
          Length = 1536

 Score =  130 bits (328), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 136/529 (25%), Positives = 238/529 (44%), Gaps = 46/529 (8%)

Query: 209  YGRIILLRVLSERLVARLRATVIKKTIHQDAEFFDTHKVGDLISRLGSDAYVVSRSMTQK 268
            +  II+L   S R    L  ++ K  I    +FF+T  +G +I+R  SD   V  ++   
Sbjct: 1021 FRTIIMLLYCSIRGSKTLHDSMAKAIIRSPVQFFETTPIGRVINRFSSDIDSVDVNLQNV 1080

Query: 269  VSDGFKALICGSVGIGMMXXXXXXXXXXXXVFTPPVILSASVFGKQISTTSRELQEATGH 328
             S  F++++   + + ++            +F   +++    + K     SREL+     
Sbjct: 1081 FSIFFRSILDYILTVILVSVAMPWFL----LFNALIMIIYFYYEKLYIVQSRELK----R 1132

Query: 329  LTKVAEEQLSGIKTVQSFVAEQREINRYNFA-IRDIFNIGKKAAVINAKF-FSSTSAMGD 386
            LT +A   +  I  +   +  Q  I+ YN + +    NI +    +N  F F ST+    
Sbjct: 1133 LTSIAYSPI--ISLMSETLGGQMVISAYNHSKMFKFMNIERVQYNLNVLFTFRSTNRWLS 1190

Query: 387  LSFLTVLGFGSYLVLQNSLTI------------GDLTAFMMYTEYTGNSIFGLSTFYSEI 434
            +   ++   G++++L   L              G +   M Y     +++  +     +I
Sbjct: 1191 IRLQSI---GAFIILCTGLLALTTLRTSSPIGSGLIGLLMSYVLQVTSALTWIVRSTVQI 1247

Query: 435  MQGAGAASRLFELTDRVPS----ISTTKGVKYKPGNGEIEFKNVSFAYPTRPSNMIFKNL 490
                 +  R+ E     P     I + +  +  P  G IEFKN +  Y    S  + KN+
Sbjct: 1248 ETNIVSVERILEYCHLPPEAEDIIDSNRVERDWPQRGSIEFKNYTTTYRANLSP-VLKNI 1306

Query: 491  NFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPSSGEILIDGQNINDLNSKSLRRHIGLV 550
            +  I     V IVG +G GKST++L L +  + + G I IDG +I+ +    LR ++ ++
Sbjct: 1307 SVTINPSEKVGIVGRTGAGKSTLSLALFRILEAAEGTIFIDGVDISRIGLTDLRGNMAII 1366

Query: 551  QQEPILMSGTIRDNIVYGLTEMPTKDEIRQVAKQCFCHNFITRFQ---------SSYDTV 601
             Q+     GT+R N+     +  T  E+  V +       + R           S  D  
Sbjct: 1367 PQDAQAFEGTVRSNL--DPFQKHTDVELWNVIELSHLKPHVLRMAEDDNLSGNLSGLDAK 1424

Query: 602  IGPHGTLLSGGQKQRIAIARALIKKPRILILDEATSALDVESEGAINYTFGQLMKKKEMT 661
            I  +G+ LS GQ+Q + +ARAL+ + ++L+LDEAT+A+DVE++  I  T     K +  T
Sbjct: 1425 INENGSNLSVGQRQLLCLARALLNQSKVLVLDEATAAVDVETDKIIQETIRTQFKDR--T 1482

Query: 662  IVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELWDDPTSELSQLLNE 710
            I++IAHRL TI  ++ ++VL   G V E    K L  D ++   QL ++
Sbjct: 1483 ILTIAHRLDTIMDNDKILVLDA-GGVKEFDSPKNLLSDESTLFYQLCDK 1530

 Score = 64.3 bits (155), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 101/446 (22%), Positives = 197/446 (44%), Gaps = 70/446 (15%)

Query: 309 SVFGKQISTTSRELQEATGHLTKVAEEQLSGIKTVQSFVAEQREINRYNFAIRDIFNIG- 367
           S   K++ T ++   +      K   E L+ +K+++ +  E+  + + +  +R+   IG 
Sbjct: 444 SYLSKKVKTLTKTQMKYKDARIKTITEILNSMKSIKLYAWEKPMMQKLD-HVRNDLEIGN 502

Query: 368 -KKAAVINAKFFSSTSAMGDLSFLTVLGFGSYLVLQNS-----LTIGDLTAFMMYTEYTG 421
            KK  + +   + + + +  L  +T   FG + ++ +      L    L+ F +  E   
Sbjct: 503 LKKIGIASNLIYFAWNCVPLL--VTCSTFGIFTLISDEPLTPELVFPALSLFNILNE--- 557

Query: 422 NSIFGLSTFYSEIMQGAGAASRL--FELTDRVP-SISTTKGVKYKPGNGEI---EFKNVS 475
            +I+ + +  + +++   + +RL  F L++ +  S     G   KP N  I   E +N +
Sbjct: 558 -AIYAIPSTINTMIEVTVSLNRLKKFLLSEELDRSFIEQTG---KPANEYIPAVEIENAT 613

Query: 476 FAYPTRP----------------SNMIFKNLN-FKIEAGSNVCIVGPSGRGKSTVALLLE 518
           F + ++                 + +  KN++ F     S  C++G  G GK+T+     
Sbjct: 614 FLWKSQAQLINSENDDSEANIETTQVALKNIDHFTASPKSLTCVIGKVGSGKTTLL---- 669

Query: 519 KYYKPSSGEI-LIDGQNINDLNSKSLR-RHIGLVQQEPILMSGTIRDNIVYGLTEMPTKD 576
              K   G++  I G   +     S+R   I    QE  +M+ TI++NI++G       D
Sbjct: 670 ---KAILGQLPCISGSKESISPKLSIRGESIAYCPQEAWIMNDTIKENILFG----HKFD 722

Query: 577 EIRQVAKQCFCHNFITRFQSSYD---TVIGPHGTLLSGGQKQRIAIARALIKKPRILILD 633
           E         C   +  F    D   T++G  G  LSGGQK R+++ARA+  +  I +LD
Sbjct: 723 ETYYTLTVAACE-LLADFDILPDGDQTLVGEKGISLSGGQKARVSLARAVYSRADIYLLD 781

Query: 634 EATSALDVE-----SEGAINYTFGQLMKKKEMTIVSIAHRLSTIRRSENVIVLGHDGSVV 688
           +  SA+D        E  ++   G L  K   T++   + +S ++ S+ +  L  +G +V
Sbjct: 782 DILSAVDAGVSKKIVENVLDSNSGLLRNK---TVILSTNTVSVLKHSQLIYAL-ENGIIV 837

Query: 689 EMGKFKELWD----DPTSELSQLLNE 710
           E G + ++ +    D  S++S LL +
Sbjct: 838 ERGNYNDIIESANSDDESKISALLKQ 863

>KLTH0H16038g Chr8 (1376941..1381890) [4950 bp, 1649 aa] {ON} similar
            to uniprot|P32386 Saccharomyces cerevisiae YLL048C
          Length = 1649

 Score =  130 bits (326), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 138/531 (25%), Positives = 237/531 (44%), Gaps = 92/531 (17%)

Query: 230  VIKKTIHQDAEFFDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALI-CGSVGIGMMXX 288
            ++KK ++    FFD+  +G +++R   D   V + +T  V   F +L+ C S  I +   
Sbjct: 1133 ILKKVLYAKLRFFDSTPIGRIMNRFSRDIEAVDQELTPFVEGAFVSLVQCLSTVILI--- 1189

Query: 289  XXXXXXXXXXVFTPPVILSASVF--------GKQISTTSRELQE----ATGHLTKVAEEQ 336
                       +  P     ++F        G      SREL+     +   + +   E 
Sbjct: 1190 ----------AYITPDFFFVAIFIGIFYYLVGYFYMAGSRELKRYESISRSPIHQHFSET 1239

Query: 337  LSGIKTVQSFVAEQREINRYNFAIRDIFNIGKKAAVINAKFFSSTSAMGDLSF------- 389
            L GI T+++F  E+R      F   ++  I +     N  FF    A   L+F       
Sbjct: 1240 LVGITTIRAFGDERR------FMQENLTKIDEN----NKPFFYLWVANRWLAFRIDMIGA 1289

Query: 390  LTVLGFGSYLVLQ-NSLTIG----DLTAFMMYTEYTGNSIFGLSTFYSEIMQGAGAASRL 444
              +   G +++L   SL  G     LT  + +TE        L   YS +     +  RL
Sbjct: 1290 CVIFAAGIFVLLNIKSLDSGLAGISLTYAISFTE----GALWLVRLYSNVEMTMNSVERL 1345

Query: 445  FEL--TDRVPSISTTKGVKYK-PGNGEIEFKNVSFAY-PTRPSNMIFKNLNFKIEAGSNV 500
             E    ++ P   +T     + P  G+IE  ++S  Y P+ P   + KN+ F ++    V
Sbjct: 1346 KEYMEVEQEPHYQSTHNPPPEWPSQGKIEVNDLSLRYAPSLPK--VIKNVTFTVDPNCKV 1403

Query: 501  CIVGPSGRGKSTVALLLEKYYKPSSGEILIDGQNINDLNSKSLRRHIGLVQQEPILMSGT 560
             IVG +G GKST+   L ++  P SG I ID  +I  +  K LR+ I ++ Q+P L +GT
Sbjct: 1404 GIVGRTGAGKSTIITALFRFLDPESGYIKIDNVDITSVELKRLRQSITIIPQDPTLFTGT 1463

Query: 561  IRDNI-------------VYGLTEMPTKDEIRQVAK------QCFCHNFITRFQSSYDTV 601
            ++ N+                   + T++E+   A            N + +F    +  
Sbjct: 1464 VKSNLDPYDEYSDKQIFEALKRVNLVTQEELDHAANPSPDNASAVSEN-VNKFL-FLENE 1521

Query: 602  IGPHGTLLSGGQKQRIAIARALIKKPRILILDEATSALDVESEGAINYTFGQLMKKKEMT 661
            I   G+ LS GQ+Q + +AR+L++ P++++LDEAT+++D +S+  I  T     +  + T
Sbjct: 1522 ISEGGSNLSQGQRQLVCLARSLLRSPKVMLLDEATASIDYQSDARIQQTIRS--EFSDST 1579

Query: 662  IVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELWDDPTSELSQLLNEKS 712
            I++IAHRL +I   + ++V+       + G+ KE +D P    S LLN+ S
Sbjct: 1580 ILTIAHRLRSIIDYDKILVM-------DAGEVKE-YDHP---YSLLLNKNS 1619

 Score = 85.9 bits (211), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 64/242 (26%), Positives = 118/242 (48%), Gaps = 19/242 (7%)

Query: 467 GEIEFKNVSFAYPTRPSNMIFKNLNFKIEAGSNVCIVGPSGRGKSTVAL-------LLE- 518
            +I F+N +F++  +  +   KN+N   + G    ++GP+G GK+++ +       LLE 
Sbjct: 687 NKIGFENATFSWDRKNPDFKLKNMNIDFKLGKLNVVIGPTGSGKTSLLMGLLGEMDLLEG 746

Query: 519 KYYKPSSGEILIDGQNINDLNSKSLRRHIGLVQQEPILMSGTIRDNIVYGLTEMPTKDEI 578
           K Y P      +D +    + +  +   I    Q   L++ T+++NI++  +    +   
Sbjct: 747 KVYAPC-----LDPREDMVIENDGMTNSIAYCSQAAWLLNDTVKNNILF--SSPFNEGRY 799

Query: 579 RQVAKQCFCHNFITRFQSSYDTVIGPHGTLLSGGQKQRIAIARALIKKPRILILDEATSA 638
             V + C          +   T IG  G  LSGGQKQR+++ARAL    R L+LD+  SA
Sbjct: 800 NAVIEACGLKRDFEILSAGDQTEIGEKGITLSGGQKQRVSLARALYSSSRHLLLDDCLSA 859

Query: 639 LDVESEGAI--NYTFGQLMKKKEMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKEL 696
           +D  +   I  N   G LM+ +  T + ++H ++   ++   +V   +G V + G+  EL
Sbjct: 860 VDSHTALWIYENCISGPLMEGR--TCILVSHNVALTLKNAEWVVFMENGRVKDQGEPLEL 917

Query: 697 WD 698
           ++
Sbjct: 918 YN 919

>Suva_2.297 Chr2 complement(518369..522919) [4551 bp, 1516 aa] {ON}
            YDR135C (REAL)
          Length = 1516

 Score =  129 bits (325), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 123/481 (25%), Positives = 221/481 (45%), Gaps = 23/481 (4%)

Query: 241  FFDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGSVGIGMMXXXXXXXXXXXXVF 300
            FF+T  +G +++R  +D Y V   + +  S  F      +V +                 
Sbjct: 1041 FFETTPIGRILNRFSNDIYKVDALLGRTFSQFF----VNAVKVTFTITVICVTTWQFIFI 1096

Query: 301  TPPVILSASVFGKQISTTSRELQE----ATGHLTKVAEEQLSGIKTVQSFVAEQREINRY 356
              P+ +    + +    TSREL+         +    +E L G+ TV+ + ++Q+  +  
Sbjct: 1097 IVPLGVFYIYYQQYYLRTSRELRRLDSITRSPIYSHFQETLGGLATVRGY-SQQKRFSHI 1155

Query: 357  NFAIRDIFNIGKKAAVINAKFFSS--TSAMGDLSFLTVLGFGSYLVLQNSLTIGDLTAFM 414
            N   R   N+      +NA  + +     +G +  L       + + Q +LT G +   +
Sbjct: 1156 N-QCRIDNNMSAFYPSVNANRWLAYRLELIGSVIILGAATLSVFRLKQGTLTAGMVGLSL 1214

Query: 415  MYTEYTGNSIFGLSTFYSEIMQGAGAASRLFELTD---RVP-SISTTKGVKYKPGNGEIE 470
             Y      ++  +     E+     +  R+ E  D     P  I   +  K  PG G+I+
Sbjct: 1215 SYALQITQTLNWIVRMTVEVETNIVSVERIKEYADIKSEAPLVIEGHRPPKEWPGQGDIK 1274

Query: 471  FKNVSFAYPTRPS-NMIFKNLNFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPSSGEIL 529
            F   S  Y  RP  +++ K ++  I+    + IVG +G GKS++ L L +  + S+G I+
Sbjct: 1275 FNQYSTRY--RPELDLVLKQIDIHIKPKEKIGIVGRTGAGKSSLTLALFRIIEASAGNIV 1332

Query: 530  IDGQNINDLNSKSLRRHIGLVQQEPILMSGTIRDNIVYGLTEMPTKDEIRQVAKQCFCHN 589
            IDG  IN++    LR  + ++ Q+  +  GT+R+NI   + +   +   R +       +
Sbjct: 1333 IDGIPINEIGLYDLRHKLSIIPQDSQVFEGTVRENID-PINQYTDEAMWRALELSHLKEH 1391

Query: 590  FITRFQSSYDTVIGPHGTLLSGGQKQRIAIARALIKKPRILILDEATSALDVESEGAINY 649
             ++      D+ +   G+ LS GQ+Q + +ARA++ + +IL+LDEAT+A+DVE++  I  
Sbjct: 1392 ILSMSNDGLDSQLTEGGSNLSVGQRQLLCLARAMLVQSKILVLDEATAAVDVETDKVIQE 1451

Query: 650  TFGQLMKKKEMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELWDDPTSELSQLLN 709
            T     K +  TI++IAHRL+TI  S+ +IVL  +G V E     +L  +  S    L  
Sbjct: 1452 TIRTAFKDR--TILTIAHRLNTIMDSDRIIVLD-NGKVAEFDSPAQLLTNTKSLFYSLCA 1508

Query: 710  E 710
            E
Sbjct: 1509 E 1509

 Score = 75.1 bits (183), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 88/417 (21%), Positives = 177/417 (42%), Gaps = 82/417 (19%)

Query: 330 TKVAEEQLSGIKTVQSFVAEQ-----REINRYNFAIRDIFNIGKKAAVINAKFFSSTSAM 384
           T+V  E L+ IK+++ +  E+      E  R N  + ++  +G   AV + +F       
Sbjct: 485 TRVISEILNNIKSLKLYAWEKPYREKLEDVRNNKELNNLTKLGCYMAVTSFQF------- 537

Query: 385 GDLSFL-TVLGFGSYLVLQNSLTIGDLTAFMMYTEYTGNSIFGLSTF--------YSEIM 435
             + FL +   F  ++  ++     DL        +   ++F L +F         +  +
Sbjct: 538 NIVPFLVSCCTFAVFVYTEDRALTTDLV-------FPALTLFNLLSFPLMIIPMVLNSFI 590

Query: 436 QGAGAASRLFEL----------TDRVPSISTTKGVKYKPGNGEIEFKNVSFAYPTRPSNM 485
           + + +  RLF              R+P +     +    G+      + +F +  +P   
Sbjct: 591 EASVSIGRLFSFFTNEELQPDSVQRLPKVENVGDIAINIGD------DATFLWQRKPEYK 644

Query: 486 I-FKNLNFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPSSGEIL-IDGQNINDLNSKSL 543
           +  KN+NF+ + G   C+VG  G GK+  ALL       + G++  + G         S+
Sbjct: 645 VALKNINFQAKKGELTCVVGKVGSGKT--ALL-----SSTLGDLFRVKG-------FASV 690

Query: 544 RRHIGLVQQEPILMSGTIRDNIVYGLTEMPTKDEIRQVAKQCFCHNFITRFQSSYDTVIG 603
              +  V Q P +M+GT+++NI++G       +   +  K C     +        T++G
Sbjct: 691 HGSVAYVSQVPWIMNGTVKENILFG--HKYDAEFYEKTIKACALTIDLAILMDGDQTLVG 748

Query: 604 PHGTLLSGGQKQRIAIARALIKKPRILILDEATSALD----------VESEGAINYTFGQ 653
             G  LSGGQK R+++ARA+  +    +LD+  +A+D          V     + +T  +
Sbjct: 749 EKGISLSGGQKARLSLARAVYSRADTYLLDDPLAAVDEHVARHLVEHVLGSNGLLHTKTK 808

Query: 654 LMKKKEMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELWDDPTSELSQLLNE 710
           L+   +++ +S+A          + I L  +G +++ G + ++  D  S L +L+ +
Sbjct: 809 LLATNKVSALSVA----------DSIALLDNGEIIQQGTYDDITKDADSPLWKLIKD 855

>Skud_12.52 Chr12 (107860..112545) [4686 bp, 1561 aa] {ON} YLL015W
            (REAL)
          Length = 1561

 Score =  129 bits (325), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 143/539 (26%), Positives = 245/539 (45%), Gaps = 59/539 (10%)

Query: 203  VGIAA--NYGRIILLRVLSERLVARLRATVIKKTIHQDAEFFDTHKVGDLISRLGSDAYV 260
            VG AA  N   I++L   S R   +L   + K  I     FF+T  VG +I+R  SD   
Sbjct: 1029 VGSAAFNNLRSIVMLLYCSIRGSKKLHENMAKSVIRSPMVFFETTPVGRIINRFSSDMDA 1088

Query: 261  VSRSMTQKVSDGFKALICGSVGIGMMXXXXXXXXXXXXVFTPPVILSASVFGKQISTTSR 320
            V  S+    S  FK+++   V + ++            VF   +++    +       SR
Sbjct: 1089 VDSSLQYIFSFFFKSILTYLVTVILV----GYNMPWFFVFNMFLLVIYIYYQTFYIVLSR 1144

Query: 321  ELQE----ATGHLTKVAEEQLSGIKTVQSFVAEQREI----NRYNFAIRDIFN------- 365
            EL+     +   +  +  E L+G   + ++   +R I     +  + I  +FN       
Sbjct: 1145 ELKRLISISYSPIMSLMSESLNGYSIIDAYDHFERFIYLNYEKIQYNIDFVFNFRSTNRW 1204

Query: 366  IGKKAAVINAKFFSSTSAMGDLSFLTVLGFGSYLVLQNSLTIGDLTAFMMYT-EYTGNSI 424
            +  +   I A    +T+ +     LT +        +  L+ G +   M Y+ E TG+  
Sbjct: 1205 LSVRLQTIGATIVLATAMLA----LTTMN------TKKQLSSGMVGLLMSYSLEVTGSLT 1254

Query: 425  FGLSTFYSEIMQGAGAASRLFELTDRVPSISTTKGVKYK-----PGNGEIEFKNVSFAYP 479
            + + T    I     +  R+ E  + +PS + +   + +     P  G IEFKN S  Y 
Sbjct: 1255 WIVRTTVM-IETNIVSVERIVEYCE-LPSEARSINPENRPDESWPSKGSIEFKNYSTKY- 1311

Query: 480  TRPSNMIFKNLNFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPSSGEILIDGQNINDLN 539
                + + K++N +I+    + IVG +G GKST++L L +  +P+ G I+ID  NI+DL 
Sbjct: 1312 RENLDPVLKDINVRIKPCEKIGIVGRTGAGKSTLSLALFRILEPTEGSIVIDDINISDLG 1371

Query: 540  SKSLRRHIGLVQQEPILMSGTIRDNI----VYGLTEMPTKDEIRQVAKQC--FCHNFIT- 592
               LR H+ ++ Q+     GT+R N+     Y   E+    ++  +         N I  
Sbjct: 1372 LFDLRSHLAIIPQDAQAFEGTVRTNLDPFNRYSEGELKKAVDLAHLGPHLEKMLDNEIRG 1431

Query: 593  ---------RFQSSYDTVIGPHGTLLSGGQKQRIAIARALIKKPRILILDEATSALDVES 643
                           +  I  +GT LS GQ+Q + +ARAL+ + +IL+LDEAT+++D+E+
Sbjct: 1432 ADGAAEENGNVSDVLNVKINENGTNLSVGQRQLLCLARALLNRSKILVLDEATASVDMET 1491

Query: 644  EGAINYTFGQLMKKKEMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELWDDPTS 702
            +  I  T  +  K +  TI++IAHR+ T+  S+ +IVL  +G+V E     +L  D  S
Sbjct: 1492 DKIIQDTIRREFKDR--TILTIAHRIDTVLDSDKIIVL-DEGTVKEFDSPSKLLSDKAS 1547

 Score = 80.9 bits (198), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 99/423 (23%), Positives = 185/423 (43%), Gaps = 56/423 (13%)

Query: 331 KVAEEQLSGIKTVQSFVAEQREINRYNFAIRD--IFNIGKKAAVINAKFFSSTSA--MGD 386
           K   E L+ IK+++ +  E+  + R N    D  + N  K   V N  +F+      M  
Sbjct: 473 KTITEILNAIKSIKLYAWEEPMMERLNHVRNDMELQNFRKIGIVSNLIYFAWNCVPLMVT 532

Query: 387 LSFLTVLGFGSYLVLQNSLTIGDLTAFMMYTEYTGNSIFGLSTFYSEIMQGAGAASRL-- 444
            S   +    S   L  ++    L+ F +      ++I+ + +  + I++ + +  RL  
Sbjct: 533 CSTFGLFSLFSDTPLSPAIVFPSLSLFNI----LNSAIYSVPSMINTIIETSVSMERLKS 588

Query: 445 FELTDRVPSISTTKGVKYKPGNGE-----IEFKNVSFAYPTR------------------ 481
           F L+D    I  +   +  P   E     IE  N++F + ++                  
Sbjct: 589 FLLSDE---IDDSFIERIDPSMSERTLPVIEMNNITFLWKSKEALASGQFEGNSNADEES 645

Query: 482 ---PSNMIFKNLN-FKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPSSGEILIDGQNIND 537
               S +  KN++ F+ + G  VC+VG  G GKST       + K   G++     +   
Sbjct: 646 IIGSSQIALKNIDHFEAKRGDLVCVVGRVGAGKST-------FLKGILGQLPCMSGSKGS 698

Query: 538 LNSKSLRR--HIGLVQQEPILMSGTIRDNIVYGLTEMPTKDEIRQVAKQCFCHNFITRFQ 595
           +  K + R   +    QE  +M+ ++R+NI++G      K       K C     +    
Sbjct: 699 IPPKLIIRASSLAYCSQESWIMNSSVRENILFG--HKFDKAYYDLTIKACQLLPDLKILP 756

Query: 596 SSYDTVIGPHGTLLSGGQKQRIAIARALIKKPRILILDEATSALDVE-SEGAINYTF-GQ 653
              +T++G  G  LSGGQK R+++ARA+  +  I +LD+  SA+D E S+  + Y   G+
Sbjct: 757 DGDETLVGEKGISLSGGQKARLSLARAVYSRADIYLLDDVLSAVDAEVSKNIVEYVLIGK 816

Query: 654 LMKKKEMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELW--DDPTSELSQLLNEK 711
               K  TI+   + +  ++ S+ +  L  +G ++E G ++ +   ++  S+L +LL E 
Sbjct: 817 AALLKNKTIILATNTVPILKHSQMIYAL-ENGEIIEQGNYEGVMNRENTNSKLKKLLEEF 875

Query: 712 STP 714
            +P
Sbjct: 876 DSP 878

>Kwal_56.23844 s56 complement(733654..738138) [4485 bp, 1494 aa] {ON}
            YDR135C (YCF1) - metal resistance protein, similar to
            multidrug resistance proteins and cystic fibrosis protein
            CFTR [contig 171] FULL
          Length = 1494

 Score =  129 bits (325), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 127/486 (26%), Positives = 222/486 (45%), Gaps = 52/486 (10%)

Query: 241  FFDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGSVGIGMMXXXXXXXXXXXXVF 300
            FF+T  +G +++R  +D Y V   + +  S  F      +V +                 
Sbjct: 1020 FFETTPIGRVLNRFSNDIYKVDELLGRTFSQFF----VNAVKVSFTIIVICSSTWQFVFV 1075

Query: 301  TPPVILSASVFGKQISTTSRELQE----ATGHLTKVAEEQLSGIKTVQSFVAEQREINRY 356
              P+      + +    TSREL+         +    +E L GI T++ +  + R ++  
Sbjct: 1076 IIPLGTLYIYYQQYYLRTSRELRRLDSVTRSPIYAHFQETLGGISTIRGYQQQGRFLHI- 1134

Query: 357  NFAIRDIFNIGKKAAVIN--AKFFSSTSAMGDLSF-------LTVLGFGSYLVL---QNS 404
                        +A V N  + F+ S +A   L+F       + +LG  +  V    Q +
Sbjct: 1135 -----------NQARVDNNMSAFYPSVNANRWLAFRLEFIGSIIILGAATLSVFRLKQGA 1183

Query: 405  LTIGDLTAFMMYTEYTGNSIFGLSTFYSEIMQGAGAASRLFELTDRVPS----ISTTKGV 460
            LT G +   + Y      S+  +     E+     +  R+ E  +  P     I + +  
Sbjct: 1184 LTPGMIGLSVSYALQITQSLNWIVRMTVEVETNIVSVERIKEYANITPEAPAVIESNRPA 1243

Query: 461  KYKPGNGEIEFKNVSFAYPTRPS-NMIFKNLNFKIEAGSNVCIVGPSGRGKSTVALLLEK 519
            +  P +G I+F+N S  Y  RP  ++  +N+N  I+    + IVG +G GKS++ L L +
Sbjct: 1244 EDWPTHGAIKFENYSARY--RPELDLSLRNINIDIKPQERIGIVGRTGAGKSSLTLALFR 1301

Query: 520  YYKPSSGEILIDGQNINDLNSKSLRRHIGLVQQEPILMSGTIRDNIVYGLTEMPTKDEIR 579
              + + G I+IDG   + +  + LR H+ ++ Q+  +  GT+R+NI    T   T +EI 
Sbjct: 1302 IIEAAEGRIIIDGVPTDSIGLRDLRHHLSIIPQDSQVFEGTVRENI--DPTNEYTDEEIW 1359

Query: 580  QVAKQCFCHNFITRF-QSSYDTVIGPHGTLLSGGQKQRIAIARALIKKPRILILDEATSA 638
               +     + I    +   ++++   G  LS GQ+Q + +ARAL+   RIL+LDEAT+A
Sbjct: 1360 HALELAHLKDHIKSLGKDELESMLTEGGGNLSVGQRQLMCLARALLIPTRILVLDEATAA 1419

Query: 639  LDVESEGAINYTFGQLMKKKEMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELWD 698
            +DVE++  I  T     K +  TI++IAHR++TI  S+ ++VL       + GK  E  D
Sbjct: 1420 VDVETDQVIQETIRTAFKNR--TILTIAHRINTILDSDRILVL-------DSGKIAEF-D 1469

Query: 699  DPTSEL 704
             P + L
Sbjct: 1470 SPEALL 1475

 Score = 82.4 bits (202), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 70/274 (25%), Positives = 126/274 (45%), Gaps = 50/274 (18%)

Query: 450 RVPSISTTKGVKYKPGNGEIEFKNVSFAYPTRPSNMI-FKNLNFKIEAGSNVCIVGPSGR 508
           R P ++ T  V    G       + +F +  +P   +  KN+NF+ + G   CIVG  G 
Sbjct: 599 RKPKVTKTGEVAINVG------ADATFLWQRKPEYKVALKNINFQAKKGELTCIVGKVGS 652

Query: 509 GKSTVALLLEKYYKPSSGEILIDGQNINDL----NSKSLRRHIGLVQQEPILMSGTIRDN 564
           GKS                 LI G  + DL       S+   I  V Q P +M+GT+++N
Sbjct: 653 GKSA----------------LIQGI-LGDLFRVKGFASVHGSIAYVSQVPWIMNGTVKEN 695

Query: 565 IVYGLTEMPTKDEIRQVAKQCFCHNFITRFQSSYDTVIGPHGTLLSGGQKQRIAIARALI 624
           I++G       D      + C     ++      +T++G  G  LSGGQK RI++ARA+ 
Sbjct: 696 ILFG--HKYDADFYDTTLRACALAVDLSILPKGDETLVGEKGISLSGGQKARISLARAVY 753

Query: 625 KKPRILILDEATSALDVE-SEGAINYTFG---------QLMKKKEMTIVSIAHRLSTIRR 674
            +    +LD+  +A+D   ++  I +  G         +++   +++++SIA  +S    
Sbjct: 754 ARADTYLLDDPLAAVDEHVAKHLIEHVLGSQGLLSSKVKVLATNKISVLSIADHIS---- 809

Query: 675 SENVIVLGHDGSVVEMGKFKELWDDPTSELSQLL 708
                 L  +G +++ G ++E+  D +S LS+++
Sbjct: 810 ------LLENGEIIQQGSYEEVTSDKSSALSKII 837

>KLTH0G12716g Chr7 (1080818..1085320) [4503 bp, 1500 aa] {ON} highly
            similar to uniprot|P39109 Saccharomyces cerevisiae
            YDR135C
          Length = 1500

 Score =  129 bits (324), Expect = 9e-30,   Method: Compositional matrix adjust.
 Identities = 129/492 (26%), Positives = 224/492 (45%), Gaps = 45/492 (9%)

Query: 241  FFDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGSVGIGMMXXXXXXXXXXXXVF 300
            FF+T  +G +++R  +D + V   + +     F      ++ +               + 
Sbjct: 1026 FFETTPIGRILNRFSNDIFKVDELLGRT----FAQFFVNAIKVSFTIIVICFSTWQFILV 1081

Query: 301  TPPVILSASVFGKQISTTSRELQE----ATGHLTKVAEEQLSGIKTVQSFVAEQREINRY 356
              P+      + +    TSREL+         +    +E L GI T++ +  ++R ++  
Sbjct: 1082 ILPMGTLYIYYQQYYLRTSRELRRLDSVTRSPIYAHFQETLGGISTIRGYNQQKRFVHI- 1140

Query: 357  NFAIRDIFNIGKKAAVIN--AKFFSSTSAMGDLSF-------LTVLGFGSYLVL---QNS 404
                        +A V N  + ++ S +A   L+F       + +L   S  VL   Q +
Sbjct: 1141 -----------NQARVDNNMSAYYPSVNANRWLAFRLEFIGSVIILAASSLSVLRLKQGA 1189

Query: 405  LTIGDLTAFMMYTEYTGNSIFGLSTFYSEIMQGAGAASRLFE---LTDRVPS-ISTTKGV 460
            LT G +   + Y      S+  +     E+     +  R+ E   L    P+ I + +  
Sbjct: 1190 LTPGMIGLSVSYALQITQSLNWIVRMTVEVETNIVSVERIKEYANLESEAPAVIESNRPS 1249

Query: 461  KYKPGNGEIEFKNVSFAYPTRPS-NMIFKNLNFKIEAGSNVCIVGPSGRGKSTVALLLEK 519
            +  P  G I+F+N S  Y  RP   +  K++N  I+    + IVG +G GKS++ L L +
Sbjct: 1250 EDWPSQGSIKFENYSARY--RPELELSLKDINLDIKPQERIGIVGRTGAGKSSLTLALFR 1307

Query: 520  YYKPSSGEILIDGQNINDLNSKSLRRHIGLVQQEPILMSGTIRDNIVYGLTEMPTKDEIR 579
              + +SG I IDG  I+ +  + LR H+ ++ Q+  L  GTIR+NI    T   T ++I 
Sbjct: 1308 IIEAASGRIYIDGLPIDSIGLRDLRHHLSIIPQDSQLFEGTIRENI--DPTNEYTDEQIW 1365

Query: 580  QVAKQCFCHNFITRF-QSSYDTVIGPHGTLLSGGQKQRIAIARALIKKPRILILDEATSA 638
            +  +     + +    +   D  +   G+ LS GQ+Q + +ARAL+   +IL+LDEAT+A
Sbjct: 1366 RALELSHLKDHVKGLGKEELDAPLTEGGSNLSVGQRQLMCLARALLIPSKILVLDEATAA 1425

Query: 639  LDVESEGAINYTFGQLMKKKEMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELWD 698
            +DVE++  I  T     K +  TI++IAHR++TI  S+ ++VL   G V E      L  
Sbjct: 1426 VDVETDQVIQETIRTAFKNR--TILTIAHRINTILDSDRILVL-DSGKVAEFDTPDNLLK 1482

Query: 699  DPTSELSQLLNE 710
            +P S    L  E
Sbjct: 1483 NPESLFYSLCYE 1494

 Score = 74.3 bits (181), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 62/250 (24%), Positives = 114/250 (45%), Gaps = 40/250 (16%)

Query: 473 NVSFAYPTRPSNMI-FKNLNFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPSSGEILID 531
           + +F +  +P   +  KN+NF  + G   C+VG  G GKS +              IL D
Sbjct: 621 DATFLWQRKPEYKVALKNINFAAKKGKLTCVVGKVGSGKSALI-----------QAILGD 669

Query: 532 GQNINDLNSKSLRRHIGLVQQEPILMSGTIRDNIVYGLTEMPTKDE--IRQVAKQCFCHN 589
              +      S+   I  V Q P +M+GT++DNI++G       DE       K C    
Sbjct: 670 LFRVKGF--ASVHGSIAYVSQVPWIMNGTVKDNILFG----HKYDESFYTMTLKACALIV 723

Query: 590 FITRFQSSYDTVIGPHGTLLSGGQKQRIAIARALIKKPRILILDEATSALDVE-SEGAIN 648
            +        T++G  G  LSGGQK R+++ARA+  +    +LD+  +A+D   ++  + 
Sbjct: 724 DLAVLPKGDQTLVGEKGISLSGGQKARLSLARAVYARADTYLLDDPLAAVDEHVTKHLVE 783

Query: 649 YTFG---------QLMKKKEMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELWDD 699
           +  G         +++   ++T++SIA            I L  +G +++ G + ++   
Sbjct: 784 HVLGPNGLLASKTKVLATNKITVLSIADH----------IALLENGEIIQQGSYDDVTSA 833

Query: 700 PTSELSQLLN 709
            +S LS++++
Sbjct: 834 KSSALSKIIS 843

>Kpol_1060.7 s1060 complement(13248..17630) [4383 bp, 1460 aa] {ON}
            complement(13248..17630) [4383 nt, 1461 aa]
          Length = 1460

 Score =  129 bits (323), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 129/504 (25%), Positives = 227/504 (45%), Gaps = 62/504 (12%)

Query: 225  RLRATVIKKTIHQDAEFFDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGSVGIG 284
            +L  + +++ +H    F DT  +G +++R   D   +   +T+ V     A     +G+ 
Sbjct: 951  KLNLSAVRRILHTPMAFLDTTPLGRILNRFTKDTDSLDNELTENVRLML-AQFANIIGVC 1009

Query: 285  MMXXXXXXXXXXXXVFTPPVILSASVFGKQISTTSRELQEATG----HLTKVAEEQLSGI 340
            +M            +  P ++L   +      +  RE++         +     E L G+
Sbjct: 1010 VMCIIYLPWFA---IAIPFILLIFVLVSNHYQSAGREIKRLEAIQRSFVYNNLNEVLGGM 1066

Query: 341  KTVQSFVAEQREINRYNFAIRDIFNIGKKAAVINAKFFSSTSAMGDLSFLTVLGF----- 395
             T++ + +E+R + + ++ I D  N      V   ++ +    M  + F  ++       
Sbjct: 1067 DTIRFYNSEERFMAKSDYLI-DKMNEAGYLVVCVQRWVAVLLDMIAVCFALIIALLCVTR 1125

Query: 396  ---------GSYL--VLQNSLTIGDLTAFMMYTEYTGNSIFGLSTFYSEIMQGAGAASRL 444
                     G  L  VLQ    +  +   +  TE   NS+  L ++ +E+   A      
Sbjct: 1126 QFHISASSVGVLLTYVLQLPGLLNTVLRALTQTENDMNSVERLVSYATELPTEAAY---- 1181

Query: 445  FELTDRVPSISTTKGVKYKPGNGEIEFKNVSFAY-PTRPSNMIFKNLNFKIEAGSNVCIV 503
                 R P  S        P  G+I+F+ VSFAY P  P+  + KNL+  I  G  + I 
Sbjct: 1182 -----RKPESSPDPSW---PQEGKIDFEEVSFAYRPGLPA--VLKNLSMSINGGEKIGIC 1231

Query: 504  GPSGRGKSTVALLLEKYYKPSSGEILIDGQNINDLNSKSLRRHIGLVQQEPILMSGTIRD 563
            G +G GKST+   L +  +  SG I+IDG NI+++    LRR + ++ Q+P+L  GTIR 
Sbjct: 1232 GRTGAGKSTIMSALYRLNELESGRIIIDGVNISNIGLFDLRRSLSIIPQDPVLFRGTIRK 1291

Query: 564  NI-VYG------LTEMPT------KDEIRQVAKQCFCHNFITRFQSSY----DTVIGPHG 606
            N+  +G      L +  +      K+ + +V  Q    N  ++ Q  +    D  +   G
Sbjct: 1292 NLDPFGERSDDELWDALSRGGSIDKESLEEVKTQKSTGN--SKVQELHKFHLDQEVEEEG 1349

Query: 607  TLLSGGQKQRIAIARALIKKPRILILDEATSALDVESEGAINYTFGQLMKKKEMTIVSIA 666
            +  S G++Q +A+ARAL++  ++LILDEATS++D E++  I     +     E TI+ IA
Sbjct: 1350 SNFSLGERQLLALARALVRNSKVLILDEATSSVDYETDNKIQNRIIEAF--SECTILCIA 1407

Query: 667  HRLSTIRRSENVIVLGHDGSVVEM 690
            HRL TI   + ++VL   G + E 
Sbjct: 1408 HRLKTILNYDRILVL-EKGEIAEF 1430

 Score = 85.9 bits (211), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 67/212 (31%), Positives = 101/212 (47%), Gaps = 22/212 (10%)

Query: 487 FKNLNFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPSSGEILIDGQNINDLNSKSLRRH 546
           FK++N +I  G  + I GP G GK+++   +    + + G + I+G+             
Sbjct: 604 FKDINLEIHKGEFIMITGPIGTGKTSLLNAMSGLMEKTEGSVQINGE------------- 650

Query: 547 IGLVQQEPILMSGTIRDNIVYGLTEMPTKDEIRQVAKQCFCHNFITRFQSSYDTVIGPHG 606
             L+   P + + T+RDNI++G      K +   V K C     +    +   T IG  G
Sbjct: 651 -LLMGGYPWIQNATVRDNIIFG--SPFDKSKYNMVVKACCLDADLDILPAGDMTEIGERG 707

Query: 607 TLLSGGQKQRIAIARALIKKPRILILDEATSALDVESEGAI--NYTFGQLMKKKEMTIVS 664
             LSGGQK RI +AR + K   I + D+  SA+D      I      G L  K   T V 
Sbjct: 708 INLSGGQKARINLARCVYKNKDIYLFDDVLSAVDSRVGKLIMDECLLGLLNGK---TRVL 764

Query: 665 IAHRLSTIRRSENVIVLGHDGSVVEMGKFKEL 696
             H+LS +  +  VIVLG+DGS V++G  +EL
Sbjct: 765 ATHQLSLVENASRVIVLGNDGS-VDIGTVEEL 795

>Skud_12.22 Chr12 complement(31933..36918) [4986 bp, 1661 aa] {ON}
            YLL048C (REAL)
          Length = 1661

 Score =  129 bits (323), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 143/540 (26%), Positives = 243/540 (45%), Gaps = 108/540 (20%)

Query: 230  VIKKTIHQDAEFFDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALI-CGSVGIGMMXX 288
            ++ K +H    FFD    G +++R   D   + + +T  +   F +LI C S  I +   
Sbjct: 1141 ILNKVLHSKIRFFDATPTGRIMNRFSKDIEAIDQELTPYIQGAFYSLIECLSTVILI--- 1197

Query: 289  XXXXXXXXXXVFTPPVILSASVF--------GKQISTTSRELQE----ATGHLTKVAEEQ 336
                       F  P  LS ++         G      SREL+     +   + +   E 
Sbjct: 1198 ----------TFITPQFLSIAIVVSILYYFVGYFYMAGSRELKRFESISRSPIYQHFSET 1247

Query: 337  LSGIKTVQSFVAEQREINRYNFAIRDIFNIGKKAAVINAKFFSSTSAMGDLSF------- 389
            L G+ T+++F  E R      F   ++  I +     N  FF    A   L+F       
Sbjct: 1248 LVGVTTIRAFGDEGR------FMQENLQKIDEN----NKPFFYLWVANRWLAFRIDMIGS 1297

Query: 390  LTVLGFGSYLV-----LQNSLTIGDLTAFMMYTEYTGNSIFGLSTFYSEIMQGAGAASRL 444
            L + G G +++     + + +    LT  + +TE        L   YSE+     +  R+
Sbjct: 1298 LVIFGAGLFILFNIDHIDSGMAGISLTYAISFTE----GALWLVRLYSEVEMNMNSVERV 1353

Query: 445  FELT--DRVPSISTTKGV--KYKPGNGEIEFKNVSFAY-PTRPSNMIFKNLNFKIEAGSN 499
             E    ++ P  +  K V     P +G+IE  ++S  Y P  P   +  N++F ++A S 
Sbjct: 1354 KEYMKIEQEP-YNQHKEVPPSQWPQDGKIEVNDLSLRYAPNLPR--VINNVSFSVDAQSK 1410

Query: 500  VCIVGPSGRGKSTVALLLEKYYKPSSGEILIDGQNINDLNSKSLRRHIGLVQQEPILMSG 559
            + IVG +G GKST+   L ++ +P +G I ID  +I+ ++ + LRR I ++ Q+P L SG
Sbjct: 1411 IGIVGRTGAGKSTIITALFRFLEPETGHIKIDNIDISGVDLQRLRRSITIIPQDPTLFSG 1470

Query: 560  TIRDNIVYGLTEMPTKDEIRQVAKQCFCHNFITRFQSSYDTV------------------ 601
            TI+ N+     E   K +I +  K+    N I+  QS    V                  
Sbjct: 1471 TIKTNLD-PYDEFSDK-KIFEALKRV---NLISEEQSHQGAVREADNDTSSNSSENINKF 1525

Query: 602  ------IGPHGTLLSGGQKQRIAIARALIKKPRILILDEATSALDVESEGAINYTFGQLM 655
                  +   G+ LS GQ+Q + +AR+L++ P+I++LDEAT+++D  S+  I  T     
Sbjct: 1526 LDLSSEVSEGGSNLSQGQRQLMCLARSLLRSPKIILLDEATASIDYSSDAKIQETI---- 1581

Query: 656  KKKEM---TIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELWDDPTSELSQLLNEKS 712
             +KE    TI++IAHRL ++   + ++V+       + G+ KE +D P    S LLN++S
Sbjct: 1582 -RKEFQGSTILTIAHRLRSVIDYDKILVM-------DAGEVKE-YDHP---YSLLLNKQS 1629

 Score = 82.8 bits (203), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 70/259 (27%), Positives = 121/259 (46%), Gaps = 25/259 (9%)

Query: 449 DRVPSISTTKGVK------YKPGNGEIEFKNVSFAYPTRPSNMIFKNLNFKIEAGSNVCI 502
           DRV      K  K        P       +N + ++     +   K+LN + + G    +
Sbjct: 668 DRVQDFLNEKDTKKYDQLTIDPNGKRFALENSTISWDKDNQDFKLKDLNIEFKTGKLNVV 727

Query: 503 VGPSGRGKSTV--ALLLEKYYKPSSGEILIDG-----QNINDLNSKSLRRHIGLVQQEPI 555
           +GP+G GK+++  ALL E Y    +G+I++       + + D N  +    I    Q   
Sbjct: 728 IGPTGSGKTSLLMALLGEMYLL--NGKIVVPALEPRQELVVDANGTT--NSIAYCSQGAW 783

Query: 556 LMSGTIRDNIVYGLTEMPTKD-EIRQVAKQCFCHNFITRFQSSYDTVIGPHGTLLSGGQK 614
           L++ TI+ NI++     P  +   + V + C         ++   T IG  G  LSGGQK
Sbjct: 784 LLNDTIKHNILFN---SPFNEARYKAVVEACGLKRDFEILKAGDLTEIGEKGIALSGGQK 840

Query: 615 QRIAIARALIKKPRILILDEATSALDVESEGAI--NYTFGQLMKKKEMTIVSIAHRLSTI 672
           QR+++ARAL    R ++LD+  SA+D  +   I  N   G LM+ +  T + ++H ++  
Sbjct: 841 QRVSLARALYSNARHVLLDDCLSAVDSHTASWIYDNCITGPLMEDR--TCILVSHNIALT 898

Query: 673 RRSENVIVLGHDGSVVEMG 691
            R+  ++VL  DG + + G
Sbjct: 899 LRNAELVVLLEDGRIKDQG 917

>Kwal_26.9532 s26 complement(1256241..1260656) [4416 bp, 1471 aa] {ON}
            YGR281W (YOR1) - ABC transporter [contig 363] FULL
          Length = 1471

 Score =  128 bits (322), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 124/493 (25%), Positives = 217/493 (44%), Gaps = 42/493 (8%)

Query: 226  LRATVIKKTIHQDAEFFDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGSVGIGM 285
            L    +K+ +H    F DT  +G +++R   D   +   +T+ V   F       VG+ +
Sbjct: 961  LNLKAVKRLLHTPMSFLDTTPIGRVLNRFTKDTDTLDTELTESVR-LFLFQASNIVGVVI 1019

Query: 286  MXXXXXXXXXXXXVFTPPVILSASVFGKQISTTSRELQ--EAT--GHLTKVAEEQLSGIK 341
            M            +  P ++L  +       ++SRE++  EA    H+     E LSG+ 
Sbjct: 1020 MCIIYLPWFA---IAVPFLLLIFAAVADHYQSSSREIKRLEAVQRSHVFNNFNEVLSGMD 1076

Query: 342  TVQSFVAEQREINRYNFAIRDIFNIGKKAAVINAKFFSSTSAMGDLSFLTVLGFGSYLVL 401
            T++++  E R + + +F I  +   G     I  ++ S    M  ++F  ++   + L +
Sbjct: 1077 TIRAYRGEARFLTKSDFLINKMNEAGYVVVAIQ-RWVSIALDMIAMAFALII---TLLCV 1132

Query: 402  QNSLTIGDLTAFMMYTEYTGNSIFGLSTFYSEIMQGAG---AASRLFELTDRVPSIST-- 456
                +I   +  ++ T Y       L+T    + QG     +A RL      +P  +   
Sbjct: 1133 TRQFSISAASVGVLLT-YVLQLPGLLNTLMRAMTQGENDMNSAERLISYATDLPLEAAYR 1191

Query: 457  ---TKGVKYKPGNGEIEFKNVSFAY-PTRPSNMIFKNLNFKIEAGSNVCIVGPSGRGKST 512
               T   +  P  G I+F +VS AY P  P  ++  +++  +  G  + I G +G GKST
Sbjct: 1192 RPETSPPESWPSEGAIDFDHVSLAYRPGLP--LVLHDVSLHVRGGEKIGICGRTGAGKST 1249

Query: 513  VALLLEKYYKPSSGEILIDGQNINDLNSKSLRRHIGLVQQEPILMSGTIRDNI------- 565
            +   L +  +   G I IDG +I  L    LR  + ++ Q+P+L  G +R N+       
Sbjct: 1250 IMSALYRMIELHDGSITIDGIDIAQLGLYELRSKLAIIPQDPVLFKGDVRKNLDPFHERS 1309

Query: 566  -------VYGLTEMPTKDEIRQVAKQCFCHNFITRFQSSY-DTVIGPHGTLLSGGQKQRI 617
                   +     + T+DE    A        +T     + +  +   G+  S G++Q +
Sbjct: 1310 DNELWDALVRAGAIATEDEAAARAVTRATAGALTNLHKFHLEQEVEEDGSNFSLGERQLL 1369

Query: 618  AIARALIKKPRILILDEATSALDVESEGAINYTFGQLMKKKEMTIVSIAHRLSTIRRSEN 677
            A+ RAL++  RILILDEATS++D E++  I           E T++ IAHRL+TI   + 
Sbjct: 1370 ALTRALVRSSRILILDEATSSVDYETDAKIQARIADAF--SECTVLCIAHRLNTILDYDR 1427

Query: 678  VIVLGHDGSVVEM 690
            ++VL   G V E 
Sbjct: 1428 ILVLDQ-GRVCEF 1439

 Score = 83.6 bits (205), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 72/214 (33%), Positives = 101/214 (47%), Gaps = 26/214 (12%)

Query: 487 FKNLNFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPSSGEILIDGQNINDLNSKSLRRH 546
           FKNLN +I  G  V + G  G GKS++   +  + K  SG+I  +G         SL   
Sbjct: 594 FKNLNIEIAKGELVIVTGSVGTGKSSLLAAMSGFMKKKSGDIYKNG---------SL--- 641

Query: 547 IGLVQQEPILMSGTIRDNIVYG--LTEMPTKDEIRQVAKQCFCHNFITRFQSSYDTVIGP 604
             L+   P + + T++DNI++G    E   K+ IR     C     +    +   T IG 
Sbjct: 642 --LLCGYPWIQNTTVKDNILFGSPFDEARYKETIRV----CSLQADLDLLPAGDKTEIGE 695

Query: 605 HGTLLSGGQKQRIAIARALIKKPRILILDEATSALDVESEGAI--NYTFGQLMKKKEMTI 662
            G  LSGGQK RI +AR++ KK  I + D+  SA+D      I      G L  K   T 
Sbjct: 696 RGITLSGGQKARINLARSVYKKKDIYLFDDVLSAVDARVGKHIMDECMMGALDGK---TR 752

Query: 663 VSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKEL 696
           V   H+LS I R+  VI +  DG+ V+ G   EL
Sbjct: 753 VLATHQLSLIARASKVIFIDLDGT-VDSGTLDEL 785

>YDR135C Chr4 complement(723004..727551) [4548 bp, 1515 aa] {ON}
            YCF1Vacuolar glutathione S-conjugate transporter; member
            of the ATP-binding cassette family; has a role in
            detoxifying metals such as cadmium, mercury, and
            arsenite; also transports unconjugated bilirubin,
            selenodigluthatione, and oxidized glutathione; similar to
            human cystic fibrosis protein CFTR
          Length = 1515

 Score =  128 bits (322), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 125/481 (25%), Positives = 217/481 (45%), Gaps = 23/481 (4%)

Query: 241  FFDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGSVGIGMMXXXXXXXXXXXXVF 300
            FF+T  +G +++R  +D Y V   + +  S  F      +V +                 
Sbjct: 1040 FFETTPIGRILNRFSNDIYKVDALLGRTFSQFF----VNAVKVTFTITVICATTWQFIFI 1095

Query: 301  TPPVILSASVFGKQISTTSRELQE----ATGHLTKVAEEQLSGIKTVQSFVAEQREINRY 356
              P+ +    + +    TSREL+         +    +E L G+ TV+ + ++Q+  +  
Sbjct: 1096 IIPLSVFYIYYQQYYLRTSRELRRLDSITRSPIYSHFQETLGGLATVRGY-SQQKRFSHI 1154

Query: 357  NFAIRDIFNIGKKAAVINAKFFSS--TSAMGDLSFLTVLGFGSYLVLQNSLTIGDLTAFM 414
            N   R   N+      INA  + +     +G +  L       + + Q +LT G +   +
Sbjct: 1155 N-QCRIDNNMSAFYPSINANRWLAYRLELIGSIIILGAATLSVFRLKQGTLTAGMVGLSL 1213

Query: 415  MYTEYTGNSIFGLSTFYSEIMQGAGAASRLFELTD---RVPSI-STTKGVKYKPGNGEIE 470
             Y      ++  +     E+     +  R+ E  D     P I    +  K  P  G+I+
Sbjct: 1214 SYALQITQTLNWIVRMTVEVETNIVSVERIKEYADLKSEAPLIVEGHRPPKEWPSQGDIK 1273

Query: 471  FKNVSFAYPTRPS-NMIFKNLNFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPSSGEIL 529
            F N S  Y  RP  +++ K++N  I+    V IVG +G GKS++ L L +  + S G I+
Sbjct: 1274 FNNYSTRY--RPELDLVLKHINIHIKPNEKVGIVGRTGAGKSSLTLALFRMIEASEGNIV 1331

Query: 530  IDGQNINDLNSKSLRRHIGLVQQEPILMSGTIRDNIVYGLTEMPTKDEIRQVAKQCFCHN 589
            ID   IN++    LR  + ++ Q+  +  GT+R+NI   + +   +   R +       +
Sbjct: 1332 IDNIAINEIGLYDLRHKLSIIPQDSQVFEGTVRENID-PINQYTDEAIWRALELSHLKEH 1390

Query: 590  FITRFQSSYDTVIGPHGTLLSGGQKQRIAIARALIKKPRILILDEATSALDVESEGAINY 649
             ++      D  +   G  LS GQ+Q + +ARA++   +IL+LDEAT+A+DVE++  +  
Sbjct: 1391 VLSMSNDGLDAQLTEGGGNLSVGQRQLLCLARAMLVPSKILVLDEATAAVDVETDKVVQE 1450

Query: 650  TFGQLMKKKEMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELWDDPTSELSQLLN 709
            T     K +  TI++IAHRL+TI  S+ +IVL  +G V E     +L  D  S    L  
Sbjct: 1451 TIRTAFKDR--TILTIAHRLNTIMDSDRIIVLD-NGKVAEFDSPGQLLSDNKSLFYSLCM 1507

Query: 710  E 710
            E
Sbjct: 1508 E 1508

 Score = 79.0 bits (193), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 89/407 (21%), Positives = 176/407 (43%), Gaps = 64/407 (15%)

Query: 330 TKVAEEQLSGIKTVQSFVAEQ-----REINRYNFAIRDIFNIGKKAAVINAKFFSSTSAM 384
           T+V  E L+ IK+++ +  E+      E  R N  ++++  +G   AV + +F       
Sbjct: 484 TRVISEILNNIKSLKLYAWEKPYREKLEEVRNNKELKNLTKLGCYMAVTSFQF------- 536

Query: 385 GDLSFL-TVLGFGSYLVLQNSLTIGDLTAFMMYTEYTGNSIFGLSTF--------YSEIM 435
             + FL +   F  ++  ++     DL        +   ++F L +F         +  +
Sbjct: 537 NIVPFLVSCCTFAVFVYTEDRALTTDLV-------FPALTLFNLLSFPLMIIPMVLNSFI 589

Query: 436 QGAGAASRLFEL----------TDRVPSISTTKGVKYKPGNGEIEFKNVSFAYPTRPSNM 485
           + + +  RLF              R+P +     V    G+      + +F +  +P   
Sbjct: 590 EASVSIGRLFTFFTNEELQPDSVQRLPKVKNIGDVAINIGD------DATFLWQRKPEYK 643

Query: 486 I-FKNLNFKIEAGSNVCIVGPSGRGKSTV-ALLLEKYYKPSSGEILIDGQNINDLNSKSL 543
           +  KN+NF+ + G+  CIVG  G GK+ + + +L   ++   G   + G           
Sbjct: 644 VALKNINFQAKKGNLTCIVGKVGSGKTALLSCMLGDLFR-VKGFATVHGS---------- 692

Query: 544 RRHIGLVQQEPILMSGTIRDNIVYGLTEMPTKDEIRQVAKQCFCHNFITRFQSSYDTVIG 603
              +  V Q P +M+GT+++NI++G       +   +  K C     +        T++G
Sbjct: 693 ---VAYVSQVPWIMNGTVKENILFG--HRYDAEFYEKTIKACALTIDLAILMDGDKTLVG 747

Query: 604 PHGTLLSGGQKQRIAIARALIKKPRILILDEATSALDVE-SEGAINYTFGQLMKKKEMTI 662
             G  LSGGQK R+++ARA+  +    +LD+  +A+D   +   I +  G        T 
Sbjct: 748 EKGISLSGGQKARLSLARAVYARADTYLLDDPLAAVDEHVARHLIEHVLGPNGLLHTKTK 807

Query: 663 VSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELWDDPTSELSQLLN 709
           V   +++S +  ++++ +L  +G + + G + E+  D  S L +LLN
Sbjct: 808 VLATNKVSALSIADSIALLD-NGEITQQGTYDEITKDADSPLWKLLN 853

>TPHA0A05620 Chr1 (1273220..1277653) [4434 bp, 1477 aa] {ON} Anc_5.10
            YGR281W
          Length = 1477

 Score =  128 bits (321), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 127/515 (24%), Positives = 216/515 (41%), Gaps = 62/515 (12%)

Query: 226  LRATVIKKTIHQDAEFFDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGSVGIGM 285
            L    +K+ IH    F DT  +G +++R   D   +   + + V           VG+ +
Sbjct: 968  LNIQALKRIIHTPMSFMDTTPIGRILNRFTKDTDSLDNELIENVRLTVSQF-ANIVGVCV 1026

Query: 286  MXXXXXXXXXXXXVFTPPVILSASVFGKQISTTSRELQEATG----HLTKVAEEQLSGIK 341
            M            +  P ++           +  RE++         +     E L G+ 
Sbjct: 1027 MCIVYLPWFA---IAVPFLVFIFVFIQNHYQSAGREIKRLEAIQRSFVYNNFNEILGGMD 1083

Query: 342  TVQSFVAEQREINRYNFAIRDIFNIGKKAAVINAKFFSSTSAMGDLSFLTVLGFGSYLVL 401
            T++ + +E+R I + ++ I D  N      V   ++ +    M  ++F  ++     +  
Sbjct: 1084 TIKFYKSEERYIAKSDYLI-DKMNEAGYLTVCVQRWVAILVDMIAVAFALIITLLC-VTR 1141

Query: 402  QNSLTIGDLTAFMMYTEYTGNSIFGLSTFYSEIMQGAGAASRLFELTDRVPSIST----- 456
            Q  ++   +   + Y       +  L   ++ +++           T+R+ S +T     
Sbjct: 1142 QFHISASSVGVLLTY-------VLQLPGLFNTLLRAVSQVENDMNSTERLVSYATDLPLE 1194

Query: 457  -------TKGVKYKPGNGEIEFKNVSFAY-PTRPSNMIFKNLNFKIEAGSNVCIVGPSGR 508
                   T   +  P  G I+F+NV FAY P  P  ++ KN+N +I     + I G +G 
Sbjct: 1195 AQYHKPETAPPESWPEEGTIKFENVDFAYRPGLP--IVLKNINLQINGTEKIGICGRTGA 1252

Query: 509  GKSTVALLLEKYYKPSSGEILIDGQNINDLNSKSLRRHIGLVQQEPILMSGTIRDN---- 564
            GKST+   L +  + +SG ILID  +IN L    LR+ + ++ Q+P+L  G IR N    
Sbjct: 1253 GKSTIMTALYRLNELTSGSILIDDVDINKLGLHELRKKLAIIPQDPVLFRGDIRKNLDPF 1312

Query: 565  -----------IVYGLTEMP-----TKDE-IRQVAKQCFCHNFITRFQSSYDTVIGPHGT 607
                       +V G    P     TK + I +       H F        D V+   G 
Sbjct: 1313 HERTDEELWDVLVRGGAIAPEDLAETKAQHITEDGTSADLHKF------HLDKVVEEDGA 1366

Query: 608  LLSGGQKQRIAIARALIKKPRILILDEATSALDVESEGAINYTFGQLMKKKEMTIVSIAH 667
              S G++Q +A+ RAL++  +ILILDEATS++D E++  I             TI+ IAH
Sbjct: 1367 NFSLGERQILALTRALVRNTKILILDEATSSVDYETDRKIQERIATAF--SHCTILCIAH 1424

Query: 668  RLSTIRRSENVIVLGHDGSVVEMGKFKELWDDPTS 702
            RL TI   + ++VL H G V E      L+ D T+
Sbjct: 1425 RLKTILNYDRILVLEH-GEVAEFDTPMNLFKDETT 1458

 Score = 98.2 bits (243), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 69/206 (33%), Positives = 111/206 (53%), Gaps = 20/206 (9%)

Query: 487 FKNLNFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPSSGEILIDGQNINDLNSKSLRRH 546
           F NLNF+I+ G  V I GP G GK+++      + + +SG I I+G    DL        
Sbjct: 612 FTNLNFEIKKGEFVMITGPIGTGKTSLLNSFAGFMEKTSGTIQING----DL-------- 659

Query: 547 IGLVQQEPILMSGTIRDNIVYGLTEMPTKDEIRQVAKQCFCHNFITRFQSSYDTVIGPHG 606
             L+   P + + T+RDNI++G      +D+ ++V + C   + +    +   T IG  G
Sbjct: 660 --LMGGYPWIQNATVRDNIIFG--SPYEEDKYKEVLRACSLESDLDILPAGDKTEIGERG 715

Query: 607 TLLSGGQKQRIAIARALIKKPRILILDEATSALDVE-SEGAINYTFGQLMKKKEMTIVSI 665
             LSGGQK RI +AR + K+  I +LD+  SA+D    +  ++    +L+  K   + + 
Sbjct: 716 ITLSGGQKARINLARCVYKEKDIYLLDDVLSAVDSRVGKHIMDECLTKLIGNKTRLLAT- 774

Query: 666 AHRLSTIRRSENVIVLGHDGSVVEMG 691
            H+LS I ++  +IVLG+DGS VE+G
Sbjct: 775 -HQLSLIDKASRIIVLGNDGS-VEIG 798

>TPHA0F00180 Chr6 complement(23050..27990) [4941 bp, 1646 aa] {ON}
            Anc_4.6 YHL035C
          Length = 1646

 Score =  128 bits (321), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 141/522 (27%), Positives = 236/522 (45%), Gaps = 80/522 (15%)

Query: 230  VIKKTIHQDAEFFDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGSVGIGMMXXX 289
            ++ K +H    FFD+  +G +++R   D   + + +T  V    ++++  SV +      
Sbjct: 1136 LLSKVLHSKLRFFDSTPIGRIMNRFSKDIEAIDQELTPYV----ESVVYNSVQLIATVLL 1191

Query: 290  XXXXXXXXXVFTPPVILSASVFGKQISTTSRELQ--EATGH--LTKVAEEQLSGIKTVQS 345
                     V    VIL     G    + SREL+  E+T    + +   E L G+ T+++
Sbjct: 1192 ITYITNGFIVVALLVILLYYFVGVYYLSGSRELKRFESTTKSPIYQHFSETLVGVTTIRA 1251

Query: 346  FVAEQREINRYNFAIRDIFNIGKKAAVINAKFFSSTSAMGDLSF-------LTVLGFGSY 398
            +  E R      F   ++  I +     N  FF    A   L F       L + G G  
Sbjct: 1252 YGDEIR------FMKENLTKIDEN----NKPFFYLWVANRWLCFRIDIIGSLVIFGAG-V 1300

Query: 399  LVLQNSLTIGD------LTAFMMYTEYTGNSIFGLSTFYSEIMQGAGAASRLFELTDRVP 452
            LVL N   I        LT  + +TE    S   L   YS +     +  R+ E  D + 
Sbjct: 1301 LVLMNINKIDSGLAGISLTYAITFTE----SALWLVRSYSNVEINMNSVERVKEYMD-IE 1355

Query: 453  SISTTKGV----KYKPGNGEIEFKNVSFAY-PTRPSNMIFKNLNFKIEAGSNVCIVGPSG 507
                + G+    K  P  G+IE  ++S  Y P+ P   + KN++F +E    V +VG +G
Sbjct: 1356 QEPYSAGIVNVDKSWPSEGKIEVNDLSLRYAPSLPK--VIKNVSFTVEPKMKVGVVGRTG 1413

Query: 508  RGKSTVALLLEKYYKPSSGEILIDGQNINDLNSKSLRRHIGLVQQEPILMSGTIRDNI-- 565
             GKST+   L ++  P +G I ID  +I  ++ K LR+ I ++ Q+P L +GTI+ N+  
Sbjct: 1414 AGKSTIITALFRFLDPETGYIKIDNIDITTIDLKKLRKSITIIPQDPTLFTGTIKSNLDP 1473

Query: 566  ---------------VYGLTEMPTKDEIRQVAKQCFCHNFITRFQSSYDTVIGPHGTLLS 610
                           V  + +     ++  V+ +    N     QS     I   G+ LS
Sbjct: 1474 YNEYNDDQIFKALRRVNLIVDGNLNSDVTSVSSENV--NKFLNLQSE----ISEGGSNLS 1527

Query: 611  GGQKQRIAIARALIKKPRILILDEATSALDVESEGAINYTFGQLMKKKEMTIVSIAHRLS 670
             GQ+Q + +AR+L++ P I++LDEAT+++D  S+  I  T     + K+ TI++IAHRL 
Sbjct: 1528 QGQRQLMCLARSLLRAPNIMLLDEATASIDYASDAKIQGTIRN--EFKDSTILTIAHRLR 1585

Query: 671  TIRRSENVIVLGHDGSVVEMGKFKELWDDPTSELSQLLNEKS 712
            ++   + ++V+       + G+ KE +D P    S LLN+ S
Sbjct: 1586 SVIDYDKILVM-------DAGEVKE-YDHP---YSLLLNKNS 1616

 Score = 83.2 bits (204), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 64/242 (26%), Positives = 119/242 (49%), Gaps = 12/242 (4%)

Query: 456 TTKGVKYKPGNGEIEFKNVSFAYPTRPSNMIFKNLNFKIEAGSNVCIVGPSGRGKSTVAL 515
           T K  +   GN +I  +NV+ ++  +  +   +NLN   + G    ++GP+G GK+++ +
Sbjct: 686 TKKYEQLSLGN-KISLENVTVSWNKQKQDFKLRNLNIDFKVGKLNVVIGPTGSGKTSLLM 744

Query: 516 LLEKYYKPSSGEILI---DGQNINDLNSKSLRRHIGLVQQEPILMSGTIRDNIVYGLTEM 572
            L        G+I +   D +     +S  L   +    Q   L++ T+++NI++     
Sbjct: 745 ALLGEMHLLEGKITVPSLDPRCEMTFDSDGLSNSMAYCSQAAWLLNDTVKNNILFNAEY- 803

Query: 573 PTKDEIRQVAKQCFCHNFITRFQSSYDTVIGPHGTLLSGGQKQRIAIARALIKKPRILIL 632
             ++    V   C          +   T IG  G  LSGGQKQRI++ARAL    + ++L
Sbjct: 804 -NEERYLAVISACALKRDFEILAAGDLTEIGERGITLSGGQKQRISLARALYSSSKHILL 862

Query: 633 DEATSALDVESEGAI--NYTFGQLMKKKEMTIVSIAHRLS-TIRRSENVIVLGHDGSVVE 689
           D+  SA+D  +   I  N   G LM+ +  T + ++H ++ T++ +E VI++  +G +  
Sbjct: 863 DDCLSAVDSHTAAWIYDNCIIGPLMENR--TCILVSHNVALTLKNAEQVIMID-NGKISH 919

Query: 690 MG 691
           +G
Sbjct: 920 IG 921

>TDEL0F04300 Chr6 complement(802866..807410) [4545 bp, 1514 aa] {ON}
            Anc_8.303 YDR135C
          Length = 1514

 Score =  128 bits (321), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 128/488 (26%), Positives = 222/488 (45%), Gaps = 52/488 (10%)

Query: 241  FFDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGSVGIGMMXXXXXXXXXXXXVF 300
            FF+T  +G +++R  +D Y V   + +     F         +                 
Sbjct: 1042 FFETTPIGRILNRFSNDIYKVDELLGRT----FAQFFVNVTKVSFTIIVICVTTWQFIFL 1097

Query: 301  TPPVILSASVFGKQISTTSRELQEATGHLTKVA-----EEQLSGIKTVQSFVAEQREINR 355
              P+I+    + +    TSREL+     +TK       +E L G+ T++ +  + R    
Sbjct: 1098 ILPMIVLYVYYQQYYLRTSRELRRLDS-VTKSPVYAHFQESLGGLSTIRGYDQQDR---- 1152

Query: 356  YNFAIRDIFNIGKKAAVIN--AKFFSSTSAMGDLSFL-----TVLGFGSYLVLQNSLTIG 408
                    F    ++ + N  + F+ S +A   L+F      T++ FG+  +    L  G
Sbjct: 1153 --------FTHINQSRIDNNMSAFYPSVNANRWLAFRLEFIGTIIIFGAASLSMLRLKAG 1204

Query: 409  DLTAFMM-----YTEYTGNSIFGLSTFYSEIMQGAGAASRLFELTD---RVP-SISTTKG 459
             LT  M+     Y      S+  +     E+     +  R+ E ++     P  I   + 
Sbjct: 1205 SLTPGMIGLSLSYALQITQSLNWIVRMTVEVETNIVSVERIKEYSEIKSEAPLVIEDHRP 1264

Query: 460  VKYKPGNGEIEFKNVSFAYPTRPSNMIFKNLNFKIEAGSNVCIVGPSGRGKSTVALLLEK 519
                P  G+I+F++ S  Y     N++ K++N  ++    + IVG +G GKS++ L L +
Sbjct: 1265 PADWPSKGDIKFEHYSTRY-RENMNLVLKDINLHVKPQEKIGIVGRTGAGKSSLTLALFR 1323

Query: 520  YYKPSSGEILIDGQNINDLNSKSLRRHIGLVQQEPILMSGTIRDNIVYGLTEMPTKDEIR 579
              + + G I+IDG  IN++    LR  + ++ Q+  +  GT+R+NI    T   + +EI 
Sbjct: 1324 IIEAAEGRIVIDGVPINEIGLHDLRHKLSIIPQDSQVFEGTVRENI--DPTNQYSDEEIW 1381

Query: 580  QVAKQCFCHNFITRF-QSSYDTVIGPHGTLLSGGQKQRIAIARALIKKPRILILDEATSA 638
            +V +     N +    +    T +   G  LS GQ+Q + +ARAL+   RILILDEAT+A
Sbjct: 1382 RVLELSHLKNHVLSMSKDGLMTRLTEGGANLSVGQRQLMCLARALLIPSRILILDEATAA 1441

Query: 639  LDVESEGAINYTFGQLMKKKEMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELWD 698
            +DVE++  I  T     K +  TI++IAHRL+TI  S+ ++VL       + G+ +E  D
Sbjct: 1442 VDVETDQVIQETIRTAFKDR--TILTIAHRLNTIMDSDRILVL-------DAGEVREF-D 1491

Query: 699  DPTSELSQ 706
             P + L Q
Sbjct: 1492 TPENLLKQ 1499

 Score = 80.9 bits (198), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 68/261 (26%), Positives = 120/261 (45%), Gaps = 39/261 (14%)

Query: 463 KPGNGEIEFKN-VSFAYPTRPSNMI-FKNLNFKIEAGSNVCIVGPSGRGKST-VALLLEK 519
           K G+  I+  +  +F +  +P   +  KN+N +++ G   C+VG  G GKS  V  LL  
Sbjct: 625 KAGDVAIKISDDANFLWKRKPQYQVALKNINLEVKKGELACVVGKVGSGKSALVQSLLGD 684

Query: 520 YYKPSSGEILIDGQNINDLNSKSLRRHIGLVQQEPILMSGTIRDNIVYGLTEMPTKDEIR 579
            Y+   G   + G                 V Q P +M+GT++DNI++G    P   ++ 
Sbjct: 685 LYR-VKGYAAVHGST-------------AYVSQVPWIMNGTVKDNILFGHKYDPVFYDL- 729

Query: 580 QVAKQCFCHNFITRFQSSYDTVIGPHGTLLSGGQKQRIAIARALIKKPRILILDEATSAL 639
              K C     +        T++G  G  LSGGQK R+++ARA   +    +LD+  +A+
Sbjct: 730 -TIKACALTIDLGILPDGDQTMVGEKGISLSGGQKARLSLARATYARADTYLLDDPLAAV 788

Query: 640 DVE-SEGAINYTFG---------QLMKKKEMTIVSIAHRLSTIRRSENVIVLGHDGSVVE 689
           D   ++  I +  G         +L+   ++T++SIA  +S +            G +++
Sbjct: 789 DEHVAQHLIEHVLGPRGLLKSKTKLLATNKITVLSIASSISLVE----------GGEIIQ 838

Query: 690 MGKFKELWDDPTSELSQLLNE 710
            G ++++  D  S LS L+ E
Sbjct: 839 HGSYEDISKDLDSPLSNLVKE 859

>Skud_8.9 Chr8 complement(16026..20789) [4764 bp, 1587 aa] {ON}
            YHL035C (REAL)
          Length = 1587

 Score =  127 bits (320), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 149/538 (27%), Positives = 246/538 (45%), Gaps = 118/538 (21%)

Query: 235  IHQDAEFFDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALI-CGSVGIGMMXXXXXXX 293
            +H +  FFD   VG +++R   D   V + +   +      LI C S+            
Sbjct: 1084 LHANIRFFDVTPVGRIMNRFAKDIEGVDQELIPYLEVTIFCLIQCLSI------------ 1131

Query: 294  XXXXXVFTP-------PVILSASVFGKQISTTSRELQE----ATGHLTKVAEEQLSGIKT 342
                 + TP        V++     GK   +  REL+         + +   E L+G+ T
Sbjct: 1132 IFLITIITPRFLVVAVVVLVLYYFVGKCYLSAGRELKRIDSITKSPIFQYFSETLAGVCT 1191

Query: 343  VQSFVAEQREINRYNFAIRDIFNIGKKAAVINAKFFSSTSAMGDLSF-------LTVLGF 395
            +++F  E+R      F + ++  I +     N  FF  + A+   +F         VLG 
Sbjct: 1192 IRAFGDEKR------FILENMDKIDQN----NRAFFYLSVAVKWFAFRVDIIGAFIVLGS 1241

Query: 396  GSYLVLQNSLTIGDLTAFMMYTEYTGNSIFGLSTFYSEIM-QGAGAASRL---FEL---- 447
            GS+++L     IGD+ +          S+ G+S  YS +   GA    RL   FE+    
Sbjct: 1242 GSFILLN----IGDIDS----------SLAGISLTYSILFTDGALWLVRLYSTFEMNMNS 1287

Query: 448  TDRVPSISTTKGVKYK------------PGNGEIEFKNVSFAYPTRPSNMIFKNLNFKIE 495
             +R+   S  +   Y             P +G+IE  N+S  Y +    +I KN++F ++
Sbjct: 1288 VERLKEYSGIEQENYNENHIQALQNSLWPEHGKIEVDNLSLRYASNLPPVI-KNVSFTVD 1346

Query: 496  AGSNVCIVGPSGRGKSTVALLLEKYYKPSSGEILIDGQNINDLNSKSLRRHIGLVQQEPI 555
              + + IVG +G GKST+   L +  KP +G I IDG +I+ ++  +LRR I ++ Q+PI
Sbjct: 1347 PQTKIGIVGRTGAGKSTIITALFRLLKPVTGCIKIDGYDISKIDLVTLRRAITIIPQDPI 1406

Query: 556  LMSGTIRDNIVYGLTEMPTKDEIRQVAKQCFCHNFIT------------RFQSSYD---- 599
            L +GTI+ N    L      DE R++ K     N I+             F   ++    
Sbjct: 1407 LFTGTIKSN----LDPYDEYDE-RRIFKVLSQVNLISSRELEETLNREENFSGVHNRFLN 1461

Query: 600  --TVIGPHGTLLSGGQKQRIAIARALIKKPRILILDEATSALDVESEGAINYTFGQLMKK 657
              T I   G  LS G+KQ + IAR+L+++P+I++LDEATS++D +S+  I     Q + +
Sbjct: 1462 LRTEIVEGGLNLSQGEKQLLFIARSLLREPKIILLDEATSSIDYDSDHLI-----QGIIR 1516

Query: 658  KEM---TIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELWDDPTSELSQLLNEKS 712
             E    TI++IAHRL ++   + V+V+       + G+ KE +D P   L    NE+S
Sbjct: 1517 NEFSRSTILTIAHRLRSVIDYDKVLVM-------DAGEVKE-YDHPYELLK---NERS 1563

 Score = 79.7 bits (195), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 72/246 (29%), Positives = 115/246 (46%), Gaps = 22/246 (8%)

Query: 464 PGNGEIEFKNVSFAYPTRPSNM-IFK----NLNFKIEAGSNVCIVGPSGRGKSTVALLLE 518
           P   +I+FK  +  +    +++  F+    N+NF+I  G    I+G +G GKS + + L 
Sbjct: 657 PDKNKIKFKKATLVWNENDNDINKFRLCDLNINFRI--GKLNLILGSTGSGKSALLMGLL 714

Query: 519 KYYKPSSGEILIDG-----QNINDLNSKSLRRHIGLVQQEPILMSGTIRDNIVYGLTEMP 573
                 SG I++ G       I DLN   L        Q   L++GT+R+NI++    + 
Sbjct: 715 GELYLLSGSIIVPGLEPRHDMIPDLNG--LTNSFAYCSQSAWLLNGTVRNNIIFN--GVY 770

Query: 574 TKDEIRQVAKQCFCHNFITRFQSSYDTVIGPHGTLLSGGQKQRIAIARALIKKPRILILD 633
            ++  + V   C     +    +   T IG  G  LSGGQKQRI++ARA+    + ++LD
Sbjct: 771 DENRYKNVIDACGLKRDLEILPAGDSTEIGEKGITLSGGQKQRISLARAIYSNAKHVLLD 830

Query: 634 EATSALDVESEGAINYTF---GQLMKKKEMTIVSIAHRLSTIRRSENVIVLGHDGSVVEM 690
           +  SA+D  +   I Y     G LMK +  T + + H +S   R     V+  +G V   
Sbjct: 831 DCLSAVDSHTAIWI-YEICITGLLMKNR--TCILVTHNISLAIRKAYFAVILENGKVKSQ 887

Query: 691 GKFKEL 696
           G   EL
Sbjct: 888 GTITEL 893

>TDEL0G01850 Chr7 (369839..374767) [4929 bp, 1642 aa] {ON} Anc_4.6
            YHL035C
          Length = 1642

 Score =  127 bits (320), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 136/517 (26%), Positives = 230/517 (44%), Gaps = 87/517 (16%)

Query: 230  VIKKTIHQDAEFFDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALI-CGSVGIGMMXX 288
            ++ K +H    FFD+  +G +++R   D     + +T  +   F +L+ C S  + +   
Sbjct: 1128 LLSKVMHAKLRFFDSTPIGRIMNRFSKDMEAADQELTPFIEGAFYSLVQCVSTVVLITFI 1187

Query: 289  XXXXXXXXXXVFTPPVILSASVF---GKQISTTSRELQE----ATGHLTKVAEEQLSGIK 341
                       F    IL A ++   G    T SREL+     +   + +   E L G+ 
Sbjct: 1188 TPQ--------FLFVAILVAVLYYFVGYFYLTGSRELKRLESISRSPIYQHFSETLVGVT 1239

Query: 342  TVQSFVAEQREINRYNFAIRDIFNIGKKAAVINAKFFSSTSAMGDLSF-------LTVLG 394
            T+++F  E R      F   ++  I +     N  FF    A   LSF       L + G
Sbjct: 1240 TIRAFGDESR------FMRENLQKIDEN----NRPFFYLWVANRWLSFRIDMIGALVIFG 1289

Query: 395  FGSYLVLQ-NSLTIGDLTAFMMYTEYTGNSIFGLSTFYSEIMQGAGAASRLFELTD--RV 451
             G +++L  + +  G     + Y          L   YS +     +  RL E  D  + 
Sbjct: 1290 AGIFVLLNIDHIDSGKAGISLTYAITFTEGALWLVRLYSNVEMNMNSVERLKEYMDVEQE 1349

Query: 452  PSIST--TKGVKYKPGNGEIEFKNVSFAY-PTRPSNMIFKNLNFKIEAGSNVCIVGPSGR 508
            P   +  T  V++ P  G IE  ++S  Y P  P   + KN++F ++  S V IVG +G 
Sbjct: 1350 PYDQSILTPPVEW-PQQGRIEVNDLSLRYAPNLPK--VIKNVSFTVDPRSKVGIVGRTGA 1406

Query: 509  GKSTVALLLEKYYKPSSGEILIDGQNINDLNSKSLRRHIGLVQQEPILMSGTIRDNIVYG 568
            GKST+   L ++  P +G I ID  +I  ++ + LRR I ++ Q+P L +GTI+ N+   
Sbjct: 1407 GKSTIITALFRFLDPETGNIKIDNVDITSIDLQRLRRSITIIPQDPTLFTGTIKSNL--D 1464

Query: 569  LTEMPTKDEIRQVAKQCFCHNFITRFQSSYD----------------------TVIGPHG 606
              +  T  +I +  K+    N +T  Q   D                      + I   G
Sbjct: 1465 PYDEYTDQQIFEALKRV---NLVT--QEELDRRPTSESSSVSSENINKFLDLSSEISEGG 1519

Query: 607  TLLSGGQKQRIAIARALIKKPRILILDEATSALDVESEGAINYTFGQLMKKKEM---TIV 663
              +S GQ+Q + +AR+L++ P+I++LDEAT+++D  S+  I  T      +KE    TI+
Sbjct: 1520 GNISQGQRQLVCLARSLLRSPKIILLDEATASIDYASDAKIQETI-----RKEFGGNTIL 1574

Query: 664  SIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELWDDP 700
            +IAHRL ++   + ++V+       + G+ KE  D P
Sbjct: 1575 TIAHRLRSVIDYDKILVM-------DAGEVKEF-DHP 1603

 Score = 88.2 bits (217), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 90/375 (24%), Positives = 168/375 (44%), Gaps = 35/375 (9%)

Query: 335 EQLSGIKTVQSFVAEQREINRYNFAIRDIFNIGKKAAVINAKFFSSTSAMGDLS--FLTV 392
           E    I+ ++ F  E    N +   IRD+     K  +  +  ++ +S +  ++   +T 
Sbjct: 564 EAFQAIRIIKFFSWE----NNFEKDIRDVRETELKFLMKRSLVWAGSSFVWYITPTIVTS 619

Query: 393 LGFGSYLVLQNSLTIGDLTAFMMYTEYTGNSIF-----GLSTFYSEIMQGAGAASRLFEL 447
             F  Y+ +Q  +    LT  + +T  +  S+       LS   S ++Q   +  R+ E 
Sbjct: 620 CAFWFYIYIQGEV----LTTPIAFTALSLFSLLRTPLDQLSDMLSFVIQSKVSLDRVQEF 675

Query: 448 -----TDRVPSISTTKGVKYKPGNGEIEFKNVSFAYPTRPSNMIFKNLNFKIEAGSNVCI 502
                T++   +ST K  K      +I F+N +  +     +   KNLN   + G    I
Sbjct: 676 LEEKDTEKYNQLSTAKDKK------KIGFENATITWDAERPDFKLKNLNIDFKVGKLNVI 729

Query: 503 VGPSGRGKSTVALLLEKYYKPSSGEILI---DGQNINDLNSKSLRRHIGLVQQEPILMSG 559
           +GP+G GK+++ + L       SG+I++   D +    + +  +   +    Q   L++ 
Sbjct: 730 IGPTGSGKTSLLMALLGEMHLVSGKIIVPSLDPRQELPIEADGMTNSMAYCSQAAWLLND 789

Query: 560 TIRDNIVYGLTEMPTKDEIRQVAKQCFCHNFITRFQSSYDTVIGPHGTLLSGGQKQRIAI 619
           T+++NI++       + E   V + C      +   +   T IG  G  LSGGQKQRI++
Sbjct: 790 TVKNNILFNSPYNEGRYE--AVVEACGLKRDFSILSAGDLTEIGERGITLSGGQKQRISL 847

Query: 620 ARALIKKPRILILDEATSALDVESEGAI--NYTFGQLMKKKEMTIVSIAHRLSTIRRSEN 677
           AR+L    R ++LD+  SA+D  +   I  N   G LM+ +  T + ++H  +   R+  
Sbjct: 848 ARSLYSNARHVLLDDCLSAVDSHTASWIYDNCITGPLMEGR--TCILVSHNTALTLRNAE 905

Query: 678 VIVLGHDGSVVEMGK 692
           ++V   +G V   G+
Sbjct: 906 LVVTMENGQVKNQGE 920

>Ecym_8418 Chr8 (874901..879937) [5037 bp, 1678 aa] {ON} similar to
            Ashbya gossypii ACL072C
          Length = 1678

 Score =  127 bits (319), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 125/487 (25%), Positives = 212/487 (43%), Gaps = 57/487 (11%)

Query: 230  VIKKTIHQDAEFFDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGSVGIGMMXXX 289
            ++KK ++    FFD+   G +++R   D   +   +       F +L+     I ++   
Sbjct: 1163 LLKKVLYAKLRFFDSTPTGRIMNRFSRDVEAIDEELIPFFEGAFASLVQCITTILLIGYI 1222

Query: 290  XXXXXXXXXVFTPPVILSASVFGKQISTTSRELQE----ATGHLTKVAEEQLSGIKTVQS 345
                      F   + +S  + G      SRELQ         + +   E L G+ T+++
Sbjct: 1223 TPVFL----FFAIVICVSYYIVGYFYLVGSRELQRFESITKSPIHQHFSETLVGVTTIRA 1278

Query: 346  FVAEQREINRYNFAIRDIFNIGKKAAVINAKFFSSTSAMGDLSF-------LTVLGFGSY 398
            F  E+R      F   ++     K    N  FF        L+F         +L  G +
Sbjct: 1279 FGDERR------FLADNL----SKVDTHNRPFFYLWVTNRWLAFRIDFIGAFVILASGIF 1328

Query: 399  LVLQ-NSLTIGDLTAFMMYTEYTGNSIFGLSTFYSEIMQGAGAASRLFELT--DRVPSIS 455
            ++L  NSL  G     ++Y          L   YS +     +  RL E    ++ PS  
Sbjct: 1329 ILLNVNSLDAGLAGISLIYAISFTEGALWLVRLYSNVEMTMNSVERLKEYMKIEQEPSTG 1388

Query: 456  TTKGVKYKPGNGEIEFKNVSFAYPTRPSNMIFKNLNFKIEAGSNVCIVGPSGRGKSTVAL 515
              +     P  G+IE  N+S  Y +    +I KN+ F +E  S V IVG +G GKST+  
Sbjct: 1389 LYEPPPEWPDRGKIEVNNLSLRYASNLPKVI-KNVTFTVEPQSKVGIVGRTGAGKSTIIT 1447

Query: 516  LLEKYYKPSSGEILIDGQNINDLNSKSLRRHIGLVQQEPILMSGTIRDNIVYGLTEMPTK 575
             L ++  P +G I +D  +I  +  K LR+ I ++ Q+P+L +GTI+ N+          
Sbjct: 1448 ALFRFLDPDTGTIKLDNVDITSIRLKRLRQSITIIPQDPVLFAGTIKSNL--DPYSEYAD 1505

Query: 576  DEIRQVAKQCFCHNFITRFQ------------SSYDTV---------IGPHGTLLSGGQK 614
            D I +  K+    N I + +             S++ V         I   G+ LS GQ+
Sbjct: 1506 DRIFEALKRV---NLIVQEELTPTDIPSSSSSLSFENVNKFLDLTSEITEGGSNLSQGQR 1562

Query: 615  QRIAIARALIKKPRILILDEATSALDVESEGAINYTFGQLMKKKEMTIVSIAHRLSTIRR 674
            Q + +AR+L++ P+ ++LDEAT+++D  S+  I  T  +       TI++IAHRL +I  
Sbjct: 1563 QLVCLARSLLRNPKAILLDEATASIDYASDAKIQQTIREEFSGS--TILTIAHRLRSIID 1620

Query: 675  SENVIVL 681
             + V+V+
Sbjct: 1621 YDKVLVI 1627

 Score = 81.6 bits (200), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 62/235 (26%), Positives = 115/235 (48%), Gaps = 12/235 (5%)

Query: 471 FKNVSFAYP-TRPSNMIFKNLNFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPSSGEIL 529
           F N +  +     ++   KNLN   + G    IVGP+G GK+++ + L      S G+I 
Sbjct: 713 FSNATIGWDHDSATDFKLKNLNIDFKIGKLNVIVGPTGSGKTSLLMGLLGEINLSEGKIY 772

Query: 530 IDGQNIND---LNSKSLRRHIGLVQQEPILMSGTIRDNIVYGLTEMPTK-DEIRQVAKQC 585
           +   N  +   +++  +   IG   Q   L++ T+R+NI++     P + +    V   C
Sbjct: 773 VPALNPREDLVVDADGMTDSIGYCSQSAWLLNDTLRNNILFS---APYEANRYNAVIHAC 829

Query: 586 FCHNFITRFQSSYDTVIGPHGTLLSGGQKQRIAIARALIKKPRILILDEATSALDVESEG 645
                +    +   T +G  G  LSGGQKQR+++ARA+  + R ++LD+  SA+D  +  
Sbjct: 830 GLTRDLEILNAGDQTEVGEKGITLSGGQKQRVSLARAMYSRARHILLDDCLSAVDSHTAQ 889

Query: 646 AI--NYTFGQLMKKKEMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELWD 698
            I  +   G LM+ +  T V ++H  +   ++ + +V+  +  V   G+  EL++
Sbjct: 890 WIYKHCITGPLMEGR--TCVLVSHNTALTLKNADWVVILENAKVTAQGEPLELFN 942

>Kpol_311.3 s311 (5480..10453) [4974 bp, 1657 aa] {ON} (5480..10453)
            [4974 nt, 1658 aa]
          Length = 1657

 Score =  126 bits (316), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 138/526 (26%), Positives = 237/526 (45%), Gaps = 75/526 (14%)

Query: 225  RLRATVIKKTIHQDAEFFDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGSVGIG 284
            ++ + ++ K +H +  FFD+  +G +++R   D   V + +   +      +I  S  I 
Sbjct: 1139 KIFSLLLNKALHANLRFFDSTPIGRIMNRFSKDMEAVDQELVPYLEAALYCIIDISSTIL 1198

Query: 285  MMXXXXXXXXXXXXVFTPPVILSASVF---GKQISTTSRELQE----ATGHLTKVAEEQL 337
            ++             F    IL A ++   G      SREL+         + +   E L
Sbjct: 1199 LITYITPE-------FLIIAILVAGLYYAIGVLYLAGSRELKRFDSITKSPIYQHFSETL 1251

Query: 338  SGIKTVQSFVAEQREINRYNFAIRDIFNIGKKAAVINAKFFSSTSAMGDLSF-------L 390
             G+ TV+++  E R + R N  + D           N  FF    +   L+F       L
Sbjct: 1252 VGVTTVRAYGDEARFM-RENLKMID---------ENNKPFFYLWVSNRWLAFRIDVVGAL 1301

Query: 391  TVLGFGSYLVLQ-----NSLTIGDLTAFMMYTEYTGNSIFGLSTFYSEIMQGAGAASRLF 445
             + G G +++L      + L    L+  + +TE    S   L   YS +     +  RL 
Sbjct: 1302 VIFGSGVFVLLNIDKIDSGLAGISLSFAISFTE----SALWLVRHYSNLEMNMNSVERLM 1357

Query: 446  EL--TDRVPSISTTKGVKYK-PGNGEIEFKNVSFAY-PTRPSNMIFKNLNFKIEAGSNVC 501
            E    ++ P  S++  V    P  G+IE  +VS  Y P  P   + KN  F ++    V 
Sbjct: 1358 EYMEVEQEPYKSSSLDVPSSWPEEGKIEVNDVSLRYAPNLPR--VIKNATFTVDPKMKVG 1415

Query: 502  IVGPSGRGKSTVALLLEKYYKPSSGEILIDGQNINDLNSKSLRRHIGLVQQEPILMSGTI 561
            IVG +G GKST+   L ++  P +G I ID  +I+ +  K LRR I ++ Q+P L SGTI
Sbjct: 1416 IVGRTGAGKSTIITALFRFLDPETGSIKIDNVDISTIELKKLRRSITIIPQDPTLFSGTI 1475

Query: 562  RDNI--VYGLTEMPTKDEIRQV-------------AKQCFCHNFITRFQSSYDTVIGPHG 606
            + N+      +E    + +++V              +Q        +F +  +  I   G
Sbjct: 1476 KSNLDPYDEYSEKQIFEALKRVNLVTEKELASGNSDQQSIASGNANKFLNV-NNEISEGG 1534

Query: 607  TLLSGGQKQRIAIARALIKKPRILILDEATSALDVESEGAINYTFGQLMKKKEMTIVSIA 666
            + LS GQ+Q + +AR+L++ P++++LDEAT+++D  S+  I  T     +  + TI++IA
Sbjct: 1535 SNLSQGQRQLVCLARSLLRCPKVILLDEATASIDYASDAKIQETIRN--EFDDSTILTIA 1592

Query: 667  HRLSTIRRSENVIVLGHDGSVVEMGKFKELWDDPTSELSQLLNEKS 712
            HRL T+   + ++V+       + G+ KE  D P    S LLN+ S
Sbjct: 1593 HRLRTVIDYDKILVM-------DAGEVKEF-DHP---YSLLLNKNS 1627

 Score = 87.0 bits (214), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 64/232 (27%), Positives = 113/232 (48%), Gaps = 11/232 (4%)

Query: 467 GEIEFKNVSFAYPTRPSNMIFKNLNFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPSSG 526
            +I FKN +  +     +   +N++   + G    I+GP+G GK+++ + L        G
Sbjct: 701 NKIAFKNATTTWNKEKQDFKLRNIDIDFKIGKLNVIIGPTGSGKTSLLMALLGEMDLIDG 760

Query: 527 EILI---DGQNINDLNSKSLRRHIGLVQQEPILMSGTIRDNIVYGLTEMPTKDE-IRQVA 582
           EI++   D +    L++  L   I    Q   L++ T+R+NI++     P  +E    V 
Sbjct: 761 EIIVPCLDPREDLKLDANGLTNSIAYCSQAAWLLNDTVRNNILFN---SPYCEERYNAVV 817

Query: 583 KQCFCHNFITRFQSSYDTVIGPHGTLLSGGQKQRIAIARALIKKPRILILDEATSALDVE 642
           +            +   T IG  G  LSGGQKQR+++ARAL    + L+LD+  SA+D  
Sbjct: 818 EASGLKRDFEILNAGDMTEIGERGITLSGGQKQRVSLARALYSNSKHLLLDDCLSAVDSH 877

Query: 643 SEGAI--NYTFGQLMKKKEMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGK 692
           +   I  N   G LM+ +  T + ++H ++   R+ + +V   +G +VE G+
Sbjct: 878 TATWIYDNCISGPLMENR--TCILVSHNIALTLRNADYVVKLENGKIVEHGE 927

>Kwal_34.15770 s34 complement(51755..56065) [4311 bp, 1436 aa] {ON}
            YLL048C (YBT1) - bile acid transporter of ABC family
            [contig 274] PARTIAL
          Length = 1436

 Score =  126 bits (316), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 139/531 (26%), Positives = 236/531 (44%), Gaps = 92/531 (17%)

Query: 230  VIKKTIHQDAEFFDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALI-CGSVGIGMMXX 288
            ++KK ++    FFD+  +G +++R   D   V + +T  V   F +L+ C S  I +   
Sbjct: 920  ILKKVLYAKLRFFDSTPIGRIMNRFSKDIEAVDQELTPFVEGAFVSLVQCLSTVILI--- 976

Query: 289  XXXXXXXXXXVFTPPVILSASVF--------GKQISTTSRELQE----ATGHLTKVAEEQ 336
                       +  P     ++F        G      SREL+     +   + +   E 
Sbjct: 977  ----------AYITPGFFVVAIFIAILYYLVGYFYMAGSRELKRFESISRSPIHQHFSET 1026

Query: 337  LSGIKTVQSFVAEQREINRYNFAIRDIFNIGKKAAVINAKFFSSTSAMGDLSF------- 389
            L GI T+++F  E+R      F   ++  I +     N  FF    A   L+F       
Sbjct: 1027 LVGITTIRAFGDERR------FMQENLEKIDEN----NKPFFYLWVANRWLAFRIDMIGA 1076

Query: 390  LTVLGFGSYLVLQ-NSLTIG----DLTAFMMYTEYTGNSIFGLSTFYSEIMQGAGAASRL 444
              +   G +++L   SL  G     LT  + +TE        L   YS +     +  RL
Sbjct: 1077 CVIFAAGIFVLLNIKSLDSGLAGISLTYAISFTE----GALWLVRLYSNVEMTMNSVERL 1132

Query: 445  FEL--TDRVPSISTTKGVKYK-PGNGEIEFKNVSFAY-PTRPSNMIFKNLNFKIEAGSNV 500
             E    ++ P   +T     + P  G+IE  ++S  Y P+ P   + KN++F ++    V
Sbjct: 1133 KEYMEVEQEPHYQSTHTPPPEWPSQGKIEVNDLSLRYAPSLPK--VIKNVSFTVDPNCKV 1190

Query: 501  CIVGPSGRGKSTVALLLEKYYKPSSGEILIDGQNINDLNSKSLRRHIGLVQQEPILMSGT 560
             IVG +G GKST+   L ++  P SG I ID  +I  +  K LR+ I ++ Q+P L +GT
Sbjct: 1191 GIVGRTGAGKSTIITALFRFLDPESGYIKIDNVDITSVELKRLRQSITIIPQDPTLFTGT 1250

Query: 561  IRDNI-------------VYGLTEMPTKDEIRQVAKQCFCHNFI-----TRFQSSYDTVI 602
            ++ N+                   + T++E+         ++ I      +F    D  I
Sbjct: 1251 VKSNLDPYDEYSDGQIFEALKRVNLLTEEELNSAGSPAPGNSSIHSENVNKFL-RLDNEI 1309

Query: 603  GPHGTLLSGGQKQRIAIARALIKKPRILILDEATSALDVESEGAINYTF-GQLMKKKEMT 661
               G  LS GQ+Q + +AR+L++ P++++LDEAT+++D  S+  I  T  G+       T
Sbjct: 1310 TEGGANLSQGQRQLVCLARSLLRSPKVMLLDEATASIDYTSDARIQQTIRGEFSNS---T 1366

Query: 662  IVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELWDDPTSELSQLLNEKS 712
            I++IAHRL +I   + ++V+       + G+ KE +D P    S LLN+ S
Sbjct: 1367 ILTIAHRLRSIIDYDKILVM-------DAGEVKE-YDHP---YSLLLNKNS 1406

 Score = 85.9 bits (211), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 84/325 (25%), Positives = 150/325 (46%), Gaps = 33/325 (10%)

Query: 388 SFLTVLGFGSYLVLQNSL--TIGDLTAFMMYTEYTGNSIFGLSTFYSEIMQGAGAASRL- 444
           S +T + F +Y+ +Q  +  T    TA  ++T    N +  LS   S ++Q   +  R+ 
Sbjct: 396 SIVTTVSFATYIYIQGEVLTTPVAFTALSLFT-LLRNPLDMLSDMLSYVIQSKVSLDRVQ 454

Query: 445 -FELTDRVPSISTTKGVKYKPGNGEIEFKNVSFAYPTRPSNMIFKNLNFKIEAGSNVCIV 503
            F   D      T K  +       I F+N +F++  +  +   KN++ +   G    ++
Sbjct: 455 VFLEEDE-----TEKYDQITVSRKRIGFENATFSWDRKNPDFKLKNMSIEFRLGKLNVVI 509

Query: 504 GPSGRGKSTVAL-------LLE-KYYKPSSGEILIDGQNINDLNSKSLRRHIGLVQQEPI 555
           GP+G GK+++ +       LLE K Y P      +D +    + +  +   I    Q   
Sbjct: 510 GPTGSGKTSLLMGLLGEMDLLEGKVYAPC-----LDPREDLIVENDGMTNSIAYCSQGAW 564

Query: 556 LMSGTIRDNIVYGLTEMPTKDEIR--QVAKQCFCHNFITRFQSSYDTVIGPHGTLLSGGQ 613
           L++ T+++NI++        +E R   V + C          +   T IG  G  LSGGQ
Sbjct: 565 LLNDTVKNNILFS----SPFNEARYDAVVEACGLKRDFEILSAGDQTEIGEKGITLSGGQ 620

Query: 614 KQRIAIARALIKKPRILILDEATSALDVESEGAI--NYTFGQLMKKKEMTIVSIAHRLST 671
           KQR+++ARAL    R L+LD+  SA+D  +   I  N   G LM+ +  T + ++H ++ 
Sbjct: 621 KQRVSLARALYSSSRHLLLDDCLSAVDSHTALWIYENCITGPLMEGR--TCILVSHNVAL 678

Query: 672 IRRSENVIVLGHDGSVVEMGKFKEL 696
             ++ + +V   +G V + G+  EL
Sbjct: 679 TLKNADWVVFMENGKVKDQGEPLEL 703

>KLLA0E00529g Chr5 complement(39173..44125) [4953 bp, 1650 aa] {ON}
            similar to uniprot|P32386 Saccharomyces cerevisiae
            YLL048C
          Length = 1650

 Score =  126 bits (316), Expect = 9e-29,   Method: Compositional matrix adjust.
 Identities = 139/532 (26%), Positives = 243/532 (45%), Gaps = 74/532 (13%)

Query: 222  LVARLRAT------VIKKTIHQDAEFFDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKA 275
             VA +RA+      ++K  ++    FFD+  +G +++R   D   + + +T  +   F +
Sbjct: 1122 FVAGIRASRKIFNLLLKNVLYAKLRFFDSTPIGRIMNRFSKDIESIDQELTPYMEGAFGS 1181

Query: 276  LI-CGSVGIGMMXXXXXXXXXXXXV-----FTPPVILSASVFGKQISTTSRELQEATGHL 329
            LI C S  I +             V     F     +S +   K++ + SR       H 
Sbjct: 1182 LIQCVSTIIVIAYITPQFLIVAAIVMLLFYFVAYFYMSGARELKRLESMSR--SPIHQHF 1239

Query: 330  TKVAEEQLSGIKTVQSFVAEQREINRYNFAIRDIFNIGKKAAVINAKFFSSTSAMGDLSF 389
            +    E L GI T+++F  E+R      F + ++    KK    N  FF        LS+
Sbjct: 1240 S----ETLVGITTIRAFSDERR------FLVDNM----KKIDDNNRPFFYLWVCNRWLSY 1285

Query: 390  -------LTVLGFGSYLVLQ----NSLTIGDLTAFMMYTEYTGNSIFGLSTFYSEIMQGA 438
                   L VL  GS+++L     +S   G    F +  ++T  +++ +   YS +    
Sbjct: 1286 RIELIGALIVLAAGSFILLNIKSIDSGLAGISLGFAI--QFTDGALW-VVRLYSNVEMNM 1342

Query: 439  GAASRLFELT--DRVPS-ISTTKGVKYKPGNGEIEFKNVSFAYPTRPSNMIFKNLNFKIE 495
             +  RL E T  ++ PS +         P NG+IE K++S  Y      +I KN+ F ++
Sbjct: 1343 NSVERLKEYTTIEQEPSNVGALVPPCEWPQNGKIEVKDLSLRYAAGLPKVI-KNVTFTVD 1401

Query: 496  AGSNVCIVGPSGRGKSTVALLLEKYYKPSSGEILIDGQNINDLNSKSLRRHIGLVQQEPI 555
            +   V IVG +G GKST+   L ++  P +G I ID  +I  +  K LR+ I ++ Q+P 
Sbjct: 1402 SKCKVGIVGRTGAGKSTIITALFRFLDPETGYIKIDDVDITTIGLKRLRQSITIIPQDPT 1461

Query: 556  LMSGTIRDNI--VYGLTEMPTKDEIRQV-------------AKQCFCHNFITRFQSSYDT 600
            L +GT++ N+      +E    + +++V             +     H+         + 
Sbjct: 1462 LFTGTLKTNLDPYNEYSEAEIFEALKRVNLVSSEELGNPSTSDSTSVHSANMNKFLDLEN 1521

Query: 601  VIGPHGTLLSGGQKQRIAIARALIKKPRILILDEATSALDVESEGAINYTFGQLMKKKEM 660
             +   G+ LS GQ+Q I +AR+L++ P++++LDEAT+++D  S+  I  T  +       
Sbjct: 1522 EVSEGGSNLSQGQRQLICLARSLLRCPKVILLDEATASIDYNSDSKIQATIREEFSNS-- 1579

Query: 661  TIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELWDDPTSELSQLLNEKS 712
            TI++IAHRL +I   + ++V+       + G+ KE +D P    S LLN  S
Sbjct: 1580 TILTIAHRLRSIIDYDKILVM-------DAGEVKE-YDHP---YSLLLNRDS 1620

 Score = 90.5 bits (223), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 112/487 (22%), Positives = 206/487 (42%), Gaps = 48/487 (9%)

Query: 232 KKTIHQDAEFFDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGSVGIGMMX---- 287
           K+ +  D E   T  +G +I+ +  DA+ VS  +   +    +A+I   V + ++     
Sbjct: 467 KQHVDGDEESATTANLGAIINLMAVDAFKVSE-ICAYLHSFIEAIIMTIVALFLLYRLIG 525

Query: 288 XXXXXXXXXXXVFTPPVILSASVFG----KQISTTSRELQEATGHLTKVAEEQLSGIKTV 343
                       F P     AS+ G    K ++ T + +Q+          E    I+ +
Sbjct: 526 WSALVGSAMIICFLPLNFKLASLLGTLQKKSLAITDKRIQKLN--------EAFQAIRII 577

Query: 344 QSFVAEQREINRYNFAIRDI-------FNIGKKAAVINAKFFSSTSAMGDLSFLTVLGFG 396
           + F  E+      NF  +DI        N+  K +++ A   SS       S +T   F 
Sbjct: 578 KFFSWEE------NFE-KDIQNTRDEELNMLLKRSIVWA--LSSLVWFITPSIVTSASFA 628

Query: 397 SYLVLQNSLTIGDLTAFMMYTEYT--GNSIFGLSTFYSEIMQGAGAASRLFELTDRVPSI 454
            Y+ +Q   T+    AF   + +    N +  LS   S ++Q   +  R+ E  +     
Sbjct: 629 VYIYVQGQ-TLTTPVAFTALSLFALLRNPLDMLSDMLSFVIQSKVSLDRVQEFLNEE--- 684

Query: 455 STTKGVKYKPGNGEIEFKNVSFAYPTRPSNMIFKNLNFKIEAGSNVCIVGPSGRGKSTVA 514
            T K  +      ++  +N +F +     +   KNL    + G    IVGP+G GK+++ 
Sbjct: 685 ETKKYEQLTVSRNKLGLQNATFTWDKNNQDFKLKNLTIDFKIGKLNVIVGPTGSGKTSLL 744

Query: 515 LLLEKYYKPSSGEILIDGQNIND---LNSKSLRRHIGLVQQEPILMSGTIRDNIVYGLTE 571
           + L    +  +G++ +   N  +   + +  +   I    Q   L++ T+R+NI++    
Sbjct: 745 MGLLGEMELLNGKVFVPSLNPREELVVEADGMTNSIAYCSQAAWLLNDTVRNNILFNAPY 804

Query: 572 MPTKDEIRQVAKQCFCHNFITRFQSSYDTVIGPHGTLLSGGQKQRIAIARALIKKPRILI 631
              ++    V   C          +   T IG  G  LSGGQKQR+++AR+L    R L+
Sbjct: 805 --NENRYNAVISACGLKRDFEILSAGDQTEIGEKGITLSGGQKQRVSLARSLYSSSRHLL 862

Query: 632 LDEATSALDVESEGAI--NYTFGQLMKKKEMTIVSIAHRLSTIRRSENVIVLGHDGSVVE 689
           LD+  SA+D  +   I  N   G LM+ +  T V ++H ++   ++ + +++  +G V E
Sbjct: 863 LDDCLSAVDSHTALWIYENCITGPLMEGR--TCVLVSHNVALTLKNADWVIIMENGRVKE 920

Query: 690 MGKFKEL 696
            G+  EL
Sbjct: 921 QGEPVEL 927

>YKR104W Chr11 (656836..657756) [921 bp, 306 aa] {ON} Putative
           transporter of the multidrug resistance-associated
           protein (MRP) subfamily; contains a stop codon in S288C;
           adjacent ORFs YKR103W and YKR104W are merged in
           different strain backgrounds
          Length = 306

 Score =  118 bits (296), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 90/288 (31%), Positives = 151/288 (52%), Gaps = 37/288 (12%)

Query: 440 AASRLFELTDRVPSISTTKGVKYKPGN----GEIEFKNVSFAYPTRPSNMIFKNLNFKIE 495
           +  R+ E TD +PS S   G    P N    G++E KN+S  Y    S  +  N++FK++
Sbjct: 3   SVERIKEYTD-IPSESN--GYISPPANWPQTGDVELKNLSLRYSPHSSKAL-DNVSFKVK 58

Query: 496 AGSNVCIVGPSGRGKSTVALLLEKYYKPSSGEILIDGQNINDLNSKSLRRHIGLVQQEPI 555
           AG+ V IVG +G GKS++   + +     +G I ID ++I  +  + LR  I  + Q+P 
Sbjct: 59  AGTKVGIVGRTGAGKSSIIAAIYRLSDWENGTITIDNKDIKHIPLERLRNSISCIPQDPT 118

Query: 556 LMSGTIRDNI----------VYGLTE----MPTKDEIRQVAKQ----CFCHNFITRFQSS 597
           L  GT+R N+          +YG+      +   DE+  + +Q       H    RF   
Sbjct: 119 LFDGTVRSNLDPFDRYSDVQIYGVLSKVGLIEECDELCLIFEQEQPNFSSHKLRNRF-ID 177

Query: 598 YDTVIGPHGTLLSGGQKQRIAIARALIKKPRILILDEATSALDVESEGAINYTFGQLMKK 657
            +TV+   G+ LS GQ+Q + +AR+++    I+++DEAT+++D  S+  I  T  + MK 
Sbjct: 178 LNTVVKSGGSNLSQGQRQLLCLARSMLGARNIMLIDEATASIDYISDAKIQKTIRETMKN 237

Query: 658 KEMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELWDDPTSELS 705
              TI++IAHRL ++   + ++V+       EMG+ KE +D P + +S
Sbjct: 238 --TTILTIAHRLRSVIDYDKILVM-------EMGRVKE-YDHPYTLIS 275

>ZYRO0D06160g Chr4 (524435..529012) [4578 bp, 1525 aa] {ON} highly
            similar to uniprot|P39109 Saccharomyces cerevisiae
            YDR135C
          Length = 1525

 Score =  125 bits (314), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 128/492 (26%), Positives = 231/492 (46%), Gaps = 35/492 (7%)

Query: 226  LRATVIKKTIHQDAEFFDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGSVGIGM 285
            L A +          FF+T  +G +++R  +D + V   + +     F   +   + +  
Sbjct: 1032 LHAGMANSVFRAPMRFFETTPIGRILNRFSNDIFKVDELLGRT----FSQFVNNVIKVSF 1087

Query: 286  MXXXXXXXXXXXXVFTPPVILSASVFGKQISTTSRELQ--EATGHLTKVA--EEQLSGIK 341
                         +F  P+ +    + +    TSREL+  ++T      A  +E L G+ 
Sbjct: 1088 TIIVICFTTWQFTLFVIPLGILYVYYQQYYLRTSRELRRLDSTTRSPIYAHFQESLGGLS 1147

Query: 342  TVQSFVAEQREINRYNFAIRDIFNIGKKAAVINAKFFSSTSAMGDLSFL-TVLGFG---- 396
            T++ +  ++R I+     + +  N+      +NA  + +      L F+ T++ FG    
Sbjct: 1148 TIRGYNQQRRFIHINQSRMDN--NMSAYYPSVNANRWLAYR----LEFIGTIIIFGASSL 1201

Query: 397  SYLVLQN-SLTIGDLTAFMMYTEYTGNSIFGLSTFYSEIMQGAGAASRLFELTDRVPS-- 453
            S L L++ SLT G +   + Y      S+  +     E+     +  R+ E ++ +PS  
Sbjct: 1202 SILRLKSGSLTPGMIGLSLSYALQITQSLNWIVRMTVEVETNIVSVERIKEYSE-IPSEA 1260

Query: 454  ---ISTTKGVKYKPGNGEIEFKNVSFAYPTRPS-NMIFKNLNFKIEAGSNVCIVGPSGRG 509
               I   +     P +G I+F++ S  Y  RP  ++I K++N  I+    + IVG +G G
Sbjct: 1261 PYLIEDRRPSPNWPTDGAIQFQHYSTRY--RPGLDLILKDINLDIKPKEKIGIVGRTGAG 1318

Query: 510  KSTVALLLEKYYKPSSGEILIDGQNINDLNSKSLRRHIGLVQQEPILMSGTIRDNIVYGL 569
            KS++ L L +  + + G I+IDG  I+ +    LR  + ++ Q+  +  G++R+NI    
Sbjct: 1319 KSSLTLALFRLIEAAEGRIVIDGVPIDQMGLYDLRHKLSIIPQDSQVFEGSVRENI--DP 1376

Query: 570  TEMPTKDEIRQVAKQCFCHNFITRF-QSSYDTVIGPHGTLLSGGQKQRIAIARALIKKPR 628
            TE  + +EI +V       N +         T +   G  LS GQ+Q + +ARAL+   +
Sbjct: 1377 TEQYSDEEIWRVLDLSHLKNHVLNMGNDGLLTQLSEGGGNLSVGQRQLMCLARALLVPTK 1436

Query: 629  ILILDEATSALDVESEGAINYTFGQLMKKKEMTIVSIAHRLSTIRRSENVIVLGHDGSVV 688
            IL+LDEAT+A+DVE++  +  T       +  TI++IAHRL+TI  S+ ++VL   G V 
Sbjct: 1437 ILVLDEATAAVDVETDKVLQETIRTAFADR--TILTIAHRLNTIMDSDRILVLDA-GRVA 1493

Query: 689  EMGKFKELWDDP 700
            E    + L  +P
Sbjct: 1494 EFDTPENLLKNP 1505

 Score = 95.9 bits (237), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 124/530 (23%), Positives = 227/530 (42%), Gaps = 93/530 (17%)

Query: 222 LVARLRATVIKKTIHQDAEFFDTHKVGDLISRLGSDAYVVSRSMTQKV----SDGFKALI 277
           L + L + + KK++   +E  D    GD+++ +  D   + + + Q      S  F+ ++
Sbjct: 381 LKSALTSVIYKKSLVLSSEAADMSSTGDIVNLMSVDVQRL-QDLAQWCHLIWSGPFQIIL 439

Query: 278 CGSVGIGMMXXXXXXXXXXXXVFTPPVILSASVFGKQISTTSRELQEATGHLTKVAEEQL 337
           C +    ++            V  P   L++S+   Q +    +++      T++  E L
Sbjct: 440 CLTSLYKLLGKSMWVGVIILIVMMP---LNSSLMRVQKNLQKGQMKNKDQR-TRLINEIL 495

Query: 338 SGIKTVQSFV-----AEQREINRYNFAIRDIFNIGKKAAVINAKF-----FSSTSAMG-- 385
           + +K+++ +       E+ E  R    ++++  IG   A+IN +F     F S S     
Sbjct: 496 NNMKSLKLYAWEKPYKEKLEYVRNEKELKNLTKIGVYNAIINFQFNIVPFFVSCSTFAVF 555

Query: 386 ----------DLSF--LTVLGFGSY------LVLQN----SLTIGDLTAFMMYTEYTGNS 423
                     DL F  LT+ G  S+      LVL +    S++IG L +F+   E   +S
Sbjct: 556 VYTEDRPLTTDLVFPALTLFGLLSFPLAVVPLVLNSYIEASVSIGRLYSFLTNEELQRDS 615

Query: 424 IFGLSTFYSEIMQGAGAASRLFELTDRVPSISTTKGVKYKPGNGEIEFKNVSFAYPTRPS 483
           +                         R+P +     V  K G+      N +F +  +P 
Sbjct: 616 V------------------------QRLPRVKNIGDVAMKLGD------NATFLWKRKPE 645

Query: 484 NMI-FKNLNFKIEAGSNVCIVGPSGRGKST-VALLLEKYYKPSSGEILIDGQNINDLNSK 541
             +  KN+NF+ + G   C+VG  G GKS  +  LL   ++   G   + G         
Sbjct: 646 YKVALKNVNFQAKKGELNCVVGRVGSGKSALIQSLLGDLFR-VKGFATVHG--------- 695

Query: 542 SLRRHIGLVQQEPILMSGTIRDNIVYGLTEMPTKDEIRQVAKQCFCHNFITRFQSSYDTV 601
               +I  V Q   +M+GT++DNI++G    P   E  +  K C     +        T+
Sbjct: 696 ----NIAYVSQVAWIMNGTVKDNILFGHKYDPEFYE--KTIKACALTIDLAILPDGDKTI 749

Query: 602 IGPHGTLLSGGQKQRIAIARALIKKPRILILDEATSALDVE-SEGAINYTFGQLMKKKEM 660
           +G  G  LSGGQK R+++ARA+  +  I +LD+  +A+D   S   I++  G     K  
Sbjct: 750 VGEKGISLSGGQKARLSLARAVYSRADIFLLDDPLAAVDEHVSTHLIDHVLGPNGLLKTK 809

Query: 661 TIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELWDDPTSELSQLLNE 710
           T +   +++S +  +++V +L  +G +++ G F E+     S LS+L+ E
Sbjct: 810 TKILATNKISALSIADSVTLL-ENGEIIQQGTFCEITKAADSPLSKLIKE 858

>ZYRO0G07612g Chr7 complement(601181..606268) [5088 bp, 1695 aa] {ON}
            similar to uniprot|P32386 Saccharomyces cerevisiae
            YLL048C
          Length = 1695

 Score =  125 bits (313), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 137/531 (25%), Positives = 241/531 (45%), Gaps = 95/531 (17%)

Query: 230  VIKKTIHQDAEFFDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALI-CGSVGIGMMXX 288
            +++K +H    FFD+  +G +++R   D   V + +T      F +L+ C S  + +   
Sbjct: 1182 LLQKVLHAKLRFFDSTPIGRIMNRFSKDIEAVDQELTPFFEGAFYSLVTCLSTVVLI--- 1238

Query: 289  XXXXXXXXXXVFTPPVILSASV-------FGKQISTTSRELQE----ATGHLTKVAEEQL 337
                        TP  ++ A +        G      SREL+     +   + +   E L
Sbjct: 1239 ---------TFITPQFLIVAVIVAVLYYFIGYFYLAGSRELKRLDSISRSPIYQHFSETL 1289

Query: 338  SGIKTVQSFVAEQREINRYNFAIRDIFNIGKKAAVINAKFFSSTSAMGDLSF-------L 390
             G+ T+++F  E R      F   ++  I +     N  FF    A   L+        L
Sbjct: 1290 VGVTTIRAFGDESR------FIQENLHKIDEN----NRPFFYLWVANRWLAMRIDLIGSL 1339

Query: 391  TVLGFGSYLVLQ-NSLTIG----DLTAFMMYTEYTGNSIFGLSTFYSEIMQGAGAASRLF 445
             V G G +++L  + +  G     LT  + +TE        L   YS +     +  RL 
Sbjct: 1340 VVFGAGVFILLNIDHIDAGMAGISLTYAITFTE----GALWLVRLYSNVEMNMNSVERLK 1395

Query: 446  E--LTDRVP---SISTTKGVKYKPGNGEIEFKNVSFAY-PTRPSNMIFKNLNFKIEAGSN 499
            E  + ++ P    I T       P +G +E  +VS  Y P  P   + KN++F +E  S 
Sbjct: 1396 EYMVVEQEPYNQPIMTPPSDW--PQHGRVEMSDVSLRYAPGLPR--VIKNVSFTVEPKSK 1451

Query: 500  VCIVGPSGRGKSTVALLLEKYYKPSSGEILIDGQNINDLNSKSLRRHIGLVQQEPILMSG 559
            V +VG +G GKST+   L ++  P +G I ID  +I+ ++ + LRR I ++ Q+P L +G
Sbjct: 1452 VGVVGRTGAGKSTIITALFRFLDPETGHIKIDNVDISLIDLQMLRRSITIIPQDPTLFTG 1511

Query: 560  TIRDNI-------------VYGLTEMPTKDEIRQ--VAKQCFCHNFITRFQSSYDTVIGP 604
            TI+ N+                   + +++E+ +  +         + +F    ++ I  
Sbjct: 1512 TIKSNLDPYDEYSDEDIFAALKRVNLVSQEELDRSNIDAASVGSENVNKFL-DLNSEINE 1570

Query: 605  HGTLLSGGQKQRIAIARALIKKPRILILDEATSALDVESEGAINYTFGQLMKKKEM---T 661
             G  LS GQ+Q + +AR+L++ P+I++LDEAT+++D +S+  I  T      +KE    T
Sbjct: 1571 GGGNLSQGQRQLVCLARSLLRSPKIILLDEATASIDYQSDAKIQETI-----RKEFQGNT 1625

Query: 662  IVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELWDDPTSELSQLLNEKS 712
            I++IAHRL ++   + ++V+       + G+ KE +D P    S LLN+ S
Sbjct: 1626 ILTIAHRLRSVIDYDKILVM-------DQGEVKE-YDHP---YSLLLNKNS 1665

 Score =  102 bits (255), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 74/272 (27%), Positives = 132/272 (48%), Gaps = 14/272 (5%)

Query: 427 LSTFYSEIMQGAGAASRLFELTDRVPSISTTKGVKYKPGNGEIEFKNVSFAYPTRPSNMI 486
           LS   S ++Q   +  R+ E  +  P       +   PG  ++ F+N + ++ +   +  
Sbjct: 705 LSDMLSFVIQSKVSLDRIQEFLEE-PDTDKYNQLSVAPGGQKLGFENATISWDSEKQDFK 763

Query: 487 FKNLNFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPSSGEILI---DGQNINDLNSKSL 543
            +NLN   + G    ++GP+G GK+++ + L    K  +G I++   D + +  +++  +
Sbjct: 764 LRNLNIDFKVGKLNVVIGPTGSGKTSILMALLGEMKLLNGNIVVPSLDPRALLPIDADGM 823

Query: 544 RRHIGLVQQEPILMSGTIRDNIVYG--LTEMPTKDEIRQVAKQCFCHNFITRFQSSYDTV 601
              I    Q   L++ T+R+NI++    +E    D    V + C          +   T 
Sbjct: 824 TNSIAYCSQAAWLLNDTVRNNILFNSPYSEARYND----VIEACGLKRDFEILSAGDMTE 879

Query: 602 IGPHGTLLSGGQKQRIAIARALIKKPRILILDEATSALDVESEGAI--NYTFGQLMKKKE 659
           IG  G  LSGGQKQRI++AR+L    R L+LD+  SA+D  +   I  N   G LM+ + 
Sbjct: 880 IGERGITLSGGQKQRISLARSLYSNSRHLLLDDCLSAVDSHTASWIYDNCITGPLMQGR- 938

Query: 660 MTIVSIAHRLSTIRRSENVIVLGHDGSVVEMG 691
            T + I+H ++   R+  ++VL  +G V E G
Sbjct: 939 -TCILISHNIALTLRNAELVVLLENGQVKEQG 969

>Zrou_YGOB_Anc_5.10 Chr3 complement(92067..95045) [2979 bp, 992 aa]
           {ON} ANNOTATED BY YGOB -
          Length = 992

 Score =  123 bits (309), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 135/517 (26%), Positives = 229/517 (44%), Gaps = 67/517 (12%)

Query: 226 LRATVIKKTIHQDAEFFDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGSVGIGM 285
           L    +K  +H    F DT  +G +++R   D    + SM  ++++  + ++     I  
Sbjct: 482 LNLKAVKGILHTPLSFMDTTPLGRILNRFTKD----TDSMDNELTEDIRLMMFQLGNIIG 537

Query: 286 MXXXXXXXXXXXXVFTPPVILSASVFGKQISTTSRELQ--EAT--GHLTKVAEEQLSGIK 341
           +            +  P +++   +      ++ RE++  EA     +     E L G+ 
Sbjct: 538 VIVMCIVYLPWFAIAVPFLLIMFVMIADHYQSSGREVKRLEAVQRSFVYNNLNEVLGGLD 597

Query: 342 TVQSFVAEQREINRYNFAIRDIFNIGKKAAVIN---AKFFSSTSAMGDLSFLTVLGFGSY 398
           T++++ ++ R + + +F I  +   G   A +    A F    + +  L  +T+L     
Sbjct: 598 TIRAYRSQDRFLVKSDFLINKMNEAGYMVAALQRWVAIFLDMLAVIFAL-IITLLCVTRQ 656

Query: 399 LVLQNSLTIGDLTAFMMYTEYTGNSIFGLSTFYSEIMQGAGAASRLF--------ELTDR 450
             +  S T G L  +++      N++    T   +   G  +A RL         E   R
Sbjct: 657 FKISPSST-GVLLTYVLQLPGLLNTVLRALT---QAENGMNSAERLVTYALDLPQEAEYR 712

Query: 451 VPSISTTKGVKYKPGNGEIEFKNVSFAY-PTRPSNMIFKNLNFKIEAGSNVCIVGPSGRG 509
            P +S  +     P  GEI+F+ VSFAY P+ P   + KN +  I +G  + I G +G G
Sbjct: 713 RPEMSPPENW---PDRGEIKFEGVSFAYRPSLPP--VLKNFSLNIGSGEKIGICGRTGAG 767

Query: 510 KSTVALLLEKYYKPSSGEILIDGQNINDLNSKSLRRHIGLVQQEPILMSGTIRDNI---- 565
           KST+   L +  +   G+I ID  NI DL    LR  + ++ Q+P+L  GTI+ N+    
Sbjct: 768 KSTIMSALYRINEVIDGKIFIDNINIADLGLFELRSKLAIIPQDPVLFRGTIKKNLDPFG 827

Query: 566 -----------VYGLTEMPTKDEIRQVAKQ----CFCHNFITRFQSSYDTVIGPHGTLLS 610
                      V G    P  ++I +   Q       H+ + +F    +  +   G   S
Sbjct: 828 EKTDQELWESLVRGGAIAP--EDIEETKAQQPDASGSHSKMHKFH--LEQKVEEEGGNFS 883

Query: 611 GGQKQRIAIARALIKKPRILILDEATSALDVESEGAIN----YTFGQLMKKKEMTIVSIA 666
            G+KQ +A+ RAL++  RILILDEATS++D E++  I       FG      + TI+ IA
Sbjct: 884 LGEKQLLALTRALVRNSRILILDEATSSVDYETDDKIQSRIVEAFG------DCTILCIA 937

Query: 667 HRLSTIRRSENVIVLGHDGSVVEMGKFKELWDDPTSE 703
           HRL+TI   + ++VL   G V E   F   W+  T E
Sbjct: 938 HRLNTILNYDRILVL-EQGEVAE---FDTPWNLFTKE 970

 Score = 91.7 bits (226), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 70/224 (31%), Positives = 113/224 (50%), Gaps = 23/224 (10%)

Query: 487 FKNLNFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPSSGEILIDGQNINDLNSKSLRRH 546
           F+NLNF I+ G  + + GP G GK+++   +  +   S G + ++G+ ++          
Sbjct: 106 FQNLNFDIKKGEFIIVTGPIGTGKTSLLSAMAGFMARSGGSVEVNGRLLS---------- 155

Query: 547 IGLVQQEPILMSGTIRDNIVYGLTEMPTKDEIRQVAKQCFCHNFITRFQSSYDTVIGPHG 606
            G     P + + T+RDNI++G      K + R+V K C   + +    +   T IG  G
Sbjct: 156 CGY----PWIQNATVRDNIIFG--SPYEKAKYRKVIKACSLDSDLEILPAGDMTEIGERG 209

Query: 607 TLLSGGQKQRIAIARALIKKPRILILDEATSALDVESEGAI--NYTFGQLMKKKEMTIVS 664
             LSGGQK RI +AR + K   I + D+  SA+D      I      G L +K   T + 
Sbjct: 210 INLSGGQKARINLARCVYKDKDIYLFDDVLSAVDARVGKHIMDECLLGLLGQK---TRIL 266

Query: 665 IAHRLSTIRRSENVIVLGHDGSVVEMGKFKELWDDPTSELSQLL 708
             H+L+ I ++  +IVLG+DGS   +G ++EL     S+L +LL
Sbjct: 267 ATHQLALIEKATRLIVLGNDGSFT-IGTYEEL-QKSNSQLKKLL 308

>CAGL0L06402g Chr12 (720723..725330) [4608 bp, 1535 aa] {ON} highly
            similar to uniprot|P39109 Saccharomyces cerevisiae
            YDR135c YCF1 or uniprot|P14772 Saccharomyces cerevisiae
            YLL015w BPT1
          Length = 1535

 Score =  123 bits (308), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 92/275 (33%), Positives = 147/275 (53%), Gaps = 14/275 (5%)

Query: 446  ELTDRVP-SISTTKGVKYKPGNGEIEFKNVSFAYPTRPS---NMIFKNLNFKIEAGSNVC 501
            EL    P  I + +  K  P  GEI+F++    Y TR     + + K++N +I+    + 
Sbjct: 1270 ELKSEAPLVIESNRPPKEWPVAGEIKFEH----YYTRYREDLDYVLKDINLEIKPREKIG 1325

Query: 502  IVGPSGRGKSTVALLLEKYYKPSSGEILIDGQNINDLNSKSLRRHIGLVQQEPILMSGTI 561
            IVG +G GKS++ L L +  + +SG ILIDG +IN++    LR H+ ++ Q+  +  GTI
Sbjct: 1326 IVGRTGAGKSSLTLALFRIIEATSGGILIDGVHINEIGLHDLRHHLSIIPQDSQVFEGTI 1385

Query: 562  RDNIVYGLTEMPTKDEIRQVAKQCFCHNFITRF-QSSYDTVIGPHGTLLSGGQKQRIAIA 620
            R+NI    T   T  +I +  +       I +       T++   G+ LS GQ+Q + +A
Sbjct: 1386 RENI--DPTNQFTDADIWRALELSHLKEHIMQMGGDGLMTMMTEGGSNLSVGQRQLMCLA 1443

Query: 621  RALIKKPRILILDEATSALDVESEGAINYTFGQLMKKKEMTIVSIAHRLSTIRRSENVIV 680
            RAL+   ++L+LDEAT+A+DVE++  I  T     K +  TI++IAHR++TI  ++ +IV
Sbjct: 1444 RALLVPSKVLVLDEATAAVDVETDKVIQETIRTSFKDR--TILTIAHRINTIMDNDRIIV 1501

Query: 681  LGHDGSVVEMGKFKELWDDPTSELSQLLNEKSTPH 715
            L   G VVE    + L  +  S    L  E    H
Sbjct: 1502 LD-KGKVVEFDTPEALLKNTNSIFYSLSKEAGLQH 1535

 Score = 82.0 bits (201), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 91/399 (22%), Positives = 169/399 (42%), Gaps = 46/399 (11%)

Query: 330 TKVAEEQLSGIKTVQSFVAEQ-----REINRYNFAIRDIFNIGKKAAVINAKFFSSTSAM 384
           T+V  E L+ +K+++ +  EQ      E  R    ++++  +G   A  + +F +    +
Sbjct: 503 TRVISEILNNMKSLKLYAWEQPYKEKLEYVRNEKELKNLKKLGVYMACTSFQF-NIVPFL 561

Query: 385 GDLSFLTVLGFGSYLVLQNSLTIGDLTAFMMYTEYTGNSIFGLSTFYSEIMQGAGAASRL 444
              S   V  +     L   L    LT F + +      +  +    + I++ + + SRL
Sbjct: 562 VSCSTFAVFVYTEDKALTTDLVFPALTLFNLLS----FPLMVIPNVITAIIESSVSVSRL 617

Query: 445 FEL----------TDRVPSISTTKGVKYKPGNGEIEFKNVSFAYPTRPSNMI-FKNLNFK 493
           F              R+P +     V    G+      N +F +  +P   +  KN+N++
Sbjct: 618 FNFLTNEELQKDAVQRLPKVKEIGDVAVNVGD------NATFLWKRKPEYKVALKNINYQ 671

Query: 494 IEAGSNVCIVGPSGRGKST-VALLLEKYYKPSSGEILIDGQNINDLNSKSLRRHIGLVQQ 552
            + G   CIVG  G GKS  +  LL   ++   G   I G              +  V Q
Sbjct: 672 AKKGELSCIVGKVGSGKSAFLQSLLGDLFR-VKGFATIHGS-------------VAYVSQ 717

Query: 553 EPILMSGTIRDNIVYGLTEMPTKDEIRQVAKQCFCHNFITRFQSSYDTVIGPHGTLLSGG 612
              +M+GT+RDN+++G    P   E  +  K C     +        T++G  G  LSGG
Sbjct: 718 VAWIMNGTVRDNVLFGHKYDPEFYE--KTIKACALTIDLATLVDGDQTLVGEKGISLSGG 775

Query: 613 QKQRIAIARALIKKPRILILDEATSALDVE-SEGAINYTFGQLMKKKEMTIVSIAHRLST 671
           QK R+++ARA+  +    +LD+  +A+D   S   + +  G        T +   +++S 
Sbjct: 776 QKARLSLARAVYARADTYLLDDPLAAVDEHVSRHLVEHVLGPNGLLHSKTRILATNKISV 835

Query: 672 IRRSENVIVLGHDGSVVEMGKFKELWDDPTSELSQLLNE 710
           +  ++++ +L  +G + + G + +   D  S L +LL E
Sbjct: 836 LSAADSITLL-ENGEITQQGTYADCRKDEESALGKLLKE 873

>KLLA0F20075g Chr6 complement(1868786..1873336) [4551 bp, 1516 aa]
            {ON} similar to uniprot|P39109 Saccharomyces cerevisiae
            YDR135C
          Length = 1516

 Score =  122 bits (306), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 132/481 (27%), Positives = 214/481 (44%), Gaps = 63/481 (13%)

Query: 241  FFDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGSVGIGMMXXXXXXXXXXXXVF 300
            FF+T  +G +++R  +D Y V   + +     F       V +                 
Sbjct: 1043 FFETTPIGRILNRFSNDIYKVDEILGRT----FAQFFANVVKVSFTIVVICMATWQFIFI 1098

Query: 301  TPPVILSASVFGKQISTTSRELQE----ATGHLTKVAEEQLSGIKTVQSFVAEQREINRY 356
              P+ +    + +    TSREL+         +    +E L G+ T++ +  + R ++  
Sbjct: 1099 VLPLSVLYIYYQQYYLRTSRELRRLDSVTRSPIYAHFQETLGGLTTIRGYSQQNRFVHIN 1158

Query: 357  NFAIRDIFNIGKKAAVINAKFFSSTSAMGDLSFLTVLGFGSYLVLQNSLTI------GDL 410
               + +  N+        + F+ S +A   L+F      GS ++L  S+        G L
Sbjct: 1159 QTRVDN--NM--------SAFYPSVNANRWLAFRLEF-IGSVIILAASMLAVIRLGNGTL 1207

Query: 411  TAFMMYTEYTGNSIFGLS-TFYSEIMQGAGAASRL-----------------FELTDRVP 452
            TA M+          GLS +F  +I Q      R+                  EL    P
Sbjct: 1208 TAGMI----------GLSLSFALQITQSLNWIVRMTVEVETNIVSVERIKEYAELKSEAP 1257

Query: 453  SI-STTKGVKYKPGNGEIEFKNVSFAYPTRPS-NMIFKNLNFKIEAGSNVCIVGPSGRGK 510
             I    +     P +GEI+F N S  Y  RP   +I K+++  I     + IVG +G GK
Sbjct: 1258 YIIKDHRPPASWPESGEIKFVNYSTRY--RPELELILKDIDLHIHPKEKIGIVGRTGAGK 1315

Query: 511  STVALLLEKYYKPSSGEILIDGQNINDLNSKSLRRHIGLVQQEPILMSGTIRDNIVYGLT 570
            S++ L L +  + +SG I+IDG  I+ +    LR  + ++ Q+  +  GT+R+NI    T
Sbjct: 1316 SSLTLALFRIIEAASGHIVIDGIPIDSIGLADLRHGLSIIPQDSQIFEGTVRENI--DPT 1373

Query: 571  EMPTKDEIRQVAKQCFCHNFITRFQSS-YDTVIGPHGTLLSGGQKQRIAIARALIKKPRI 629
               T +EI          + I    S+  +T++   G+ LS GQ+Q + +ARAL+    I
Sbjct: 1374 NRYTDEEIWNALALSHLKDHILGMGSNGLETMLTEGGSNLSVGQRQLMCLARALLISSNI 1433

Query: 630  LILDEATSALDVESEGAINYTFGQLMKKKEMTIVSIAHRLSTIRRSENVIVLGHDGSVVE 689
            LILDEAT+A+DVE++  I  T       KE TI++IAHR++TI  S+ +IVL   G V E
Sbjct: 1434 LILDEATAAVDVETDQLIQKTIRNAF--KERTILTIAHRINTIMDSDRIIVLD-KGRVTE 1490

Query: 690  M 690
             
Sbjct: 1491 F 1491

 Score = 85.1 bits (209), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 71/269 (26%), Positives = 124/269 (46%), Gaps = 43/269 (15%)

Query: 465 GNGEIEFKNVSFAYPTRPSNMI-FKNLNFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKP 523
           G+  ++  + +F +  +P   +  KN+NF  + G   CIVG  G GKS +   L      
Sbjct: 620 GDEGVKVNDATFLWQRKPEYKVALKNINFVAKKGELTCIVGKVGSGKSALIQSLLGDLIR 679

Query: 524 SSGEILIDGQNINDLNSKSLRRHIGLVQQEPILMSGTIRDNIVYGLTEMPTKDEIRQVA- 582
             G   + G   N             V Q P +M+GT++DNI++G    P   E  Q+  
Sbjct: 680 VKGFATVHGDVAN-------------VSQVPWIMNGTVKDNILFGHKYDP---EFYQLTI 723

Query: 583 KQCFCHNFITRFQSSYDTVIGPHGTLLSGGQKQRIAIARALIKKPRILILDEATSALDVE 642
           K C     ++       T++G  G  LSGGQK R+++ARA+  +    +LD+  +A+D  
Sbjct: 724 KACALSIDLSMLPDGDQTLVGEKGISLSGGQKARLSLARAVYSRADTYLLDDPLAAVDEH 783

Query: 643 -SEGAINYTFG---------QLMKKKEMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGK 692
            ++  I +  G         +++   ++T++SIA          + I L  +G +++ G 
Sbjct: 784 VAKHLIEHVLGPHGLLHSKTKVLATNKITVLSIA----------DSITLMENGEIIQQGS 833

Query: 693 FKELWDDPTSELSQLLNE-----KSTPHQ 716
           + ++ +   S LS+L+ E     K TP Q
Sbjct: 834 YDQVNESTNSPLSKLIAEFGKKGKPTPSQ 862

>YLL015W Chr12 (116432..121111) [4680 bp, 1559 aa] {ON}  BPT1ABC type
            transmembrane transporter of MRP/CFTR family, found in
            vacuolar membrane, involved in the transport of
            unconjugated bilirubin and in heavy metal detoxification
            via glutathione conjugates, along with Ycf1p
          Length = 1559

 Score =  122 bits (305), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 144/546 (26%), Positives = 250/546 (45%), Gaps = 72/546 (13%)

Query: 203  VGIAA----NYGRIILLRVLSERLVARLRATVIKKTIHQDAEFFDTHKVGDLISRLGSDA 258
            +G+A+    N   I++L   S R   +L  ++ K  I     FF+T  VG +I+R  SD 
Sbjct: 1027 IGVASAAFNNLRSIMMLLYCSIRGSKKLHESMAKSVIRSPMTFFETTPVGRIINRFSSDM 1086

Query: 259  YVVSRSMTQKVSDGFKALICGSVGIGMMXXXXXXXXXXXXVFTPPVILSASVFGKQISTT 318
              V  ++    S  FK+++   V + ++            VF   +++    +       
Sbjct: 1087 DAVDSNLQYIFSFFFKSILTYLVTVILVGYNMPWFL----VFNMFLVVIYIYYQTFYIVL 1142

Query: 319  SRELQE----ATGHLTKVAEEQLSGIKTVQSFVAEQREI----NRYNFAIRDIFNIGKKA 370
            SREL+     +   +  +  E L+G   + ++   +R I     +  + +  +FN     
Sbjct: 1143 SRELKRLISISYSPIMSLMSESLNGYSIIDAYDHFERFIYLNYEKIQYNVDFVFN----- 1197

Query: 371  AVINAKFFSSTSAMGDLSFLTVLGFGSYLVL------------QNSLTIGDLTAFMMYT- 417
                   F ST+    +   T+   G+ +VL            +  L+ G +   M Y+ 
Sbjct: 1198 -------FRSTNRWLSVRLQTI---GATIVLATAILALATMNTKRQLSSGMVGLLMSYSL 1247

Query: 418  EYTGNSIFGLSTFYSEIMQGAGAASRLFELTDRVPSISTTKGVKYK----PGNGEIEFKN 473
            E TG+  + + T  + I     +  R+ E  +  P   +    K      P  G IEFKN
Sbjct: 1248 EVTGSLTWIVRTTVT-IETNIVSVERIVEYCELPPEAQSINPEKRPDENWPSKGGIEFKN 1306

Query: 474  VSFAYPTRPSNMIFKNLNFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPSSGEILIDGQ 533
             S  Y     + +  N+N KIE    V IVG +G GKST++L L +  +P+ G+I+IDG 
Sbjct: 1307 YSTKY-RENLDPVLNNINVKIEPCEKVGIVGRTGAGKSTLSLALFRILEPTEGKIIIDGI 1365

Query: 534  NINDLNSKSLRRHIGLVQQEPILMSGTIRDNIVYGLTEMPTKDEIRQVAKQCFCHNFITR 593
            +I+D+    LR H+ ++ Q+     GT++ N+        ++DE+++  +Q      + +
Sbjct: 1366 DISDIGLFDLRSHLAIIPQDAQAFEGTVKTNL--DPFNRYSEDELKRAVEQAHLKPHLEK 1423

Query: 594  FQSS-----------------YDTVIGPHGTLLSGGQKQRIAIARALIKKPRILILDEAT 636
               S                  D  I  +G+ LS GQ+Q + +ARAL+ + +IL+LDEAT
Sbjct: 1424 MLHSKPRGDDSNEEDGNVNDILDVKINENGSNLSVGQRQLLCLARALLNRSKILVLDEAT 1483

Query: 637  SALDVESEGAINYTFGQLMKKKEMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKEL 696
            +++D+E++  I  T  +  K +  TI++IAHR+ T+  S+ +IVL   GSV E     +L
Sbjct: 1484 ASVDMETDKIIQDTIRREFKDR--TILTIAHRIDTVLDSDKIIVLDQ-GSVREFDSPSKL 1540

Query: 697  WDDPTS 702
              D TS
Sbjct: 1541 LSDKTS 1546

 Score = 90.9 bits (224), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 102/423 (24%), Positives = 190/423 (44%), Gaps = 56/423 (13%)

Query: 331 KVAEEQLSGIKTVQSFVAEQREINRYNFAIRD--IFNIGKKAAVINAKFFSSTSA--MGD 386
           K   E L+ IK+++ +  E+  + R N    D  + N  K   V N  +F+      M  
Sbjct: 473 KTITELLNAIKSIKLYAWEEPMMARLNHVRNDMELKNFRKIGIVSNLIYFAWNCVPLMVT 532

Query: 387 LSFLTVLGFGSYLVLQNSLTIGDLTAFMMYTEYTGNSIFGLSTFYSEIMQGAGAASRL-- 444
            S   +    S   L  ++    L+ F +      ++I+ + +  + I++ + +  RL  
Sbjct: 533 CSTFGLFSLFSDSPLSPAIVFPSLSLFNI----LNSAIYSVPSMINTIIETSVSMERLKS 588

Query: 445 FELTDRVPS-----ISTTKGVKYKPGNGEIEFKNVSFAYPTR------------------ 481
           F L+D +       I  +   +  P    IE  N++F + ++                  
Sbjct: 589 FLLSDEIDDSFIERIDPSADERALPA---IEMNNITFLWKSKEVLTSSQSGDNLRTDEES 645

Query: 482 ---PSNMIFKNLN-FKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPSSGEILIDGQNIND 537
               S +  KN++ F+ + G  VC+VG  G GKST       + K   G++     + + 
Sbjct: 646 IIGSSQIALKNIDHFEAKRGDLVCVVGRVGAGKST-------FLKAILGQLPCMSGSRDS 698

Query: 538 LNSKSLRRH--IGLVQQEPILMSGTIRDNIVYGLTEMPTKDEIRQVAKQCFCHNFITRFQ 595
           +  K + R   +    QE  +M+ ++R+NI++G      +D      K C     +    
Sbjct: 699 IPPKLIIRSSSVAYCSQESWIMNASVRENILFG--HKFDQDYYDLTIKACQLLPDLKILP 756

Query: 596 SSYDTVIGPHGTLLSGGQKQRIAIARALIKKPRILILDEATSALDVE-SEGAINYTF-GQ 653
              +T++G  G  LSGGQK R+++ARA+  +  I +LD+  SA+D E S+  I Y   G+
Sbjct: 757 DGDETLVGEKGISLSGGQKARLSLARAVYSRADIYLLDDILSAVDAEVSKNIIEYVLIGK 816

Query: 654 LMKKKEMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELWD--DPTSELSQLLNEK 711
               K  TI+   + +S ++ S+ +  L  +G +VE G ++++ +  + TS+L +LL E 
Sbjct: 817 TALLKNKTIILTTNTVSILKHSQMIYAL-ENGEIVEQGNYEDVMNRKNNTSKLKKLLEEF 875

Query: 712 STP 714
            +P
Sbjct: 876 DSP 878

>KLLA0D04059g Chr4 complement(338422..343128) [4707 bp, 1568 aa] {ON}
            similar to uniprot|P14772 Saccharomyces cerevisiae
            YLL015W BPT1 ABC type transmembrane transporter of
            MRP/CFTR family found in vacuolar membrane involved in
            the transport of unconjugated bilirubin and in heavy
            metal detoxification via glutathione conjugates along
            with Ycf1p
          Length = 1568

 Score =  121 bits (304), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 133/525 (25%), Positives = 223/525 (42%), Gaps = 61/525 (11%)

Query: 212  IILLRVLSERLVARLRATVIKKTIHQDAEFFDTHKVGDLISRLGSDAYVVSRSMTQKVSD 271
            II++   S R        +    +     FF+T  VG +++R  SD   +       +S 
Sbjct: 1053 IIMMLFCSIRASKLFHNQMAHSVVMAPMSFFETTPVGRIVNRFSSDVNSIDEDFQHIISF 1112

Query: 272  GFKALICGSVGIGMMXXXXXXXXXXXXVFTPPVILSASVFGKQISTT-SRELQEATG--- 327
             F++++   + I ++            +    ++L    + + +    SREL+  T    
Sbjct: 1113 FFRSMLDYLITIVIITVSMPWF-----LLFNTILLGIYYYYQTLYVVLSRELKRLTSISY 1167

Query: 328  -HLTKVAEEQLSGIKTVQSFVAEQREINRYNFA-----IRDIFN-------IGKKAAVIN 374
              +  +  E L G   + ++       N YNF      I  IFN       +  +   I 
Sbjct: 1168 SPVMSLLSETLGGHVVINAY-KHANIFNYYNFENIQTNINFIFNFRSTNRWLSMRLQTIG 1226

Query: 375  AKFFSSTSAMGDLSFLTVLGFGSYLVLQNSLTIGDLTAFMMYTEYTGNSIFGLSTFYSEI 434
            A     TS M     L  LG        N ++ G +   M Y     +S+  +      I
Sbjct: 1227 AVIVLITSLMA----LASLG------TSNPISAGLIGLLMSYALQVSSSLMWIIRMAVNI 1276

Query: 435  MQGAGAASRLFELTDRVPS----ISTTKGVKYKPGNGEIEFKNVSFAYPTRPSNMIFKNL 490
                 +  R+ E  D  P     I  ++  K  P  GEI F++ +  Y     + + K++
Sbjct: 1277 ETTIVSVERIIEYRDLKPEGIRVIEDSRPPKNWPKRGEITFEHYTTKY-RENLDPVLKDI 1335

Query: 491  NFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPSSGEILIDGQNINDLNSKSLRRHIGLV 550
            + +I+    + +VG +G GKST+ L L +  +P  G+I IDG +I+ L    LRR + ++
Sbjct: 1336 DLRIKHQEKIGVVGRTGAGKSTLTLALFRILEPFEGKITIDGIDISTLGLYDLRRSLSII 1395

Query: 551  QQEPILMSGTIRDNIVYGLTEMPTKDEIRQVAKQCFCHNFITRFQSS-----------YD 599
             Q+     GT+R N+        T  EI +  +       I R  S             D
Sbjct: 1396 PQDAQAFEGTVRSNL--DPFNRHTDAEIWKALELSHLKPHIERIVSELPDDENKPTDLLD 1453

Query: 600  TVIGPHGTLLSGGQKQRIAIARALIKKPRILILDEATSALDVESEGAINYTFGQLMKKKE 659
            T I  +G  LS GQ+Q + ++RAL+   +ILILDEAT+A+D E++  I  T     K + 
Sbjct: 1454 TQISDNGNNLSMGQRQLLCLSRALLNPSKILILDEATAAVDRETDKIIQETIRTAFKDR- 1512

Query: 660  MTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELWDDPTSEL 704
             TI++IAHR+ T+  S+ ++VL       + G+ KE  D P + L
Sbjct: 1513 -TILTIAHRIDTVLDSDKIMVL-------DKGEVKEF-DTPDNLL 1548

 Score = 74.3 bits (181), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 94/399 (23%), Positives = 180/399 (45%), Gaps = 53/399 (13%)

Query: 331 KVAEEQLSGIKTVQSFVAEQREINRYNFAIRDI--FNIGKKAAVINAKFFSSTSAMGDLS 388
           K   E L+ +K+++ +  E+  ++R N    D+   N+ K A V N  FF        ++
Sbjct: 469 KTVTEILNSMKSIKLYAWEKPMLDRLNHVRNDLELHNMKKIAIVSNFMFFCWNIVPLLVT 528

Query: 389 FLTVLGFGSYL---VLQNSLTIGDLTAFMMYTEYTGNSIFGLSTFYSEIMQGAGAASRL- 444
             T + F SYL   VL   +    LT F M      +++F + T  S I++   +  RL 
Sbjct: 529 CSTFVLF-SYLTDQVLSPQIIFPSLTLFSM----LNDALFTVPTMISNIIEIGVSLKRLK 583

Query: 445 -FELTDRVPSISTTKGVKYKPGNGEIEFKNVSFAYPTRPS----------------NMIF 487
            + L + + + S  +  +    +  +E  N  F + +  S                 +  
Sbjct: 584 GYLLAEELDT-SFIEHARATASDPTVEISNAVFLWKSPKSAASSEDTDEEAEISSPGVAL 642

Query: 488 KNL-NFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPSSGEI-LIDGQNINDLNSKSLRR 545
           K++ NF  +     CIVG  G GKST       + +   G++  +   + + +  K + R
Sbjct: 643 KSIENFSAKKAQLTCIVGRVGSGKST-------FLQAILGQLPCVSSDSASGVKPKVVIR 695

Query: 546 --HIGLVQQEPILMSGTIRDNIVYGLTEMPTKDE--IRQVAKQCFCHNFITRFQSSYDTV 601
             ++    Q+P +M+ +++DNI++G       DE   ++  K C     +        T+
Sbjct: 696 ADNLAYCPQQPWIMNASLKDNILFGYK----YDEAMYKKTIKACQLLPDLEILPDGDQTL 751

Query: 602 IGPHGTLLSGGQKQRIAIARALIKKPRILILDEATSALDVE-SEGAINYTFGQ---LMKK 657
           +G  G  LSGGQK R+++ARA+  +  + +LD+  SA+D    +  I+    +   L+K 
Sbjct: 752 VGEKGISLSGGQKARLSLARAVYSRADLYLLDDVLSAVDSHVCKSIIDDVLDRQKGLLKN 811

Query: 658 KEMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKEL 696
           K  T++   + ++ +  S+ +I L  +G +VE   ++E+
Sbjct: 812 K--TVILTTNAVNVLVHSD-MIYLLKNGKIVESNSYEEV 847

>SAKL0H23958g Chr8 complement(2062067..2066743) [4677 bp, 1558 aa]
            {ON} similar to uniprot|P14772 Saccharomyces cerevisiae
            YLL015W BPT1 ABC type transmembrane transporter of
            MRP/CFTR family found in vacuolar membrane involved in
            the transport of unconjugated bilirubin and in heavy
            metal detoxification via glutathione conjugates along
            with Ycf1p
          Length = 1558

 Score =  119 bits (299), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 143/544 (26%), Positives = 241/544 (44%), Gaps = 78/544 (14%)

Query: 212  IILLRVLSERLVARLRATVIKKTIHQDAEFFDTHKVGDLISRLGSDAYVVSRSMTQKVSD 271
            +I++   S +   +L  T+ +  +     FF+T  VG +I+R  SD  VV + +    + 
Sbjct: 1035 VIMMIYCSIKGSKKLHDTMARAVLRSPMSFFETTPVGRIINRFSSDVNVVDQGLQFSFTY 1094

Query: 272  GFKALICGSVGIGMMXXXXXXXXXXXXVFTPPV------ILSASVFGKQIS--TTSRELQ 323
             F  ++     + ++             F  P+      IL    F  QI   T SREL+
Sbjct: 1095 FFIYILNYLFTVILIS------------FNMPLFLLFNGILLVLYFYYQIYYITLSRELK 1142

Query: 324  EATG----HLTKVAEEQLSGIKTVQSFVAEQREINRYNFAIRDIFNIGKKAAVINAKF-F 378
              T      +  +  E L G   + ++   QR     N +I+  FNI       N  F F
Sbjct: 1143 RLTSISYSPIMSLLSETLGGHLVINAYKHLQRFTYLNNESIQ--FNI-------NCMFNF 1193

Query: 379  SSTSAMGDLSFLTV---------LGFGSYLVLQNSLTIGDLTAFMMYTEYTGNSIFGLST 429
             ST+    +   T+         L   S +    +L+ G +   M Y      S+  +  
Sbjct: 1194 RSTNRWLSMRLQTIGAVLVLLTALLSLSTINTDKALSSGMVGLLMSYALQVTTSLTWIVR 1253

Query: 430  FYSEIMQGAGAASRLFELTDRVPS----ISTTKGVKYKPGNGEIEFKNVSFAYPTRPSNM 485
               ++     +  R+ E  +  P     I  ++  K  P  G I F+N S  Y     + 
Sbjct: 1254 MSVQVETDIVSVERILEYCNLPPEADAIIEESRPPKEWPSRGAITFQNYSTKY-RENLDP 1312

Query: 486  IFKNLNFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPSSGEILIDGQNINDLNSKSLRR 545
            + K++  +I+    + IVG +G GKST++L L +  +PS G I+IDG +I  L    LR 
Sbjct: 1313 VLKDITVEIKPQEKIGIVGRTGAGKSTLSLALFRLLEPSGGSIVIDGIDIAKLGLSDLRG 1372

Query: 546  HIGLVQQEPILMSGTIRDNI----------VYGLTEMP-TKDEIRQVAKQCFCHNF---- 590
            ++ ++ Q+     GTI+ N+          ++   E+   K  I ++A +    N     
Sbjct: 1373 NLAIIPQDAQAFEGTIKSNLDPFGQYSDEEIWRALELSHLKPHILKMASEENTENSETTT 1432

Query: 591  -ITRFQSSYDTVIGPHGTLLSGGQKQRIAIARALIKKPRILILDEATSALDVESEGAINY 649
              TR        I  +G  LS GQ+Q + ++RAL+   +IL+LDEAT+A+D+E++  I  
Sbjct: 1433 EATRSHELLSARITENGGNLSIGQRQLLCLSRALLNHSKILVLDEATAAVDMETDKIIQE 1492

Query: 650  TFGQLMKKKEMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELWDDPTSELSQLLN 709
            T     K +  TI++IAHR+ T+  S+ ++VL       + G+ KE +D PT+    LL 
Sbjct: 1493 TIKTAFKDR--TILTIAHRIDTVMDSDKIMVL-------DKGEVKE-FDTPTN----LLA 1538

Query: 710  EKST 713
            +KST
Sbjct: 1539 DKST 1542

 Score = 75.9 bits (185), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 80/321 (24%), Positives = 148/321 (46%), Gaps = 39/321 (12%)

Query: 400 VLQNSLTIGDLTAFMMYTEYTGNSIFGLSTFYSEIMQG-AGAASRLFELTDRVPSISTTK 458
           +++  ++I  L  F++  E        L  F+ E +   A + S   E+ +      +TK
Sbjct: 573 IIETGVSIKRLKDFLLAEE--------LDDFFIERLDANATSNSPAIEIYNATFLWKSTK 624

Query: 459 GVKYKPGNGEIEFKNVSFAYPTRPSNMIFKNL-NFKIEAGSNVCIVGPSGRGKSTVALLL 517
           G+K        E +N         + +  KN+ +F+   G   CIVG  G GKST     
Sbjct: 625 GLK--------EDENYDEEAAVASTKVALKNIRHFEARKGDLTCIVGRVGSGKST----- 671

Query: 518 EKYYKPSSGEI-LIDGQNINDLNSKSLR-RHIGLVQQEPILMSGTIRDNIVYGLTEMPTK 575
             + +   G++  I G + +      +R + I    Q+P +M+ +++DN+++G      +
Sbjct: 672 --FLQAILGQLPCISGLDEHVPPKLIIRAKSIAYCPQQPWIMNASLKDNVIFG--HRLNE 727

Query: 576 DEIRQVAKQCFCHNFITRFQSSYDTVIGPHGTLLSGGQKQRIAIARALIKKPRILILDEA 635
           D  +   ++C     +        T++G  G  LSGGQK R+++ARA+  +  + +LD+ 
Sbjct: 728 DYYKATIRKCQLLPDLDILPDGDQTLVGEKGISLSGGQKARLSLARAVYARADVYLLDDI 787

Query: 636 TSALDVE-----SEGAINYTFGQLMKKKEMTIVSIAHRLSTIRRSENVIVLGHDGSVVEM 690
            SA+D E      E  +N   G L  K   T++   + +S ++ S+N+  L  DG +VE 
Sbjct: 788 LSAVDAEVSKNIVEQVLNRGTGILKNK---TVILTTNAVSVLKHSQNIYAL-LDGEIVEN 843

Query: 691 GKFKE-LWDDPTSELSQLLNE 710
             + + +  D +S L  L+ E
Sbjct: 844 KSYADAMSCDDSSILKTLIQE 864

>KLTH0B09724g Chr2 complement(796023..800483) [4461 bp, 1486 aa] {ON}
            similar to uniprot|P53049 Saccharomyces cerevisiae
            YGR281W YOR1 Plasma membrane transporter of the ATP-
            binding cassette (ABC) family mediates export of many
            different organic anions including oligomycin
          Length = 1486

 Score =  119 bits (297), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 125/516 (24%), Positives = 223/516 (43%), Gaps = 60/516 (11%)

Query: 225  RLRATVIKKTIHQDAEFFDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGSVGIG 284
            RL    +++ +H    F DT  +G +++R   D   V   +T+ V   F   +   VG+ 
Sbjct: 975  RLNLKAVQRLLHTPMSFLDTTPIGRVLNRFTKDTDTVDTELTESVR-LFVFQLSNIVGVI 1033

Query: 285  MMXXXXXXXXXXXXVFTPPVILSASVFGKQISTTSRELQ--EAT--GHLTKVAEEQLSGI 340
            +M            +  P ++L          ++SRE++  EA    H+     E L G+
Sbjct: 1034 VMCIIYLPWFA---IAVPFLMLVFVGVADHYQSSSREIKRLEAVQRSHVFNNFNEVLGGM 1090

Query: 341  KTVQSFVAEQREINRYNFAIRDIFNIGKKAAVINAKFFSSTSAMGDLSFLTVLGFGSYLV 400
             T++++  E+R + + +F    +   G     I  ++ +    M  ++F  ++   + L 
Sbjct: 1091 DTIRAYRGERRFLTKSDFLTNKMNEAGYLVVAIQ-RWVAIALDMIAMAFALIV---TLLC 1146

Query: 401  LQNSLTIGDLTAFMMYTEYTGNSIFGLSTFYSEIMQG---AGAASRLFELTDRVPSISTT 457
            +     I   +  ++ T Y       L+     + QG     +  RL      +P  +  
Sbjct: 1147 VTRQFHISAASVGVLLT-YVLQLPGLLNMLLRAMTQGENDMNSTERLISYATELPLEAAY 1205

Query: 458  KGVKYKP-----GNGEIEFKNVSFAY-PTRPSNMIFKNLNFKIEAGSNVCIVGPSGRGKS 511
            +  +  P      +G IEF +VS AY P  P  ++ K++   + AG  + I G +G GKS
Sbjct: 1206 RRPEMSPPAEWPTDGRIEFDHVSLAYRPGLP--LVLKDVTLHVAAGEKIGICGRTGAGKS 1263

Query: 512  TVALLLEKYYKPSSGEILIDGQNINDLNSKSLRRHIGLVQQEPILMSGTIRDNIVYGLTE 571
            T+   L +  +   G I IDG +I+ L    LR  + ++ Q+P++  G +R N+      
Sbjct: 1264 TIMSALYRMCELHDGSITIDGVDISTLGLYDLRSKLSIIPQDPVMFKGDVRKNL--DPFH 1321

Query: 572  MPTKDEI-------------------RQVAKQCFCHNFITRFQSSYDTVIGPHGTLLSGG 612
              T DE+                    Q  +     + + +F    +  +   GT  S G
Sbjct: 1322 ERTDDELWHALVRGGAIPAESLATVRAQTHENAGSLSNMHKFHLQQE--VEEDGTNFSLG 1379

Query: 613  QKQRIAIARALIKKPRILILDEATSALDVESEGAINYTFGQLMKKKEMTIVSIAHRLSTI 672
            ++Q +A+ RAL+++ +ILILDEATS++D E++  I     +       TI+ IAHRL+TI
Sbjct: 1380 ERQLLALTRALVRQSKILILDEATSSVDYETDAKIQTRIVEAFSN--CTILCIAHRLNTI 1437

Query: 673  RRSENVIVLGHDGSVVEM----------GKFKELWD 698
               + ++VL   G V E           G F E+ D
Sbjct: 1438 LDYDRILVLDQ-GRVCEFDTPAALYARGGVFTEMCD 1472

 Score = 87.8 bits (216), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 72/213 (33%), Positives = 102/213 (47%), Gaps = 24/213 (11%)

Query: 487 FKNLNFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPSSGEILIDGQNINDLNSKSLRRH 546
           F NLN +I  G  V + G  G GKS++   L  + K + G+I  DG              
Sbjct: 603 FDNLNIQITKGELVIVTGSVGTGKSSLLYALSGFMKKTGGDIYKDGTM------------ 650

Query: 547 IGLVQQEPILMSGTIRDNIVYGLTEMPTKDEIR--QVAKQCFCHNFITRFQSSYDTVIGP 604
             L+   P + + T+RDNI++G       +E R  ++ + C     +    +   T IG 
Sbjct: 651 --LLCGYPWIQNATVRDNILFG----SPYNEARYNEIIRVCSLQADLELLPAGDRTEIGE 704

Query: 605 HGTLLSGGQKQRIAIARALIKKPRILILDEATSALDVESEGAINYTFGQLMKKKE-MTIV 663
            G  LSGGQK RI +ARA+ KK  I + D+  SA+D      I      LM K E  T V
Sbjct: 705 RGITLSGGQKARINLARAVYKKKDIYLFDDVLSAVDARVGKHIMDEC--LMGKLEGSTRV 762

Query: 664 SIAHRLSTIRRSENVIVLGHDGSVVEMGKFKEL 696
              H+LS I R+  VI +  DGS V++G  +EL
Sbjct: 763 LATHQLSLIARASKVIYIDLDGS-VDVGSVEEL 794

>KLLA0C14234g Chr3 (1234598..1238962) [4365 bp, 1454 aa] {ON} similar
            to uniprot|P53049 Saccharomyces cerevisiae YGR281W YOR1
            Plasma membrane transporter of the ATP- binding cassette
            (ABC) family mediates export of many different organic
            anions including oligomycin
          Length = 1454

 Score =  118 bits (296), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 123/531 (23%), Positives = 228/531 (42%), Gaps = 42/531 (7%)

Query: 205  IAANYGRIILLRVLSERLVARLRATVIKKTIHQDAEFFDTHKVGDLISRLGSDAYVVSRS 264
            +A  + + I + +L       L    +++ +H    F D   +G +++R   D   +   
Sbjct: 923  LAFMFTQFISIGLLGTYASKHLNIKALQRLLHAPMSFMDVTPIGRVMNRFTKDTDTLDNE 982

Query: 265  MTQKVSDGFKALICGSVGIGMMXXXXXXXXXXXXVFTPPVILSASVFGKQISTTSRELQE 324
            +T+ V    + LI     +  +            +  P ++            + RE++ 
Sbjct: 983  ITESV----RLLIFQIANLTGIIILCIIYIPWFAIAMPFLVFLYVFVADHYQASGREIKR 1038

Query: 325  ATG----HLTKVAEEQLSGIKTVQSFVAEQREINRYNFAIRDIFNIGKKAAVINAKFFSS 380
                    +     E L G+ T++++ +EQR + + +F I  +   G     I  ++ + 
Sbjct: 1039 MDAVQRSFVYNNFNEVLGGMDTIKAYRSEQRFLMKSDFLINKMNEAGYLVTSIQ-RWVAI 1097

Query: 381  TSAMGDLSFLTVLGFGSYLVLQNSLTIGDLTAFMMYTEYTGNSIFGLSTFYSEIMQGAGA 440
            +  M  + F  ++     +  Q  ++ G +   + Y       +  L    ++      +
Sbjct: 1098 SLDMLAVIFALIIALLC-VTRQFHVSAGSVGVMVTYVLQLPGLLNALLRSQTQTENDLNS 1156

Query: 441  ASRLFELTDRVP-----SISTTKGVKYKPGNGEIEFKNVSFAY-PTRPSNMIFKNLNFKI 494
            A RL      +P      I  T+  +  P  G I+F+NVS AY P  P  +  KN++  I
Sbjct: 1157 AERLVNYAYDLPIEAKYRILETQPPEQWPSEGRIKFENVSLAYRPELP--VALKNVSIDI 1214

Query: 495  EAGSNVCIVGPSGRGKSTVALLLEKYYKPSSGEILIDGQNINDLNSKSLRRHIGLVQQEP 554
             +   + I G +G GKST+   L +  +  +G+I ID  +I+ L    LR  + ++ Q+P
Sbjct: 1215 GSNEKIGICGRTGAGKSTIMSALYRLVELKTGKITIDDIDISTLGLYELRSKLAIIPQDP 1274

Query: 555  ILMSGTIRDN----------------IVYGLTEMPTKDEIRQVAKQCFCHNFIT--RFQS 596
            +L  G IR N                +  G  +    D IR   K     N ++   F+ 
Sbjct: 1275 VLFKGDIRRNLDPFQECTDEQLWDALVRGGAIDRKDVDSIRAQHKDA---NGLSGDMFKF 1331

Query: 597  SYDTVIGPHGTLLSGGQKQRIAIARALIKKPRILILDEATSALDVESEGAINYTFGQLMK 656
              D ++   G+  S G++Q +A+ RAL++  +ILILDEATS++D  ++  I     +  +
Sbjct: 1332 HLDQMVEDDGSNFSLGERQLLALTRALVRGSKILILDEATSSVDYATDAKIQSRIVE--E 1389

Query: 657  KKEMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELWDDPTSELSQL 707
                TI+ IAHRL TI     ++VL   G VVE    K+L++D  S  +++
Sbjct: 1390 FSNCTILCIAHRLKTILAYNRILVLDQ-GQVVEFDTPKKLYNDRDSIFNEM 1439

 Score = 85.9 bits (211), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 73/231 (31%), Positives = 110/231 (47%), Gaps = 32/231 (13%)

Query: 487 FKNLNFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPSSGEILIDGQNINDLNSKSLRRH 546
           F  LNF ++    + I GP G GKS++   L  + + SSG + I G    DL        
Sbjct: 592 FHGLNFDVKENEFIIITGPIGTGKSSLLNALAGFMRRSSGSMTIKG----DL-------- 639

Query: 547 IGLVQQEPILMSGTIRDNIVYGLTEMPTKDEIRQVAKQCFCHNFITRFQSSYDTVIGPHG 606
             L+   P + + T++DNI++G      K + ++V + C     +    +   T IG  G
Sbjct: 640 --LLCGYPWVQNATVKDNILFG--SPFDKPKYQKVIEICSLQADLDILPAGDRTEIGERG 695

Query: 607 TLLSGGQKQRIAIARALIKKPRILILDEATSALD------VESEGAINYTFGQLMKKKEM 660
             LSGGQK RIA+AR++ K   I + D+  SA+D      +  E  + Y        K+ 
Sbjct: 696 ITLSGGQKARIALARSVYKDMDIYLFDDVLSAVDSRVCKHIVDECMMGYL-------KQK 748

Query: 661 TIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELWDDPT--SELSQLLN 709
           T +   H+LS I ++  VI LG DGS  ++G   EL    T  S+L Q  N
Sbjct: 749 TRILATHQLSLIDKASRVIFLGLDGS-FDIGTVPELLKRNTGFSDLMQFQN 798

>TBLA0C06400 Chr3 complement(1545011..1549144) [4134 bp, 1377 aa] {ON}
            Anc_5.10 YGR281W
          Length = 1377

 Score =  117 bits (294), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 139/542 (25%), Positives = 242/542 (44%), Gaps = 92/542 (16%)

Query: 210  GRIILLRVLSERLVARLRATVIKKTIHQDAEFFDTHKVGDLISRLGSDAYVVSRSMTQKV 269
            G+  LL  +  R    L    + + IH    F ++  +G +++R   D    + S+  ++
Sbjct: 857  GQFSLLCYIGLRASKSLNLQAVNRVIHSPMWFMESTPMGRIMNRFTKD----TESLDNQI 912

Query: 270  SDGFKALI---CGSVGIGMMXXXXXXXXXXXXVFTPPVILSASVFGKQISTTSRELQ--E 324
             D  + ++   C  VGI ++            +  P + L   V      +++RE++  E
Sbjct: 913  LDNLRFVVYQACTIVGISVLCIIYLPWFA---IAIPGLGLILFVACSHYQSSAREIKRLE 969

Query: 325  AT------GHLTKVAEEQLSGIKTVQSFVAEQREINRYNF-------------AIRDIFN 365
            A        HL  V    L G+ T++++ AE+R   + ++             A++   N
Sbjct: 970  AVQRSFIYNHLNDV----LGGVDTIRAYGAEERFSYKLDYLIDKTNEASYLYTAVQRWIN 1025

Query: 366  IGKKAAVINAKFFSSTSAMGDLSFLTVL---GFGSYLVLQNSLTIGDLT----AFMMYTE 418
            I     VIN    S T  +  L    V    G  + +VL   L I DL       +  TE
Sbjct: 1026 I-----VINLVGISFTLIVSLLCVTKVFNLSGASTGVVLSYVLLIPDLLNNTLTMVTQTE 1080

Query: 419  YTGNSIFGLSTFYSEIMQGAGAASRLFELTDRVPSISTTKGVKYKPGNGEIEFKNVSFAY 478
               NS+  L T+ +E+ Q A          + VPS       K  P NGEI+F+NV + +
Sbjct: 1081 NDMNSVERLVTYATELPQEASHG-------EEVPS-------KTWPENGEIKFENVRYTH 1126

Query: 479  PT-RPSNMIFKNLNFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPSSGEILIDGQNIND 537
                P+  +      KI AG  V I G +G GKSTV   L +  +  SG ++ID  +++ 
Sbjct: 1127 RDGLPA--VLDKFTLKIAAGERVGICGRTGAGKSTVLGALYRLREVESGRVMIDDVDVSK 1184

Query: 538  LNSKSLRRHIGLVQQEPILMSGTIRDNI-VYGLTEMPTKDEIRQVAKQCFCHNF------ 590
            LN  +LR  + ++ Q+P+L  G++R N+  +G  +    D ++    +C    F      
Sbjct: 1185 LNLTALRSRLAIIPQDPVLFQGSVRHNLDPFGEYD---DDVLKNALMRCTVGKFNKTGNE 1241

Query: 591  -------------ITRFQSSYDTVIGPHGTLLSGGQKQRIAIARALIKKPRILILDEATS 637
                         + +F+   D  +  +G   S G++Q +A+ARALI+   IL+LDEAT+
Sbjct: 1242 STEGIDTDADNGLVGKFRLDQD--VEENGCNFSVGERQVLALARALIRNSSILVLDEATA 1299

Query: 638  ALDVESEGAINYTFGQLMKKKEMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELW 697
            A+D  ++  +     +  K +  T++ +AHRL TI   + ++VL  +G ++ +   K L 
Sbjct: 1300 AVDAATDAHVQRLVAEAFKGR--TVLCVAHRLDTILNYDRILVL-ENGKIIGLDTPKSLL 1356

Query: 698  DD 699
            D+
Sbjct: 1357 DN 1358

 Score = 93.6 bits (231), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 107/404 (26%), Positives = 185/404 (45%), Gaps = 63/404 (15%)

Query: 322 LQEATGHLTKVAEEQLSGIKTVQSFVAEQREINRYNFAIRDIFNIGK----KAAVINAKF 377
           + + T     +  E L+ IK V+ +  EQ     Y  +I+ I ++      +  ++    
Sbjct: 355 INQVTDQRVSILREVLNNIKMVKLYCWEQA----YEKSIKKIRSLETSKLTRMEILKNVI 410

Query: 378 FSSTSAMGDL-SFLTVLG-FGSYLVLQNSLTIGDLTAFMMYTEYTGNSIFGLSTFYSEIM 435
           FS T ++ ++ S +T L  F  +  L+N+ TI        ++  +   I  L +FY  + 
Sbjct: 411 FSVTFSLPNICSLMTFLALFKIHGGLKNAATI--------FSSLSLFKILSLLSFYIPLS 462

Query: 436 QGAG-----AASRLFELTDRVPS-----ISTTKGVKYKPGNGEIEFKNVSFAYPTRPSNM 485
            G       +  R  E  +   S     I  T    Y      I+  + SF + T   + 
Sbjct: 463 LGTAIDIVTSLDRFQEFLEAEESKETRIIRETNSEIYGDNTVAIKASHCSFRWDTEEKDN 522

Query: 486 I-------FKNLNFKIEAGSNVCIVGPSGRGKST----VALLLEKYYKPSSGEILIDGQN 534
                   F +LNF+I  G  + IVGP G GK++    +  L+ +Y   + GE+ +DG  
Sbjct: 523 NEEKEFSGFHDLNFEIMKGELIIIVGPIGSGKTSLLNAICGLMPQY--GNEGELEVDGSL 580

Query: 535 INDLNSKSLRRHIGLVQQEPILMSGTIRDNIVYGLTEMPTKDEIRQVAKQCFCHNFITRF 594
           ++                 P + + T+RDNI++G     +K   ++V + C     + + 
Sbjct: 581 VS--------------CGYPWIQNTTVRDNILFGSKYDESK--FKRVIRMCSLEEDLEKL 624

Query: 595 QSSYD-TVIGPHGTLLSGGQKQRIAIARALIKKPRILILDEATSALDVE-SEGAINYTFG 652
            S+YD T IG  G  LSGGQK RI +AR+L K+  I + D+  SA+D    +  +     
Sbjct: 625 -SAYDMTEIGERGVTLSGGQKSRINLARSLYKEKDIYLFDDILSAVDSRVGQSIMKECLM 683

Query: 653 QLMKKKEMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKEL 696
           + +K K  T V   H+LS I +++ +IVLG+DG   +MG++++L
Sbjct: 684 EGLKNK--TRVLATHQLSLIGKADQLIVLGNDGK-FDMGRYEDL 724

>Skud_18.2 Chr18 (5442..10184) [4743 bp, 1580 aa] {ON} YHL035C (REAL)
          Length = 1580

 Score =  117 bits (293), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 84/273 (30%), Positives = 145/273 (53%), Gaps = 30/273 (10%)

Query: 455  STTKGVKYKPGNGEIEFKNVSFAYPTRPSNMIFKNLNFKIEAGSNVCIVGPSGRGKSTVA 514
            S T  V + P  GEIEFKN+S  Y    S  +  N++FK+  G+ V IVG +G GKS++ 
Sbjct: 1293 SATSPVDW-PQTGEIEFKNLSLRYSPHSSKAL-DNVSFKVRTGTKVGIVGRTGAGKSSII 1350

Query: 515  LLLEKYYKPSSGEILIDGQNINDLNSKSLRRHIGLVQQEPILMSGTIRDNI--VYGLTEM 572
              + +     SG I+ID ++I  ++ + LR  I  + Q P L  GTIR N+      ++ 
Sbjct: 1351 AAIYRLSDWESGTIIIDNKDIKCVSLECLRNSISCIPQNPTLFDGTIRSNLDPYNQYSDK 1410

Query: 573  PTKDEIRQVA----KQCFC--------HNFITRFQSSYDTVIGPHGTLLSGGQKQRIAIA 620
               D + +V      +  C         +F     S  ++V+   G+ LS GQ+Q + +A
Sbjct: 1411 QVFDALAKVGLIERNEVLCLVTDRQQSSSFSPNKFSDLNSVVRSGGSNLSQGQRQLLCLA 1470

Query: 621  RALIKKPRILILDEATSALDVESEGAINYTFGQLMKKKEMTIVSIAHRLSTIRRSENVIV 680
            R+++   +I+++DEAT+++D  S+  I  T  + M+    TI++IAHRL ++     ++V
Sbjct: 1471 RSMLGSRKIMLIDEATASIDYISDAKIQKTIRETMENT--TILTIAHRLRSVIDYNKILV 1528

Query: 681  LGHDGSVVEMGKFKELWDDPTSELSQLLNEKST 713
            +       +MG+ KE +D P +    L+++K+T
Sbjct: 1529 M-------DMGRVKE-YDHPYN----LISDKNT 1549

 Score = 80.1 bits (196), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 75/255 (29%), Positives = 123/255 (48%), Gaps = 9/255 (3%)

Query: 447 LTDRVPSISTTKGVKYKPGNGEIEFKNVSFAYPTRPSNMIFKNLNFKIEAGSNVCIVGPS 506
           + D +    T+K         ++ FK+ +  +    ++   KN++ + +  S   I+GP+
Sbjct: 642 IEDYLDESETSKYEILTQSKSKVGFKDANMEWDADETSFKLKNISIEFKLNSLNAIIGPT 701

Query: 507 GRGKSTVALLLEKYYKPSSGEILI---DGQNINDLNSKSLRRHIGLVQQEPILMSGTIRD 563
           G GKS++ L L       SG+I +   D ++  ++    +   +    Q P L+SGTI D
Sbjct: 702 GSGKSSLLLGLLGELNLCSGQIYVPSVDSRDDLEVGIDGMTNSMAYCSQSPWLISGTIED 761

Query: 564 NIVYGLTEMPTKDEIRQVAKQCFCHNFITRFQSSYDTVIGPHGTLLSGGQKQRIAIARAL 623
           NIV+G  E P +     V K C     +    +   T +G  G  LSGGQ+QR+A+ARA+
Sbjct: 762 NIVFG--ERPNQRRFNAVIKACCLEKDVKAMSAGLKTSVGGGGFSLSGGQQQRVALARAI 819

Query: 624 IKKPRILILDEATSALDVESEGAI--NYTFGQLMKKKEMTIVSIAHRLSTIRRSENVIVL 681
               R L+LD+  SA+D E+   I      G +MK +   I S  H +S I +    +V+
Sbjct: 820 YSSSRFLLLDDCLSAVDPETALNIYEKCLCGPIMKGRTCIITS--HNISLITKKAEWLVI 877

Query: 682 GHDGSVVEMGKFKEL 696
             +G V   GK  +L
Sbjct: 878 LDNGEVKGQGKPSDL 892

>TPHA0F00410 Chr6 (98503..103215) [4713 bp, 1570 aa] {ON} Anc_4.52
            YLL015W
          Length = 1570

 Score =  116 bits (291), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 128/546 (23%), Positives = 231/546 (42%), Gaps = 63/546 (11%)

Query: 208  NYGRIILLRVLSERLVARLRATVIKKTIHQDAEFFDTHKVGDLISRLGSDAYVVSRSMTQ 267
            N   +I+L   S R   +L   +    +     FF+T  +G +++R  SD   +   +  
Sbjct: 1039 NIRTVIMLLYCSIRGSKKLHDGMALSVMRSPMSFFETTPIGRIVNRFSSDLEAIDSGLQY 1098

Query: 268  KVSDGFKALICGSVGIGMMXXXXXXXXXXXXVFTPPVILSASVFGKQISTTSRELQEAT- 326
              S  F++++   V + ++            V    +I+    +       SREL+  T 
Sbjct: 1099 IFSFFFRSVLIYVVSLILVGYNLPWFIALNAV----LIMIYFYYQAYYIMLSRELKRLTT 1154

Query: 327  ---GHLTKVAEEQLSGIKTVQSFVAEQREINRYNFAIRDIFNIGKKAAVINAKF-FSSTS 382
                 +  +  E L G   + +F       +R+NF     FN       I+  F F ST+
Sbjct: 1155 ISYSPIMSLISETLGGFSVINAF----DHTSRFNF-----FNFETVQYNIDCVFQFRSTN 1205

Query: 383  --------AMGDLSFLTVLGFGSYLVL--QNSLTIGDLTAFMMYTEYTGNSIFGLSTFYS 432
                     +G+L  L   G  S+  L  +  L+ G +   M Y+    +S+  +     
Sbjct: 1206 RWLSVRLQTIGNLIILAT-GLLSFATLGTKKQLSSGMVGLLMSYSLQVTSSLMWIVRMTV 1264

Query: 433  EIMQGAGAASRLFELTDRVPS----ISTTKGVKYKPGNGEIEFKNVSFAYPTRPSNMIFK 488
            +I     +  R  E  +  P     I  ++  +  P  G IEF N +  Y     + + K
Sbjct: 1265 QIETRIVSVERTLEYCELKPEALEIIENSRPPEGWPREGAIEFNNYTTKY-RENLDPVLK 1323

Query: 489  NLNFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPSSGEILIDGQNINDLNSKSLRRHIG 548
            ++N  I+    + IVG +G GKST+ L L +  + + G I IDG +I+ +  + LR ++ 
Sbjct: 1324 DINVSIKPKEKIGIVGRTGAGKSTLTLALFRLIEATGGSISIDGIDISKIGLEDLRSNLA 1383

Query: 549  LVQQEPILMSGTIRDNIVYGLTEMPTKDEIRQVAKQCFCHNFITRFQSSYD--------- 599
            ++ Q+     GTIR N+     +  + +E+ +  +       I R     +         
Sbjct: 1384 IIPQDAQAFEGTIRSNL--DPFDQHSDEELWRAVELSHLKQHILRMNEEANDRESDSSRT 1441

Query: 600  ---------------TVIGPHGTLLSGGQKQRIAIARALIKKPRILILDEATSALDVESE 644
                           T I  +G+ +S GQ+Q + ++RAL+   ++LILDEAT+A+D+E++
Sbjct: 1442 DITTPDSHNIKELLATPISKNGSNVSVGQRQLLCLSRALLNPSKVLILDEATAAIDMETD 1501

Query: 645  GAINYTFGQLMKKKEMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELWDDPTSEL 704
              +  T     + KE TI++IAHR+ T+   + ++VL   G V E      L  D  +  
Sbjct: 1502 KIVQDTIKN--EFKERTILTIAHRIDTVMNYDKILVLDK-GEVAEFDTVSNLLSDKNTMF 1558

Query: 705  SQLLNE 710
             +L  +
Sbjct: 1559 YKLCEQ 1564

 Score = 68.9 bits (167), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 114/528 (21%), Positives = 226/528 (42%), Gaps = 65/528 (12%)

Query: 226 LRATVIKKTIHQDAEFFDTHKVGDLISRLGSDAYVVSRSM--TQKVSDGFKALICGSVGI 283
           L A V KK++   ++    H  GD+I+ + +D   + R    +Q +      ++   + +
Sbjct: 366 LMALVYKKSLRISSDARQKHSSGDIINLMSTDVLNLQRFFENSQSIIGAPIQIVIVLISL 425

Query: 284 GMMXXXXXXXXXXXXVFTPPVILSASVFGKQISTTSRELQEATGHLTKVAEEQLSGIKTV 343
            ++            V   P+  +A +  K  S    +++     LT +  E L+ IK++
Sbjct: 426 YLLLDKAVFAGMISMVIMIPI--NAYLSRKVGSLYKTQMKYKDSRLT-ILTEILNSIKSI 482

Query: 344 QSFVAEQREINRYNFAIRDIF--NIGKKAAVINAKFFSSTSA--MGDLSFLTVLGFGSYL 399
           + +  E+  + +      D+   N  K     N  FF+      M   S   +    S +
Sbjct: 483 KLYSWEKPMLKKLLHVRNDLELENFKKIGIFSNLIFFAWNCVPLMVTCSTFLIFSMISDV 542

Query: 400 VLQNSLTIGDLTAFMMYTEYTGNSIFGLSTFYSEIMQGAGAASRL--FELTDRVPSISTT 457
            L   +    LT F +      ++I+ + +  ++++Q   +  RL  F L + +      
Sbjct: 543 PLSPDIIFPSLTLFNI----LNDAIYVVPSTINDVIQANISMKRLRDFLLAEELDD---- 594

Query: 458 KGVKYK-PGNGE----IEFKNVSFAYPTRP----------------SNMIFKNL-NFKIE 495
             ++YK P   +    IE  N +F + ++                 S    KN+ NF ++
Sbjct: 595 SFIEYKSPSETDDAPVIEINNATFLWQSKKIINENSSTDEESNIETSKAALKNIDNFTVK 654

Query: 496 AGSNVCIVGPSGRGKSTV--ALLLEKYYKPSSGEI-LIDGQNINDLNSKSLR-RHIGLVQ 551
            GS  CIVG  G GKST+  A+L         G++  I   +       ++R   I    
Sbjct: 655 KGSLTCIVGKVGSGKSTILHAIL---------GQLPCISALDQTRAPKVTIRATSIAYCP 705

Query: 552 QEPILMSGTIRDNIVYGLTEMPTKDEIRQVAKQCFCHNFITRFQSSYDTVIGPHGTLLSG 611
           QE  +M+ ++++NIV+G      ++    V + C   + ++      +T++G  G  L G
Sbjct: 706 QEAWIMNSSVKENIVFG--HKHDENYYNLVIQACQLASDLSILPDGDETIVGEKGISLVG 763

Query: 612 G-QKQRIAIARALIKKPRILILDEATSALDVE-SEGAINYTFGQ---LMKKKEMTIVSIA 666
           G QK RI++ARA+  +  + +LD+  SA+D   S+  I Y   +   L++ K  TI+   
Sbjct: 764 GVQKARISLARAVYARADVYLLDDILSAVDAHVSKNIIKYVLSKETGLLRNK--TIILST 821

Query: 667 HRLSTIRRSENVIVLGHDGSVVEMGKFKELWDDP-TSELSQLLNEKST 713
           + ++ ++ S+ +  +   G +VE   ++ + +    S + +L+ E  T
Sbjct: 822 NNVNVLKNSQKIYAI-EKGEIVEESDYENVMNSSDASRIKKLIEEFGT 868

>TDEL0G00330 Chr7 complement(58587..62984) [4398 bp, 1465 aa] {ON}
            Anc_5.10 YGR281W
          Length = 1465

 Score =  116 bits (290), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 119/511 (23%), Positives = 226/511 (44%), Gaps = 61/511 (11%)

Query: 226  LRATVIKKTIHQDAEFFDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGSVGIGM 285
            L    +++ +H    + DT  +G +++R   D   +   +T+ +   F       +G+ +
Sbjct: 958  LNLKAVERVLHTPMAYMDTTPIGRILNRFTKDTDSLDNELTESLR-LFMTQFANIIGVCV 1016

Query: 286  MXXXXXXXXXXXXVFTPPVILSASVFGKQISTTSRELQEATG----HLTKVAEEQLSGIK 341
            M            +  P ++L   +       + RE++         +     E L G+ 
Sbjct: 1017 MCIIYLPWFA---IAIPFLVLIFVLIADHYQASGREVKRLDAIQRSFVYNNLNEVLGGMD 1073

Query: 342  TVQSFVAEQREINRYNFAIRDIFNIGKKAAVINAKFFSSTSAMGDLSFLTVLGFGSYLVL 401
            T++++ +++R + + +F I  +   G     +  ++ +    M  ++F  ++   S L +
Sbjct: 1074 TIKAYGSQERFLVKTDFLINKMNEAGYLLVALQ-RWVAIFLDMIAVAFALII---SLLCV 1129

Query: 402  QNSL-----TIGDLTAFMMYTEYTGNSIFGLSTFYSEIMQGAGAASRLFELTDRVPSIST 456
                     ++G L  +++      N+I    T   +      +A RL    + +P  + 
Sbjct: 1130 TRQFHISPASVGVLLTYVLQLPGLLNTILRALT---QTENDMNSAERLVYCANELPLEAD 1186

Query: 457  TKGVKYKP-----GNGEIEFKNVSFAY-PTRPSNMIFKNLNFKIEAGSNVCIVGPSGRGK 510
             K  +  P       GEI F++VSFAY P  P  ++ K ++  I++   + I G +G GK
Sbjct: 1187 YKRPELAPPESWPSKGEIVFEDVSFAYRPGLP--VVLKGISLDIKSQEKIGICGRTGAGK 1244

Query: 511  STVALLLEKYYKPSSGEILIDGQNINDLNSKSLRRHIGLVQQEPILMSGTIRDN------ 564
            ST+   L +  + S G+I ID  +I  +    LR+ + ++ Q+P+L  GTIR N      
Sbjct: 1245 STIMSALYRLNELSDGKIFIDSVDIGQIGLYDLRKKLSIIPQDPVLFRGTIRKNLDPFQE 1304

Query: 565  ---------IVYGLTEMPTKDEIRQVAKQCFCHNFITRFQSSYDTVIGPHGTLLSGGQKQ 615
                     +V G      + E+ +  K     +  +  +   D  +   G   S G++Q
Sbjct: 1305 HPDELLWKSLVSGGAISAEEVEVVKGQKPDSIGSLSSMHKFHLDQKVEEEGANFSLGERQ 1364

Query: 616  RIAIARALIKKPRILILDEATSALDVESEGAIN----YTFGQLMKKKEMTIVSIAHRLST 671
             +A+ RAL+++ +ILILDEATS++D E++  I       FG      + TI+ IAHRL T
Sbjct: 1365 LLALTRALVRQSKILILDEATSSVDYETDNKIQSRIAAAFG------DCTILCIAHRLKT 1418

Query: 672  IRRSENVIVLGHDGSVVEMGKFKELWDDPTS 702
            I   + ++VL       E G+ +E +D P S
Sbjct: 1419 ILTYDRILVL-------EQGEIEE-FDTPRS 1441

 Score = 96.7 bits (239), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 74/212 (34%), Positives = 105/212 (49%), Gaps = 22/212 (10%)

Query: 487 FKNLNFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPSSGEILIDGQNINDLNSKSLRRH 546
           FKNLN  I+ G  V I GP G GKS++   +  + + +SG + +DG    DL        
Sbjct: 596 FKNLNIDIKKGDFVMITGPIGTGKSSLLSAMAGFMRKTSGTVEVDG----DL-------- 643

Query: 547 IGLVQQEPILMSGTIRDNIVYGLTEMPTKDEIRQVAKQCFCHNFITRFQSSYDTVIGPHG 606
             L+   P + + T+RDNI++G      K+   +V + C     I        T IG  G
Sbjct: 644 --LMCGYPWIQNATVRDNIIFG--SPYDKERFDEVVRVCSLKADIDILPGGELTEIGERG 699

Query: 607 TLLSGGQKQRIAIARALIKKPRILILDEATSALDVESEGAI--NYTFGQLMKKKEMTIVS 664
             LSGGQK RI +AR++ K   I + D+  SA+D      I      G+L  K   T + 
Sbjct: 700 ITLSGGQKARINLARSVYKDKDIFLFDDVLSAVDSRVGKHIMDECLLGRLKGK---TRIL 756

Query: 665 IAHRLSTIRRSENVIVLGHDGSVVEMGKFKEL 696
             H+LS I ++  VIVLG DGS  E GK ++L
Sbjct: 757 ATHQLSLIEKASVVIVLGVDGS-FEAGKLEDL 787

>KLTH0B00396g Chr2 complement(38234..42757) [4524 bp, 1507 aa] {ON}
            similar to uniprot|P32386 Saccharomyces cerevisiae
            YLL048C
          Length = 1507

 Score =  116 bits (290), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 82/234 (35%), Positives = 134/234 (57%), Gaps = 23/234 (9%)

Query: 465  GNGEIEFKNVSFAY-PTRPSNMIFKNLNFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKP 523
            G  EI F +V   Y P  P   + KN++F +   S V IVG +G GKSTV + L +  + 
Sbjct: 1234 GGAEISFDHVYVRYAPHLPD--VLKNVSFTLLPNSKVAIVGRTGSGKSTVMMSLFRLIEL 1291

Query: 524  SSGEILIDGQNINDLNSKSLRRHIGLVQQEPILMSGTIRDNI-VYGLTEMPTKDEIRQVA 582
            ++G I I G +I  LN ++LRR + ++ Q+P L SGTI+ NI  +G     +  E+   A
Sbjct: 1292 TNGTIRIGGIDIASLNLQTLRRELTVIPQDPSLFSGTIKSNIDPFG---RYSDQELTHFA 1348

Query: 583  KQ--CFCHNFITRFQSSYDTVIGPHGTLLSGGQKQRIAIARALIKKPRILILDEATSALD 640
            ++   F      R  +S  +++   G  +S GQ+Q + +ARAL++K +ILILDEAT+++D
Sbjct: 1349 RRIGLFSGTDDVRTFNSLGSLVSEGGENMSQGQRQLLCLARALLQKSKILILDEATASID 1408

Query: 641  VESEGAI-----NYTFGQLMKKKEMTIVSIAHRLSTIRRSENVIVLGHDGSVVE 689
             E++  I     +++ G +       ++++AHR+STI   + VIVL  D  +V+
Sbjct: 1409 HETDATIQQVVRDFSSGGI-------VITVAHRMSTIIDYDQVIVL--DSGIVK 1453

 Score =  102 bits (253), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 87/315 (27%), Positives = 146/315 (46%), Gaps = 21/315 (6%)

Query: 388 SFLTVLGFGSYLVLQ-NSLTIGDLTAFMMYTEYTGNSIFGLSTFYSEIMQGAGAASRLFE 446
           + +T   FG+ + LQ   +T+      +       N +  L+T    I+Q   +  R+ +
Sbjct: 556 TLVTAATFGASIYLQKQKITVASAYTALTLFALLRNPLTQLATMLGTIIQTTVSIQRIEK 615

Query: 447 LTDRVPSISTTKGVKYKPGNGEIEFKNVSFAYPTRPSNMIFKNLNFKIEAGSNVCIVGPS 506
             +R    +T K    K    E+ F+N S  +    +  + KNL    E      I+GPS
Sbjct: 616 FLNRS---NTKKHEILKDSFTEMGFRNASLTWNRFDTGFMLKNLTIDFELHKLNVIIGPS 672

Query: 507 GRGKSTVALLLEKYYKPSSGEILIDGQNINDLNSKSLRRHIGLVQQEPILMSGTIRDNIV 566
           G GKS+V L L        G I +    ++D      R       Q P + + T+++NIV
Sbjct: 673 GSGKSSVLLALLGELDLIEGSIRVPRGYMHDD-----RCSFAFCSQTPWITNATVKENIV 727

Query: 567 YGLTEMPTKDEIRQVAKQCFCHNFITRFQSSYDTVIGPHGTLLSGGQKQRIAIARALIKK 626
           +  ++  TK   ++V   C     I   Q   +TV+G  G  LSGGQ+QR+A+ARA+   
Sbjct: 728 FS-SQFNTK-RYQEVLHACGLEEDILEMQEGDETVVGDKGMTLSGGQRQRLALARAVYSG 785

Query: 627 PRILILDEATSALDVESEGAINYTF-----GQLMKKKEMTIVSIAHRLSTIRRSENVIVL 681
              L+LD+  SA+D    G   + F     G LMK K  T +   H ++ +++  ++I+L
Sbjct: 786 AEHLLLDDCLSAVD---PGMAVWIFQKCIMGPLMKGK--TCILATHNIALVQKHADMIIL 840

Query: 682 GHDGSVVEMGKFKEL 696
             +G V ++GK ++ 
Sbjct: 841 LDNGRVSKIGKARDF 855

>Kpol_YGOB_1041.45 s1041 complement(118923..123629) [4707 bp, 1568 aa]
            {ON} ANNOTATED BY YGOB -
          Length = 1568

 Score =  115 bits (289), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 132/531 (24%), Positives = 229/531 (43%), Gaps = 57/531 (10%)

Query: 208  NYGRIILLRVLSERLVARLRATVIKKTIHQDAEFFDTHKVGDLISRLGSDAYVVSRSMTQ 267
            N   I++L   S R   +L   +    ++    FF+T  +G +I+R   D   V   +  
Sbjct: 1032 NLRSIVMLIFCSIRGSKKLHDNMALSVVYSPMSFFETTPIGRIINRFSGDLDSVDSGLQF 1091

Query: 268  KVSDGFKALICGSVGIGMMXXXXXXXXXXXXVFTPPVILSASVFGKQISTTSRELQEATG 327
              S  F++L+    G  +             VF   +I+    +      TSREL+  T 
Sbjct: 1092 IFSHFFRSLL----GYIVTVILVGYNMPWFFVFNIFLIVIYFYYQAYYIVTSRELKRLTS 1147

Query: 328  ----HLTKVAEEQLSGIKTVQSFVAEQR----EINRYNFAIRDIFNIGKKAAVINAKFFS 379
                 +  +  E L+G   + ++   +R          F I  +FN       ++ +   
Sbjct: 1148 ITYSPIMSLISETLAGYLVINAYNHAKRFSYFNFESVQFNIDCLFNFRSTNRWLSVRL-- 1205

Query: 380  STSAMGDLSFLTVLGFGSYLVLQNS--LTIGDLTAFMMYTEYTGNSIFGLSTFYSEIMQG 437
               A+G L  L   G  S   +  S  LT G +   M Y+    NS+  +     +I   
Sbjct: 1206 --QAIGALIVLAT-GLLSLSTIGTSKQLTAGMVGLLMSYSLQVTNSLMWIVRMSVQIETN 1262

Query: 438  AGAASRLFELTDRVPSIST----TKGVKYKPGNGEIEFKNVSFAYPTRPSNMIFKNLNFK 493
              +  R+ E  +  P        TK  K  P +G I+F + S  Y  +  + +   +N +
Sbjct: 1263 IVSVERILEYCELPPEPPHEIEETKPEKSWPAHGSIKFIDYSTKY-RKNLDPVLNKINLE 1321

Query: 494  IEAGSNVCIVGPSGRGKSTVALLLEKYYKPSSGEILIDGQNINDLNSKSLRRHIGLVQQE 553
            IE    + IVG +G GKST+ L L +  + + G+I+IDG +I+ L    LR ++ ++ Q+
Sbjct: 1322 IEPREKIGIVGRTGAGKSTLTLALFRILEATDGKIVIDGVDISTLGLSDLRSNLAIIPQD 1381

Query: 554  PILMSGTIRDNIVYGLTEMPTKDEIRQVAKQCFCHNFITRFQSSYD-------------- 599
                 GTIR N+     +  + +E+ +  +       + R  S+ D              
Sbjct: 1382 AQAFEGTIRTNL--DPFDQHSDEELWKAIEASHLKPHLERIISNRDDNSESEETNVSAKD 1439

Query: 600  -----TVIGPHGTLLSGGQKQRIAIARALIKKPRILILDEATSALDVESEGAINYTFGQL 654
                   I  +G+ LS GQ+Q + ++RAL+   +IL+LDEAT+++D+E++  I  T    
Sbjct: 1440 NNLLEIKINENGSNLSVGQRQLLCLSRALLNHSKILVLDEATASVDMETDKIIQETIRNE 1499

Query: 655  MKKKEMTIVSIAHRLSTIRRSENVIVLGHDG-SVVEMGKFKELWDDPTSEL 704
               +  TI++IAHR+ T        VLG+D   V++ G+ +E  D P + L
Sbjct: 1500 FSDR--TILTIAHRIDT--------VLGYDKILVLDKGEVREF-DSPDTLL 1539

 Score = 72.8 bits (177), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 63/237 (26%), Positives = 116/237 (48%), Gaps = 30/237 (12%)

Query: 487 FKNLN-FKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPSSG-------EILIDGQNINDL 538
           FKN+N F+++ GS  CIVG  G GK+T+   +       SG       +++I G +I   
Sbjct: 644 FKNVNHFEVKEGSLTCIVGRVGSGKTTLLRAVLGQLPCISGAQESIPPKLIIRGNSI--- 700

Query: 539 NSKSLRRHIGLVQQEPILMSGTIRDNIVYGLTEMPTKDEIRQVAKQCFCHNFITRFQSSY 598
                        Q+  +M+ ++++NI++G      +       + C     +       
Sbjct: 701 ---------AYCPQQAWIMNSSVKENILFG--HKYDEHYYNLTIEACQLTEDLKMLPDGD 749

Query: 599 DTVIGPHGTLLSGGQKQRIAIARALIKKPRILILDEATSALDVE-SEGAINYTFGQ---L 654
           +T++G  G  LSGGQK R+++ARA+  +  I +LD+  SA+D E S+  I     +   L
Sbjct: 750 ETIVGEKGISLSGGQKARLSLARAVYSRSDIYLLDDILSAVDAEVSKNIIEKVLDEQTGL 809

Query: 655 MKKKEMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELWDDP-TSELSQLLNE 710
           +K K  TI+   + +S ++ S+ +  L  +  ++E G + ++ +    S+L  L+NE
Sbjct: 810 LKSK--TIILTTNAISVLKHSQKIYAL-ENCEIIEEGAYDDVMNSSEDSKLKALINE 863

>Kpol_1041.45 s1041 complement(118923..123713) [4791 bp, 1596 aa]
            {OFF} complement(118923..123713) [4791 nt, 1597 aa]
          Length = 1596

 Score =  115 bits (288), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 132/531 (24%), Positives = 229/531 (43%), Gaps = 57/531 (10%)

Query: 208  NYGRIILLRVLSERLVARLRATVIKKTIHQDAEFFDTHKVGDLISRLGSDAYVVSRSMTQ 267
            N   I++L   S R   +L   +    ++    FF+T  +G +I+R   D   V   +  
Sbjct: 1060 NLRSIVMLIFCSIRGSKKLHDNMALSVVYSPMSFFETTPIGRIINRFSGDLDSVDSGLQF 1119

Query: 268  KVSDGFKALICGSVGIGMMXXXXXXXXXXXXVFTPPVILSASVFGKQISTTSRELQEATG 327
              S  F++L+    G  +             VF   +I+    +      TSREL+  T 
Sbjct: 1120 IFSHFFRSLL----GYIVTVILVGYNMPWFFVFNIFLIVIYFYYQAYYIVTSRELKRLTS 1175

Query: 328  ----HLTKVAEEQLSGIKTVQSFVAEQR----EINRYNFAIRDIFNIGKKAAVINAKFFS 379
                 +  +  E L+G   + ++   +R          F I  +FN       ++ +   
Sbjct: 1176 ITYSPIMSLISETLAGYLVINAYNHAKRFSYFNFESVQFNIDCLFNFRSTNRWLSVRL-- 1233

Query: 380  STSAMGDLSFLTVLGFGSYLVLQNS--LTIGDLTAFMMYTEYTGNSIFGLSTFYSEIMQG 437
               A+G L  L   G  S   +  S  LT G +   M Y+    NS+  +     +I   
Sbjct: 1234 --QAIGALIVLAT-GLLSLSTIGTSKQLTAGMVGLLMSYSLQVTNSLMWIVRMSVQIETN 1290

Query: 438  AGAASRLFELTDRVPSIST----TKGVKYKPGNGEIEFKNVSFAYPTRPSNMIFKNLNFK 493
              +  R+ E  +  P        TK  K  P +G I+F + S  Y  +  + +   +N +
Sbjct: 1291 IVSVERILEYCELPPEPPHEIEETKPEKSWPAHGSIKFIDYSTKY-RKNLDPVLNKINLE 1349

Query: 494  IEAGSNVCIVGPSGRGKSTVALLLEKYYKPSSGEILIDGQNINDLNSKSLRRHIGLVQQE 553
            IE    + IVG +G GKST+ L L +  + + G+I+IDG +I+ L    LR ++ ++ Q+
Sbjct: 1350 IEPREKIGIVGRTGAGKSTLTLALFRILEATDGKIVIDGVDISTLGLSDLRSNLAIIPQD 1409

Query: 554  PILMSGTIRDNIVYGLTEMPTKDEIRQVAKQCFCHNFITRFQSSYD-------------- 599
                 GTIR N+     +  + +E+ +  +       + R  S+ D              
Sbjct: 1410 AQAFEGTIRTNL--DPFDQHSDEELWKAIEASHLKPHLERIISNRDDNSESEETNVSAKD 1467

Query: 600  -----TVIGPHGTLLSGGQKQRIAIARALIKKPRILILDEATSALDVESEGAINYTFGQL 654
                   I  +G+ LS GQ+Q + ++RAL+   +IL+LDEAT+++D+E++  I  T    
Sbjct: 1468 NNLLEIKINENGSNLSVGQRQLLCLSRALLNHSKILVLDEATASVDMETDKIIQETIRNE 1527

Query: 655  MKKKEMTIVSIAHRLSTIRRSENVIVLGHDG-SVVEMGKFKELWDDPTSEL 704
               +  TI++IAHR+ T        VLG+D   V++ G+ +E  D P + L
Sbjct: 1528 FSDR--TILTIAHRIDT--------VLGYDKILVLDKGEVREF-DSPDTLL 1567

 Score = 72.8 bits (177), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 63/237 (26%), Positives = 116/237 (48%), Gaps = 30/237 (12%)

Query: 487 FKNLN-FKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPSSG-------EILIDGQNINDL 538
           FKN+N F+++ GS  CIVG  G GK+T+   +       SG       +++I G +I   
Sbjct: 672 FKNVNHFEVKEGSLTCIVGRVGSGKTTLLRAVLGQLPCISGAQESIPPKLIIRGNSI--- 728

Query: 539 NSKSLRRHIGLVQQEPILMSGTIRDNIVYGLTEMPTKDEIRQVAKQCFCHNFITRFQSSY 598
                        Q+  +M+ ++++NI++G      +       + C     +       
Sbjct: 729 ---------AYCPQQAWIMNSSVKENILFG--HKYDEHYYNLTIEACQLTEDLKMLPDGD 777

Query: 599 DTVIGPHGTLLSGGQKQRIAIARALIKKPRILILDEATSALDVE-SEGAINYTFGQ---L 654
           +T++G  G  LSGGQK R+++ARA+  +  I +LD+  SA+D E S+  I     +   L
Sbjct: 778 ETIVGEKGISLSGGQKARLSLARAVYSRSDIYLLDDILSAVDAEVSKNIIEKVLDEQTGL 837

Query: 655 MKKKEMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELWDDP-TSELSQLLNE 710
           +K K  TI+   + +S ++ S+ +  L  +  ++E G + ++ +    S+L  L+NE
Sbjct: 838 LKSK--TIILTTNAISVLKHSQKIYAL-ENCEIIEEGAYDDVMNSSEDSKLKALINE 891

>ACL072C Chr3 complement(224562..229445) [4884 bp, 1627 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YLL048C
            (YBT1) and YHL035C
          Length = 1627

 Score =  115 bits (288), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 131/519 (25%), Positives = 226/519 (43%), Gaps = 84/519 (16%)

Query: 230  VIKKTIHQDAEFFDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALI-CGSVGIGMMXX 288
            V+ K +H    FFD    G +++RL  D   V + +       F A++ C S  +     
Sbjct: 1114 VLWKILHAKMRFFDATPTGRIMNRLSKDLEAVDQELIPYFEGSFAAVVQCISTLV----- 1168

Query: 289  XXXXXXXXXXVFTPPVILSASVF--------GKQISTTSRELQE----ATGHLTKVAEEQ 336
                       +  P  L  ++F        G    TTSREL+         + +   E 
Sbjct: 1169 --------LIAYVTPQFLIMAIFIGFLYALIGYFYVTTSRELKRFESITRSPIYQHFSET 1220

Query: 337  LSGIKTVQSFVAEQREINRYNFAIRDIFNIGKKAAVINAKFFSSTSAMGDLSF-LTVLG- 394
            L GI +++++  E+R      F + ++  I       N  FF    A   L+F + +LG 
Sbjct: 1221 LVGITSIRAYGDERR------FMLENLSRIDDN----NRPFFYLWIANRWLAFRVDLLGA 1270

Query: 395  ---FGSYLVLQNSLTIGDLTA-----FMMYTEYTGNSIFGLSTFYSEIMQGAGAASRLFE 446
               F S L +   L IG L A      + Y  +           YS +     +  RL E
Sbjct: 1271 LVTFFSGLFIY--LNIGKLDAGLAGISLTYAIFFTEGALWFVRHYSNVEMTMNSFERLKE 1328

Query: 447  LTDRVPSISTTKGVKYKPGN----GEIEFKNVSFAY-PTRPSNMIFKNLNFKIEAGSNVC 501
              + +      +  +  P N    G I+  ++S  Y P  P   + KN+NF +E    V 
Sbjct: 1329 YME-IEQEPYNENAQLPPDNWPQHGRIDVSDLSLRYAPNLPK--VIKNVNFSVEPKLKVG 1385

Query: 502  IVGPSGRGKSTVALLLEKYYKPSSGEILIDGQNINDLNSKSLRRHIGLVQQEPILMSGTI 561
            IVG +G GKST+   + ++  P +G + ID  +I  +    LR+ I ++ Q+P L +GT+
Sbjct: 1386 IVGRTGAGKSTIITAMFRFLDPETGFVKIDNIDITTIPLHRLRQSITIIPQDPTLFTGTL 1445

Query: 562  RDNIVYGLTEMPTKDEIRQVAKQCFCHNF----------------ITRFQSSYDTVIGPH 605
            + +I+   ++   K     + +     +                 I +F    +  +   
Sbjct: 1446 K-SILDPYSQYSDKQIYEALQRVNLLSDTDINSLSSPSTQSSGENINKFL-DLNNEVTEG 1503

Query: 606  GTLLSGGQKQRIAIARALIKKPRILILDEATSALDVESEGAINYTFGQLMKKKEMTIVSI 665
            G  LS GQ+Q + +AR+L++ P+I++LDEAT+++D  S+  I  T  +  + ++ TI++I
Sbjct: 1504 GANLSQGQRQLVCLARSLLRSPKIIMLDEATASIDYTSDEKIQQTIRE--EFRDSTILTI 1561

Query: 666  AHRLSTIRRSENVIVLGHDGSVVEMGKFKELWDDPTSEL 704
            AHRL +I   + V+V+       + G+ KE +D P S L
Sbjct: 1562 AHRLKSIIDYDKVLVM-------DAGEVKE-YDHPYSLL 1592

 Score = 82.0 bits (201), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 99/382 (25%), Positives = 166/382 (43%), Gaps = 51/382 (13%)

Query: 335 EQLSGIKTVQSFVAE---QREINRYNFAIRD--IFNIGKKAAVINAKFFSSTSAMGDLSF 389
           E L  I+ ++ F  E   ++E+     AIR+  +  + K+A V +A           +SF
Sbjct: 542 ETLQSIRIIKFFAWETNFEKEVQ----AIREDELATLLKRAIVWSA-----------ISF 586

Query: 390 LTVL--------GFGSYLVLQNS-LTI----GDLTAFMMYTEYTGNSIFGLSTFYSEIMQ 436
           L  +         F  Y+ +Q   LTI      L+ F+M      N +  L+   S ++Q
Sbjct: 587 LWFMVSTIVVSASFACYIYIQGEVLTIPVAFTALSLFVMLR----NPLDVLADMLSYVVQ 642

Query: 437 GAGAASRLFELTDRVPSISTTKGVKYKPGNGEIEFKNVSFAYPTRPSNMIFKNLNFKIEA 496
              +  R+    D      TTK  +       + F+N + A+   PS+   +N++ +   
Sbjct: 643 SKVSLDRIQAFLDED---ETTKYEQLTISGNRLAFENATIAWNDDPSSFRLRNIDIEFMI 699

Query: 497 GSNVCIVGPSGRGKSTVALLLEKYYKPSSGEILIDGQNIND---LNSKSLRRHIGLVQQE 553
           G      GP+G GKS++ L L        G+I +   +  +   + +  L   I    Q 
Sbjct: 700 GKLNVAFGPTGTGKSSLLLGLLGEMTLQEGKIYVPSLDPREDLVIQADGLTNSIAYCSQS 759

Query: 554 PILMSGTIRDNIVYGLTEMPTKDE-IRQVAKQCFCHNFITRFQSSYDTVIGPHGTLLSGG 612
             L++ T R NI++     P  ++    V + C              T IG  G  LSGG
Sbjct: 760 AWLLNDTARSNILF---NSPYNEQRYNDVLEACGLKKDFEILSGGDLTQIGEKGMTLSGG 816

Query: 613 QKQRIAIARALIKKPRILILDEATSALDVESEGAI--NYTFGQLMKKKEMTIVSIAHRLS 670
           QKQRI++ARAL    R L+LD+  SA+D  +   I  N   G LM+ +  T V ++H ++
Sbjct: 817 QKQRISLARALYSSARHLLLDDCLSAVDSHTALLIYENCIIGPLMEGR--TCVLVSHNVA 874

Query: 671 TIRRSENVIVLGHDGSVVEMGK 692
              R+ + +V+  +G V   G+
Sbjct: 875 LTMRNADWVVILENGRVKAQGE 896

>TBLA0A06840 Chr1 (1666910..1670086) [3177 bp, 1058 aa] {ON} Anc_5.10
            YGR281W possible pseudogene; NNN added to avoid internal
            stop codon; truncated at 5' end
          Length = 1058

 Score =  115 bits (287), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 75/241 (31%), Positives = 131/241 (54%), Gaps = 25/241 (10%)

Query: 464  PGNGEIEFKNVSFAYPTRPSNMIFKNLNFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKP 523
            P NG+I+FK+ +F Y      +I KN N  +++G  + I G +G GKST+   L +  + 
Sbjct: 797  PENGKIQFKDANFRYKEGLP-LILKNFNMLVQSGEKIGICGRTGAGKSTIMNCLFRLDEL 855

Query: 524  SSGEILIDGQNINDLNSKSLRRHIGLVQQEPILMSGTIRDNI-------------VYGLT 570
            + G I ID  +I+ L    LR+++ ++ Q+PIL  GTIR N+                L+
Sbjct: 856  TDGAIYIDDIDISTLGLHDLRKNLSIIPQDPILFEGTIRKNLDPFSYFDDATLWEAMILS 915

Query: 571  EMPTKDEIRQVAKQCFCHNFITRFQSSYDTVIGPHGTLLSGGQKQRIAIARALIKKPRIL 630
                +D     +++   +  +T+F  +    +   GT  S G+KQ +A  RA+I   +++
Sbjct: 916  GFIDRDTFGHFSEKPVNNKELTKFHLT--AHVEEDGTNYSLGEKQLLAFTRAIIHHSKVV 973

Query: 631  ILDEATSALDVESEGAINYTFGQLMKKKEM---TIVSIAHRLSTIRRSENVIVLGHDGSV 687
            +LDEA+S++D E++  I     Q +  K+    TI+ IAHRL+TI + + ++VL H G++
Sbjct: 974  VLDEASSSVDYETDAKI-----QTLISKQFSHNTILCIAHRLNTILKYDRILVLDH-GNI 1027

Query: 688  V 688
            +
Sbjct: 1028 I 1028

 Score = 94.4 bits (233), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 78/251 (31%), Positives = 115/251 (45%), Gaps = 43/251 (17%)

Query: 469 IEFKNVSFAYPTRPSNMI---------------------FKNLNFKIEAGSNVCIVGPSG 507
           I+F N SF + T   ++I                     F NLNF I  G  + I GP G
Sbjct: 166 IKFNNASFEWETFEDDIIKDENNINQILENKTNNCHFNGFNNLNFSI-XGEFIIITGPIG 224

Query: 508 RGKSTVALLLEKYYKPSSGEILIDGQNINDLNSKSLRRHIGLVQQEPILMSGTIRDNIVY 567
            GK+++   +    K   G I IDG             ++ L    P + + T+RDNI++
Sbjct: 225 TGKTSLLYAMSGLMKKLEGTIEIDG-------------NLQLCGY-PWVQNTTVRDNIIF 270

Query: 568 GLTEMPTKDEIRQVAKQCFCHNFITRFQSSYDTVIGPHGTLLSGGQKQRIAIARALIKKP 627
           G      K++   V + C     +  F     T IG  G  LSGGQK RI +ARA+ K  
Sbjct: 271 G--SKYEKEKFDHVIRICALTEDLENFSGKDLTEIGELGITLSGGQKARINLARAIYKTS 328

Query: 628 RILILDEATSALDVESEGAI--NYTFGQLMKKKEMTIVSIAHRLSTIRRSENVIVLGHDG 685
            I + D+  SA+D      I  N   G L  K    + +  H+LS I++++ ++VLG+D 
Sbjct: 329 DIYLFDDILSAVDSRVGNFIMENCLLGALSGKTXXILAT--HQLSLIKKADRIVVLGNDN 386

Query: 686 SVVEMGKFKEL 696
           S  E+G +KEL
Sbjct: 387 S-FEIGPYKEL 396

>TBLA0A03800 Chr1 complement(947158..951798) [4641 bp, 1546 aa] {ON}
            Anc_8.303 YDR135C
          Length = 1546

 Score =  113 bits (282), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 132/554 (23%), Positives = 226/554 (40%), Gaps = 83/554 (14%)

Query: 226  LRATVIKKTIHQDAEFFDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGSVGIGM 285
            L + ++   +     FF+T  +G +++R  +D Y V   + +  S  F      +V +  
Sbjct: 1009 LHSQMLASVLRAPMSFFETTPIGRILNRFSNDMYKVDELLGRTFSQFFS----NAVKVTF 1064

Query: 286  MXXXXXXXXXXXXVFTPPVILSASVFGKQISTTSRELQE--------ATGHLTKVAEEQL 337
                          F  P+      + +    TSREL+            H     +E L
Sbjct: 1065 TLVVICVSTWQFIFFIVPMSFLYIYYQQYYMRTSRELRRLDSVTRSPTISHF----QETL 1120

Query: 338  SGIKTVQSFVAEQREINRYNFAIRDIFNIGKKAAVINAKFFSS--TSAMGDLSFLTVLGF 395
             GI T++ +  E R I+     + +  N+      IN   + +     +G +  L     
Sbjct: 1121 GGISTIRGYSQENRFIHINQQRVDN--NMSAYYPSINCNRWLAFRLEFLGSVIILGASTL 1178

Query: 396  GSYLVLQNSLTIGDLTAFMMYTEYTGNSIFGLSTFYSEIMQGAGAASRL---FELTDRVP 452
            G Y + Q ++T G +   + Y      S+  +     E+     +  R+    EL    P
Sbjct: 1179 GIYRLSQGNMTPGMIGLSLSYALQITQSLNWIVRMTVEVETNIVSVERIKEYSELASEAP 1238

Query: 453  SISTTK--GVKYKPGNGEIEFKNVSFAYPTRPS---NMIFKNLNFKIEAGSNVCIVGPSG 507
            SI   K   V + P +G ++F +    Y TR     + + K++   I+    + IVG +G
Sbjct: 1239 SIVEDKRPDVNW-PQDGAVKFNH----YYTRYRADLDYVLKDITLDIKPREKIGIVGRTG 1293

Query: 508  RGKSTVALLLEKYYKPSSGEILIDGQNINDLNSKSLRRHIGLVQQEPILMSGTIRDNIVY 567
             GKS++ L L +  + S G I +DG N +++    LR  + ++ Q+  +  GT+RDNI  
Sbjct: 1294 AGKSSLTLALFRIIEASEGNINVDGINTDEIGLYDLRHKLSIIPQDSQVFEGTVRDNI-- 1351

Query: 568  GLTEMPTKDEIRQVAKQCFCHNFITRF--------------------------------- 594
              T   T +EI +  +     + I                                    
Sbjct: 1352 DPTGQYTDEEIWKALELSHLKSHIINMSKHSSSDSSSNESLSPASNNSSGNNDNSNSSSD 1411

Query: 595  -----------QSSYDTVIGPHGTLLSGGQKQRIAIARALIKKPRILILDEATSALDVES 643
                        ++ +T +   G+ LS GQ+Q + +ARAL+    IL+LDEAT+A+DVE+
Sbjct: 1412 GLTSSGLEDISHNALNTKLSEGGSNLSVGQRQLMCLARALLVPSNILVLDEATAAVDVET 1471

Query: 644  EGAINYTFGQLMKKKEMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELWDDPTSE 703
            +  I  T     K +  TI++IAHRL+TI  S+ ++VL   G + E    + L  D  S 
Sbjct: 1472 DQLIQETIRSAFKNR--TILTIAHRLNTIMDSDRILVLD-KGEIKEFDSPQTLLGDKDSL 1528

Query: 704  LSQLLNEKS-TPHQ 716
               L  +   TP Q
Sbjct: 1529 FYSLCEQAGLTPAQ 1542

 Score = 92.4 bits (228), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 71/278 (25%), Positives = 129/278 (46%), Gaps = 42/278 (15%)

Query: 450 RVPSISTTKGVKYKPGNGEIEFKNVSFAYPTRPSNMI-FKNLNFKIEAGSNVCIVGPSGR 508
           R+P++  T  V  K G+      + +F +  +P   +  KN+NF+   G   CIVG  G 
Sbjct: 598 RLPNVKNTGDVSIKLGD------DATFLWKRKPEYKVALKNINFQARKGELTCIVGKVGS 651

Query: 509 GKSTVALLLEKYYKPSSGEILIDGQNINDLNSKSLRRHIGLVQQEPILMSGTIRDNIVYG 568
           GKS +              IL D   +      ++   +  V Q P +M+GT+++NI++G
Sbjct: 652 GKSALI-----------QSILGDLFRVKGF--ATVHGDVAYVSQVPWIMNGTVKENILFG 698

Query: 569 LTEMPTKDEIRQVAKQCFCHNFITRFQSSYDTVIGPHGTLLSGGQKQRIAIARALIKKPR 628
                 K    +  K C     ++       T++G  G  LSGGQK R+++ARA+  +  
Sbjct: 699 --HKFDKKFYEKTIKACALTIDLSILPDGDSTLVGEKGISLSGGQKARLSLARAVYARAD 756

Query: 629 ILILDEATSALDVE-SEGAINYTFG---------QLMKKKEMTIVSIAHRLSTIRRSENV 678
             + D+  +A+D    +  I +  G         +++   ++T+++IA          + 
Sbjct: 757 TYLFDDPLAAVDEHVGKHLIEHVLGPNGLLHSKTKVLATNKITVLNIA----------DY 806

Query: 679 IVLGHDGSVVEMGKFKELWDDPTSELSQLLNEKSTPHQ 716
           I L  +G +++ GK++E+  DP S L +L+NE    H+
Sbjct: 807 ITLLDNGEIIQRGKYEEVTSDPGSPLCKLINEYGKKHE 844

>TBLA0C07100 Chr3 (1721628..1726085) [4458 bp, 1485 aa] {ON} 
          Length = 1485

 Score =  112 bits (281), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 127/511 (24%), Positives = 225/511 (44%), Gaps = 67/511 (13%)

Query: 226  LRATVIKKTIHQDAEFFDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGSVGIGM 285
            L    + K +H    F DT+ +G +++R   D   +   +T+ +       I   +G+G 
Sbjct: 976  LNLQALHKILHTPMSFMDTNPLGRILNRFTKDTDALDNELTENLRLAMSQ-IANIIGVGA 1034

Query: 286  MXXXXXXXXXXXXVFTPPVILSASVFGKQISTTSRELQEATG----HLTKVAEEQLSGIK 341
            M            +  P ++L   +      +T RE++         +     E L+G+ 
Sbjct: 1035 MCIIYLPWFA---IAIPFLLLIFLLIADHYQSTGREVKRLEAIQRSFVYNNLNEMLTGMD 1091

Query: 342  TVQSFVAEQREINRYNFAIRDIFNIGK--KAAVIN------AKFFSSTSAMGDLSFLTVL 393
            T++++ A+ R      FA +  F I K  +AA I+      A  F    A+     +T+L
Sbjct: 1092 TIKAYNAQDR------FATKSEFLIDKMNEAAYISIAVQRWAGIFLDLVAVAFALIITLL 1145

Query: 394  GFGSYLVLQNSLTIGDLTAFMMYTEYTGNSIFGLSTFYSEIMQGAGAASRLFELTDRVPS 453
                 +  Q  ++  D    + Y       +  L    + +++           T+R+ S
Sbjct: 1146 C----VTRQFHISGADTGVLLTY-------VLQLPGLLNTVLRALTQTENDMNSTERLVS 1194

Query: 454  ISTT--KGVKYK----------PGNGEIEFKNVSFAY-PTRPSNMIFKNLNFKIEAGSNV 500
             +T   +  +Y+          P NG I F+N++FAY P  P  +I KN N  I+    +
Sbjct: 1195 YATQLPQEAQYRKPECSPPIDWPQNGHIVFENINFAYRPGLP--IILKNFNLIIKPNEKI 1252

Query: 501  CIVGPSGRGKSTVALLLEKYYKPSSGEILIDGQNINDLNSKSLRRHIGLVQQEPILMSGT 560
             I G +G GKST+   L +  + ++G+I+ID  +I++L    LR  + ++ Q+P+L  G 
Sbjct: 1253 GICGRTGAGKSTIMNALYRLTELTTGKIIIDDIDISNLGLYELRSKLAIIPQDPVLFRGN 1312

Query: 561  IR----------DNIVY-GLTEMPTKD--EIRQVAKQCFCHNFITRFQSSYDTVIGPHGT 607
            IR          D++++  L +    D  E+  V  Q    +     +   +  +   G 
Sbjct: 1313 IRRNLDPFDEYQDDLLWESLVKAGAIDSQELETVKSQDKNSDAKNLHKFHLNQSVDEDGN 1372

Query: 608  LLSGGQKQRIAIARALIKKPRILILDEATSALDVESEGAINYTFGQLMKKKEMTIVSIAH 667
              S G++Q +A+ RAL+++ +ILILDEATS++D E++  I             TI+ IAH
Sbjct: 1373 NFSLGERQVLALTRALVRQSKILILDEATSSVDYETDAKIQNLIATAF--NHCTILCIAH 1430

Query: 668  RLSTIRRSENVIVLGHDGSVVEMGKFKELWD 698
            RL TI   + ++VL   G V E   F   W+
Sbjct: 1431 RLKTILNYDRILVL-EKGEVAE---FDTPWN 1457

 Score = 90.9 bits (224), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 67/214 (31%), Positives = 103/214 (48%), Gaps = 21/214 (9%)

Query: 486 IFKNLNFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPSSGEILIDGQNINDLNSKSLRR 545
           +  N+NF I  G  V + GP G GK+++   L    +  SGE+   G    DL       
Sbjct: 624 LLSNINFTIPKGEFVVVTGPVGSGKTSLLFALAGLMEQLSGEMNHSG----DL------- 672

Query: 546 HIGLVQQEPILMSGTIRDNIVYGLTEMPTKDEIRQVAKQCFCHNFITRFQSSYDTVIGPH 605
              L+   P + + TIRDNI++G    PT    ++V   C   + +    +   T +G  
Sbjct: 673 ---LLCGIPWVQNATIRDNILFGSPYDPTF--YKRVLHVCALESDLENLPAHDKTEVGER 727

Query: 606 GTLLSGGQKQRIAIARALIKKPRILILDEATSALDVE-SEGAINYTFGQLMKKKEMTIVS 664
           G  LSGGQK RI++ARA+ K   I + D+  SA+D       ++Y     +  K  T + 
Sbjct: 728 GVTLSGGQKARISLARAVYKNKDIYLFDDVLSAVDARVGRHIMDYCMNDHLSDK--TRIL 785

Query: 665 IAHRLSTIRRSENVIVL--GHDGSVVEMGKFKEL 696
             H+LS + +++ +IVL    D    E+G FKEL
Sbjct: 786 ATHQLSLVEKADRIIVLSTSKDAPHFEIGTFKEL 819

>Smik_11.367 Chr11 (644116..648903) [4788 bp, 1595 aa] {ON} YKR103W
            (REAL)
          Length = 1595

 Score =  112 bits (279), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 132/552 (23%), Positives = 240/552 (43%), Gaps = 91/552 (16%)

Query: 203  VGIAANYGRIILLRVLSERLVARLRATVIKKTIHQDAEFFDTHKVGDLISRLGSDAYVVS 262
            V    N  + I  ++LS   +A+LR             F D   VG +++R   D  ++ 
Sbjct: 1064 VLFGTNATKKIFAKLLSSIFLAKLR-------------FHDITPVGRIMNRFSKDMDIID 1110

Query: 263  RSMTQKVSDGFKALICGSVGIGMMXXXXXXXXXXXXVFTPPVILSASVFGKQISTTSREL 322
                Q++   F+ L    V    +            +F  P+     + G      SREL
Sbjct: 1111 ----QQLIPNFEGLFYSVVVCLWVIFLIGYITPRFLLFAIPLCALYYIVGSLYLRASREL 1166

Query: 323  QEA----TGHLTKVAEEQLSGIKTVQSFVAEQREINRYNFAIRDIFNIGKKAAVINAKFF 378
            +         + ++  E + G+ T+++   E+R      F  + +  I K     NA FF
Sbjct: 1167 KRIDNINVSPIHQLFTEAIKGVATIRALADERR------FITQTLVAIDKS----NAPFF 1216

Query: 379  SSTSAMGDLSFLTVLGFGSYLVLQNSLTI--------GDLTAFMM-----YTEYTGNSIF 425
                A   +++  V   G+ ++  +SL I          L   ++     +TE T   I 
Sbjct: 1217 YLNLATEWITY-RVDIIGALILFSSSLMIVLKAPYLDAGLAGILLSNAFSFTE-TAQWII 1274

Query: 426  GLSTFYSEIMQGAGAASRLFELTDRVPSISTTKGVKYK------PGNGEIEFKNVSFAYP 479
             +   +S +     +  R+ E  D VP + +++   Y       P  G+IEF+N++  Y 
Sbjct: 1275 KV---FSGVELLMSSVERIKEYVD-VP-LESSESNNYATPLANWPQTGDIEFENLTLRYS 1329

Query: 480  TRPSNMIFKNLNFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPSSGEILIDGQNINDLN 539
               S  +   ++FK++AG+ V IVG +G GKS++   + +      G I+ID ++I  + 
Sbjct: 1330 PHSSKAL-DGVSFKVKAGTKVGIVGRTGAGKSSIIAAIYRLSDWEDGTIIIDNKDIKYVP 1388

Query: 540  SKSLRRHIGLVQQEPILMSGTIRDNI--------VYGLTEMPTKDEIRQVAKQCFC---- 587
             + LR  I  + Q P L  GTIR N+        V     +     I Q    C      
Sbjct: 1389 LECLRNSISCIPQNPTLFEGTIRSNLDPWDQYSDVQVFEALEKVGLIEQSEGLCSLPGQK 1448

Query: 588  ------HNFITRFQSSYDTVIGPHGTLLSGGQKQRIAIARALIKKPRILILDEATSALDV 641
                  H    RF    +TV+   G+ +S GQ+Q + +AR+++    I+++DEAT+++D 
Sbjct: 1449 LSYPSNHKLRNRF-IDLNTVVKSGGSNISQGQRQLLCLARSMLGARNIMLIDEATASIDY 1507

Query: 642  ESEGAINYTFGQLMKKKEMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELWDDPT 701
             S+  I  T  + M+    T+++IAHRL ++   + ++V+       +MG+ +E +D P 
Sbjct: 1508 VSDAKIQKTIRETMRNT--TVLTIAHRLRSVIDYDKILVM-------DMGRVEE-YDHPY 1557

Query: 702  SELSQLLNEKST 713
            +    L+++K+T
Sbjct: 1558 N----LISDKNT 1565

 Score = 85.9 bits (211), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 69/231 (29%), Positives = 114/231 (49%), Gaps = 9/231 (3%)

Query: 471 FKNVSFAYPTRPSNMIFKNLNFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPSSGEI-- 528
           F+N +  +    ++   KN++   +  +   I+GP+G GKS++ L L       SG+I  
Sbjct: 667 FENANMEWEAAETSFKLKNISIDFKQNTLNAIIGPTGSGKSSLLLGLLGELNLRSGKINV 726

Query: 529 -LIDGQNINDLNSKSLRRHIGLVQQEPILMSGTIRDNIVYGLTEMPTKDEIRQVAKQCFC 587
             +  ++  ++    +   +    Q P L+SGTI+DNIV+G  E   + +   V K C  
Sbjct: 727 PTVHSRDDLEIGIDGMANSMAYCSQSPWLISGTIKDNIVFG--EFFNQQKFDDVIKCCCL 784

Query: 588 HNFITRFQSSYDTVIGPHGTLLSGGQKQRIAIARALIKKPRILILDEATSALDVESEGAI 647
              I    +   T +G  G  LSGGQ+QRIA+ARA+    R L+ D+  SA+D E+   I
Sbjct: 785 EKDIKAMTAGLKTDVGEGGFSLSGGQQQRIALARAIYSSSRYLLFDDCLSAVDPETALHI 844

Query: 648 --NYTFGQLMKKKEMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKEL 696
                 G +MK +  T +  +H +S I +    +V+  +G V   GK  +L
Sbjct: 845 YEECLCGPMMKGR--TCIVTSHNISLIIKQAQWLVILDNGEVKAQGKPSDL 893

>AGL346W Chr7 (61232..65434) [4203 bp, 1400 aa] {ON} Syntenic homolog
            of Saccharomyces cerevisiae YGR281W (YOR1)
          Length = 1400

 Score =  110 bits (274), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 115/490 (23%), Positives = 214/490 (43%), Gaps = 48/490 (9%)

Query: 225  RLRATVIKKTIHQDAEFFDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGSVGIG 284
            RL  +  K+ ++    F DT  +G +++R   D  V+   +T   +  F   +   VG+ 
Sbjct: 898  RLNLSAAKRILYAPMSFIDTTPMGRILNRFTKDTDVLDNELTDS-TRMFVFQMANVVGVF 956

Query: 285  MMXXXXXXXXXXXXVFTPPVILSASVFGKQISTTSRELQEATG----HLTKVAEEQLSGI 340
            ++            +  P  +L     G    +  RE++         +     E L G+
Sbjct: 957  ILSIAYLPYVA---IAVPISVLLLLFIGDHYQSAGREVKRLEAIQRSFVYNNLGEVLDGL 1013

Query: 341  KTVQSFVAEQREINRYNFAIRDIFNIGKKAAVINAKFFSSTSAMGDLSFLTVLGFGSYLV 400
             T++++ A+ R + + ++ +      G    VI A+ + + +   DL  + +    + L 
Sbjct: 1014 DTIRAYNAQSRFLRKSDYFLNRTNEAGY--LVIGARCWVALTT--DLVAIAIALIVTLLC 1069

Query: 401  LQNSLTIGDLTAFMMYTEYTGNSIFGLSTFYSEIMQGAGAASRLFELTDRVPSISTT--- 457
            +   + I   +A ++ T      +  +  +++ +++G          T RV   +T    
Sbjct: 1070 VTRVIHITPSSAGVLLT-----VVLQMPAYFNMVLRGFTELENNMNSTQRVHYYATALPQ 1124

Query: 458  KGVKY---------KPGNGEIEFKNVSFAY-PTRPSNMIFKNLNFKIEAGSNVCIVGPSG 507
            +  +Y          P  GEI F+ VSFAY P  P  +    ++F + AG  + I G +G
Sbjct: 1125 EAPQYLPGAAPPAGWPAAGEIVFQEVSFAYRPGLP--LALCGVSFHVRAGEKIGICGRTG 1182

Query: 508  RGKSTVALLLEKYYKPSSGEILIDGQNINDLNSKSLRRHIGLVQQEPILMSGTIRDNIVY 567
             GK++V   L +  +  SG I IDG +I  L    LR  + ++ Q+P+L  GT+R N+  
Sbjct: 1183 AGKTSVTTALYRLSELESGSIKIDGVDIATLGLHDLRSALSIIPQDPLLFRGTVRKNL-- 1240

Query: 568  GLTEMPTKDEIRQVAKQCFCHNFI-------TRFQSSYDTVIGPHGTLLSGGQKQRIAIA 620
                 P  +            + +       T  +   D  +   G   S G++Q +A+A
Sbjct: 1241 ----DPFAEHTDGTLWSALVRSGVVPAGVVPTSHKFHLDQEVDEGGANFSLGERQLLALA 1296

Query: 621  RALIKKPRILILDEATSALDVESEGAINYTFGQLMKKKEMTIVSIAHRLSTIRRSENVIV 680
            RAL++  RILILDEATS++D  ++  +        + ++ T++ +AHRL TI   + ++V
Sbjct: 1297 RALVRSTRILILDEATSSVDYATDARVQARIAA--EFRQATVLCVAHRLRTIISYDRILV 1354

Query: 681  LGHDGSVVEM 690
            L   G V E 
Sbjct: 1355 LDQ-GRVAEF 1363

 Score = 84.3 bits (207), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 63/208 (30%), Positives = 102/208 (49%), Gaps = 18/208 (8%)

Query: 489 NLNFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPSSGEILIDGQNINDLNSKSLRRHIG 548
           +L F I+ G  + ++G  G GK+++   +  Y K ++G + ++G         SL     
Sbjct: 553 DLLFSIKKGEFIIVIGAIGTGKTSLLNAVAGYMKKTTGSVHVNG---------SL----- 598

Query: 549 LVQQEPILMSGTIRDNIVYGLTEMPTKDEIRQVAKQCFCHNFITRFQSSYDTVIGPHGTL 608
           L    P + + TIRDNI++G +   T+ +  +V   C        F +   T +G  G  
Sbjct: 599 LFCGVPWIQNATIRDNIIFGSSFDQTRYD--EVVNACALEADFKIFPAGDKTEVGERGIT 656

Query: 609 LSGGQKQRIAIARALIKKPRILILDEATSALDVESEGAINYTFGQLMKKKEMTIVSIAHR 668
           LSGGQK RI++ARA+ K   I + D+  SA+D      I      L + +  T +   H+
Sbjct: 657 LSGGQKARISLARAIYKDRDIYLFDDIISAVDANVAAHITQK-CLLDRLQNRTRILATHQ 715

Query: 669 LSTIRRSENVIVLGHDGSVVEMGKFKEL 696
           L+ ++ +  VI LG DGS  +MG   EL
Sbjct: 716 LALVQEASRVIFLGQDGS-FDMGTPAEL 742

>YKR103W Chr11 (653080..656736) [3657 bp, 1218 aa] {ON}
           NFT1Putative transporter of the multidrug
           resistance-associated protein (MRP) subfamily; adjacent
           ORFs YKR103W and YKR104W are merged in different strain
           backgrounds.
          Length = 1218

 Score = 88.2 bits (217), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 73/242 (30%), Positives = 118/242 (48%), Gaps = 19/242 (7%)

Query: 465 GNGEIEFKNVSFAYPTRPSNMIFKNLNFKIEAGSNVCIVGPSGRGKSTVALLLE------ 518
            N +  F++ S  +    ++   KN++   +  S   I+GP+G GKS++ L L       
Sbjct: 647 SNTKFGFEDASMEWEAAETSFKLKNISIDFKLNSLNAIIGPTGSGKSSLLLGLLGELNLL 706

Query: 519 --KYYKPSSGEILIDGQNINDLNSKSLRRHIGLVQQEPILMSGTIRDNIVYGLTEMPTKD 576
             K Y P+     ++ ++  ++    +   +    Q P L+SGTI+DN+V+G  E+  K 
Sbjct: 707 SGKIYVPT-----VESRDDLEIGKDGMTNSMAYCSQTPWLISGTIKDNVVFG--EIFNKQ 759

Query: 577 EIRQVAKQCFCHNFITRFQSSYDTVIGPHGTLLSGGQKQRIAIARALIKKPRILILDEAT 636
           +   V K C     I    +   T +G  G  LSGGQ+QRIA+ARA+    R LILD+  
Sbjct: 760 KFDDVMKSCCLDKDIKAMTAGIRTDVGDGGFSLSGGQQQRIALARAIYSSSRYLILDDCL 819

Query: 637 SALDVESEGAI--NYTFGQLMKKKEMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFK 694
           SA+D E+   I      G +MK +   I S  H +S + +  + +V+   G V   GK  
Sbjct: 820 SAVDPETALYIYEECLCGPMMKGRTCIITS--HNISLVTKRADWLVILDRGEVKSQGKPS 877

Query: 695 EL 696
           +L
Sbjct: 878 DL 879

>KAFR0A03790 Chr1 complement(770906..773536) [2631 bp, 876 aa] {ON}
           Anc_8.661 YPL147W
          Length = 876

 Score = 80.5 bits (197), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 59/199 (29%), Positives = 105/199 (52%), Gaps = 21/199 (10%)

Query: 496 AGSNVCIVGPSGRGKSTVALLLEKYYKPSSGEILIDGQNINDLNSKSLRRHIGLVQQEPI 555
           AGS++ I+GP+G GKS++  ++ + +            N N L SK    ++  V Q+P 
Sbjct: 643 AGSSLLILGPNGCGKSSIQRIIAEIWPI---------YNKNGLLSKPTEANLLCVPQKPY 693

Query: 556 LM-SGTIRDNIVYGLT-----EMPTKDEIR-QVAKQCFCHNFITRFQS-SYDTVIGPHGT 607
               GT+RD I+Y ++     +   KD++  QV ++      + R +  SY   +     
Sbjct: 694 FTRGGTLRDQIIYPMSSDEFFDRGLKDKLLVQVLREVKLDYLLKRDKGWSYLDTVSDWKD 753

Query: 608 LLSGGQKQRIAIARALIKKPRILILDEATSALDVESEGAINYTFGQLMKKKEMTIVSIAH 667
           +LSGG+KQR+  AR +  KPR ++LDEAT+A+  + E   +Y F  ++K+     ++I+ 
Sbjct: 754 VLSGGEKQRMNFARIMFHKPRFVVLDEATNAISADME---DYLFN-VLKRYRFNFITISQ 809

Query: 668 RLSTIRRSENVIVLGHDGS 686
           R S I+  + ++ +  D S
Sbjct: 810 RPSLIKYHDLLLEISDDNS 828

>Kpol_175.1 s175 complement(1..4131) [4131 bp, 1377 aa] {ON}
           complement(1..4131) [4131 nt, 1377 aa]
          Length = 1377

 Score = 80.5 bits (197), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 93/372 (25%), Positives = 164/372 (44%), Gaps = 44/372 (11%)

Query: 334 EEQLSGIKTVQSFVAEQREINRYNFAIRDIFNIGKKAAVINAKFFSSTSAMGDLS--FLT 391
            E  S IK ++ F  E   IN     +R   +  +K  +I+   +S  + +  L+   +T
Sbjct: 558 NELFSSIKIIKCFTWEDNFINH---ILRTRDSEVRKMKLISV-IWSCNAIIWYLTPTLIT 613

Query: 392 VLGFGSYLVLQNSLTIGDLTAFMMYTEYTGNSIFGL--------STFYSEIMQGAGAASR 443
            + F +Y +     T+    AF      T  S+FGL        S+  + I+Q   +  R
Sbjct: 614 SISF-AYFIFCERATLTAPIAF------TALSLFGLLKMPLDQLSSTINYIVQSVISLRR 666

Query: 444 LFELTDRVPSISTTKGVKYKPGNGEIEFKNVSFAYPTRPSNMIFKNLNFKIEAGSNVCIV 503
           +    D  P +   K +          F   +  +       I +NLN K ++     + 
Sbjct: 667 IQSFLDE-PDMDKQKNLLLSKDGTYFMFSGATIGWSINNKGFILENLNVKFKSKKLNVVA 725

Query: 504 GPSGRGKSTVALLLEKYYKPSSGEILIDGQNINDLNSKS--------LRRHIGLVQQEPI 555
           GP+G GKS + + L        GEI     ++  L SK         L   I    Q P 
Sbjct: 726 GPTGAGKSLLLMSLLGETHLFKGEI-----HVPSLASKHELMIHGDGLTNSISYCSQIPW 780

Query: 556 LMSGTIRDNIVYGLTEMPTKDEIRQVAKQCFCHNFITRFQSSYDTVIGPHGTLLSGGQKQ 615
           +++ +I++NI++G +E   K     V + C   N +   Q   ++++G  G  LSGGQ+Q
Sbjct: 781 IINDSIKNNILFG-SEFNLK-RYNDVIRACCLTNDLRLLQDGDNSIVGDRGQNLSGGQRQ 838

Query: 616 RIAIARALIKKPRILILDEATSALDVESEGAINYTF---GQLMKKKEMTIVSIAHRLS-T 671
           R+++ARA+  K   +ILD+  SA+D +    I Y     G LMK +  T + ++H +   
Sbjct: 839 RVSLARAIYSKSMHIILDDCLSAVDSKCAKDI-YDLCLTGPLMKGR--TCILVSHNVELV 895

Query: 672 IRRSENVIVLGH 683
           I+++  +++L +
Sbjct: 896 IKKAAYLLILDN 907

 Score = 46.2 bits (108), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 67/305 (21%), Positives = 125/305 (40%), Gaps = 38/305 (12%)

Query: 225  RLRATVIKKTIHQDAEFFDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGSVGIG 284
            R+   +++  +     FF+   +G +++    D     RS+  ++S   +     ++   
Sbjct: 1092 RIFIKILRNVVSSKLIFFEKTPIGSIMNNFSKDI----RSLDFELSPFIEGTFSCTLQ-T 1146

Query: 285  MMXXXXXXXXXXXXVFTPPVILSASVF-GKQISTTSRELQEATGHLTKVA-----EEQLS 338
            +M            +F    I     F G      SREL+     +TK        E L+
Sbjct: 1147 LMSLILITYVNPNFIFPAIFIFLFCCFIGHSYLCCSRELKRYES-ITKTPIYQHFSESLA 1205

Query: 339  GIKTVQSFVAEQREINRYNFAIRDIFNIGKKAAVINAKFFSSTSAMGDLSF-------LT 391
            G+ ++++F  E R        I+ IF    +    N  FF    A   LSF       +T
Sbjct: 1206 GLVSIRAFGDELR-------FIKVIFT---RVDEYNKSFFYLWEANNWLSFRIELIGSIT 1255

Query: 392  VLGFGSYLVLQNSLTIGDLTA--FMMYTEYTGNSIFGLSTFYSEIMQGAGAASRLFELT- 448
            +L  G +L+   ++    L    F     +T ++++ +  FY+ +     +  RL+E T 
Sbjct: 1256 ILATGLFLLSNANMVDSGLAGITFTYAIAFTESALWMIK-FYATMEMNMNSVERLYEYTN 1314

Query: 449  -DRVPSISTTKGVKYK-PGNGEIEFKNVSFAY-PTRPSNMIFKNLNFKIEAGSNVCIVGP 505
             ++ P       V  + P +G+I+FKNV+  Y P  P   + +++ F I     + +VG 
Sbjct: 1315 LEQEPYSRCITNVDNQWPNSGDIKFKNVTLRYSPELPK--VLQDVTFVIGDKEKIGVVGR 1372

Query: 506  SGRGK 510
            +G GK
Sbjct: 1373 TGAGK 1377

>Ecym_5660 Chr5 complement(1331316..1335926) [4611 bp, 1536 aa] {ON}
           similar to Ashbya gossypii AGL346W
          Length = 1536

 Score = 80.1 bits (196), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 62/213 (29%), Positives = 103/213 (48%), Gaps = 24/213 (11%)

Query: 487 FKNLNFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPSSGEILIDGQNINDLNSKSLRRH 546
           F +L+F+++ G  + I G  G GK+++   L  +   ++G+I  +G+             
Sbjct: 590 FSDLSFEVKKGELLVITGAIGTGKTSLLNALAGFMHKTNGDIQYNGR------------- 636

Query: 547 IGLVQQEPILMSGTIRDNIVYGLTEMPTKDEI-RQVAKQCFCHNFITRFQSSYDTVIGPH 605
             L    P + + TIRDNI +G    P  + + R+V + C     ++   +   T +G  
Sbjct: 637 -MLFCGAPWIQNATIRDNITFG---SPYDENLYREVMRVCSLDRDMSVLPAGDKTEVGER 692

Query: 606 GTLLSGGQKQRIAIARALIKKPRILILDEATSALDVESEGAI--NYTFGQLMKKKEMTIV 663
           G  LSGGQK RI +AR + K   I + D+  SA+D     +I  +   G+L  K   T +
Sbjct: 693 GITLSGGQKARINLARCVYKVRDIYLFDDILSAVDARVGASIMNDCLLGKLGDK---TRI 749

Query: 664 SIAHRLSTIRRSENVIVLGHDGSVVEMGKFKEL 696
              H++S   ++  VI LG DGS  ++G   EL
Sbjct: 750 LATHQISLTEQASRVIYLGTDGS-FDIGTVDEL 781

 Score = 73.6 bits (179), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 40/117 (34%), Positives = 67/117 (57%), Gaps = 6/117 (5%)

Query: 450  RVPSISTTKGVKYKPGNGEIEFKNVSFAY-PTRPSNMIFKNLNFKIEAGSNVCIVGPSGR 508
            R+P ++  K     P  G I F NV+ AY P  P  ++ ++++F I +G  + I G +G 
Sbjct: 1184 RIPEMAPPKA---WPERGAITFDNVALAYRPGLP--LVLQDVSFHISSGEKIGICGRTGA 1238

Query: 509  GKSTVALLLEKYYKPSSGEILIDGQNINDLNSKSLRRHIGLVQQEPILMSGTIRDNI 565
            GKST+   L +  + S+G + IDG +I  +   +LR  + ++ Q+P+L  GTIR N+
Sbjct: 1239 GKSTITNALYRLVELSNGSVTIDGVDIATIGLYNLRSKLSIIPQDPLLFRGTIRKNL 1295

 Score = 65.9 bits (159), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 38/114 (33%), Positives = 66/114 (57%), Gaps = 3/114 (2%)

Query: 599  DTVIGPHGTLLSGGQKQRIAIARALIKKPRILILDEATSALDVESEGAINYTFGQLMKKK 658
            D  +   G+  S G++Q +A+ARAL+++ +ILILDEATS++D E++  I     Q  + +
Sbjct: 1418 DQTVEEDGSNFSVGERQFLALARALVRQTKILILDEATSSVDYETDAQIQARIVQ--EFQ 1475

Query: 659  EMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELWDDPTSELSQLLNEKS 712
              TI+ +AHRL TI   + ++V+   G V E      L+++  S    + ++ S
Sbjct: 1476 HATIMCVAHRLKTILHYDRILVM-EKGRVAEFDTPLRLYNEQGSIFRSMCDQSS 1528

>YPL147W Chr16 (273255..275867) [2613 bp, 870 aa] {ON}  PXA1Subunit
           of a heterodimeric peroxisomal ATP-binding cassette
           transporter complex (Pxa1p-Pxa2p), required for import
           of long-chain fatty acids into peroxisomes; similarity
           to human adrenoleukodystrophy transporter ABCD1 and
           ABCD2 and ALD-related proteins; mutations in ABCD1 cause
           X-linked adrenoleukodystrophy (X-ALD), a peroxisomal
           disorder
          Length = 870

 Score = 78.6 bits (192), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 58/197 (29%), Positives = 100/197 (50%), Gaps = 21/197 (10%)

Query: 496 AGSNVCIVGPSGRGKSTVALLLEKYYKPSSGEILIDGQNINDLNSKSLRRHIGLVQQEPI 555
           +GS++ I+GP+G GKS++  ++ + +            N N L S     +I  + Q+P 
Sbjct: 637 SGSSLLILGPNGCGKSSIQRIIAEIWPV---------YNKNGLLSIPSENNIFFIPQKPY 687

Query: 556 L-MSGTIRDNIVYGLTEMPTKD------EIRQVAKQCFCHNFITR-FQSSYDTVIGPHGT 607
               GT+RD I+Y ++     D      E+ Q+  +      + R    +Y   I     
Sbjct: 688 FSRGGTLRDQIIYPMSSDEFFDRGFRDKELVQILVEVKLDYLLKRGVGLTYLDAIADWKD 747

Query: 608 LLSGGQKQRIAIARALIKKPRILILDEATSALDVESEGAINYTFGQLMKKKEMTIVSIAH 667
           LLSGG+KQR+  AR +  KP  ++LDEAT+A+ V+ E   +Y F  L+K+     +SI+ 
Sbjct: 748 LLSGGEKQRVNFARIMFHKPLYVVLDEATNAISVDME---DYLFN-LLKRYRFNFISISQ 803

Query: 668 RLSTIRRSENVIVLGHD 684
           R + I+  E ++ +G +
Sbjct: 804 RPTLIKYHEMLLEIGEN 820

>Smik_6.344 Chr6 complement(548373..550985) [2613 bp, 870 aa] {ON}
           YPL147W (REAL)
          Length = 870

 Score = 77.4 bits (189), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 57/197 (28%), Positives = 100/197 (50%), Gaps = 21/197 (10%)

Query: 496 AGSNVCIVGPSGRGKSTVALLLEKYYKPSSGEILIDGQNINDLNSKSLRRHIGLVQQEPI 555
           +GS++ I+GP+G GKS++  ++ + +            N N L S     +I  + Q+P 
Sbjct: 637 SGSSLLILGPNGCGKSSIQRIIAEIWPV---------YNKNGLLSIPPENNIFFIPQKPY 687

Query: 556 L-MSGTIRDNIVYGLTEMPTKD------EIRQVAKQCFCHNFITRFQS-SYDTVIGPHGT 607
               GT+RD I+Y ++     D      E+ Q+  +      + R    +Y   +     
Sbjct: 688 FSRGGTLRDQIIYPMSSDEFFDRGFKDKELVQILVEVKLDYLLKRAVGLTYLDAVADWKD 747

Query: 608 LLSGGQKQRIAIARALIKKPRILILDEATSALDVESEGAINYTFGQLMKKKEMTIVSIAH 667
           LLSGG+KQR+  AR +  KP  ++LDEAT+A+ V+ E   +Y F  L+K+     +SI+ 
Sbjct: 748 LLSGGEKQRVNFARIMFHKPLYVVLDEATNAISVDME---DYLFN-LLKRYRFNFISISQ 803

Query: 668 RLSTIRRSENVIVLGHD 684
           R + I+  E ++ +G +
Sbjct: 804 RPTLIKYHEMLLEIGEN 820

>NDAI0E01240 Chr5 (244737..247430) [2694 bp, 897 aa] {ON} Anc_8.661
          Length = 897

 Score = 77.0 bits (188), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 57/186 (30%), Positives = 97/186 (52%), Gaps = 21/186 (11%)

Query: 496 AGSNVCIVGPSGRGKSTVALLLEKYYKPSSGEILIDGQNINDLNSKSLRRHIGLVQQEPI 555
           +GS++ I+GP+  GK+++  ++ + +            N N L S   + +I  + Q P 
Sbjct: 664 SGSSLLILGPNSSGKTSIQRIIAEIWPI---------YNKNGLLSVPSQENIFCIPQRPY 714

Query: 556 LMS-GTIRDNIVYGLT-----EMPTKDEIR-QVAKQCFCHNFITRFQS-SYDTVIGPHGT 607
             S GT+RD I+Y ++     +   KD +  Q+ K+      + R +  +Y   +     
Sbjct: 715 FTSSGTLRDQIIYPMSSDEFFDRGLKDSLLIQILKEVNLKYLMKRSKGLTYLDTVADWKD 774

Query: 608 LLSGGQKQRIAIARALIKKPRILILDEATSALDVESEGAINYTFGQLMKKKEMTIVSIAH 667
           LLSGG+KQRI  AR L  KPR ++LDEAT+A+  + E   +Y F  ++KK     ++I+ 
Sbjct: 775 LLSGGEKQRINFARILFHKPRFIVLDEATNAISQDME---DYLFN-ILKKYRFNFITISQ 830

Query: 668 RLSTIR 673
           R S I+
Sbjct: 831 RPSLIK 836

>Suva_16.163 Chr16 (282462..285074) [2613 bp, 870 aa] {ON} YPL147W
           (REAL)
          Length = 870

 Score = 77.0 bits (188), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 57/197 (28%), Positives = 99/197 (50%), Gaps = 21/197 (10%)

Query: 496 AGSNVCIVGPSGRGKSTVALLLEKYYKPSSGEILIDGQNINDLNSKSLRRHIGLVQQEPI 555
           +GS++ I+GP+G GKS++  ++   +            N N L S     +I  + Q+P 
Sbjct: 637 SGSSLLILGPNGCGKSSIQRIIADVWPV---------YNKNGLLSIPSENNIFCIPQKPY 687

Query: 556 L-MSGTIRDNIVYGLTEMPTKD------EIRQVAKQCFCHNFITR-FQSSYDTVIGPHGT 607
               GT+RD I+Y ++     D      E+ Q+  +      + R    +Y   +     
Sbjct: 688 FSRGGTLRDQIIYPMSSDEFFDRGFKDKELVQILAEVRLDYLLKRGVGLTYLDAVADWKD 747

Query: 608 LLSGGQKQRIAIARALIKKPRILILDEATSALDVESEGAINYTFGQLMKKKEMTIVSIAH 667
           LLSGG+KQR+  AR +  KP  ++LDEAT+A+ V+ E   +Y F  L+K+     +SI+ 
Sbjct: 748 LLSGGEKQRVNFARIMFHKPLYVVLDEATNAISVDME---DYLFN-LLKRYRFNFISISQ 803

Query: 668 RLSTIRRSENVIVLGHD 684
           R + I+  E ++ +G +
Sbjct: 804 RPTLIKYHEMLLEIGEN 820

>ACR128C Chr3 complement(573251..575734) [2484 bp, 827 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL147W
           (PXA1)
          Length = 827

 Score = 76.3 bits (186), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 54/190 (28%), Positives = 100/190 (52%), Gaps = 19/190 (10%)

Query: 497 GSNVCIVGPSGRGKSTVALLLEKYYKPSSGEILIDGQNINDLNSKSLRRHIGLVQQEPIL 556
           GS++ I+GP+  GKS++  +L + +   +   L+     +DL        + + Q+   +
Sbjct: 598 GSSLLILGPNSCGKSSIQRILAEIWPIYNKTGLVSIPAESDL--------MCIAQRPYFI 649

Query: 557 MSGTIRDNIVYGLT-----EMPTKD-EIRQVAKQCFCHNFITRFQS-SYDTVIGPHGTLL 609
             GT RD I+Y ++     E   KD E+ ++ K+      + R +  SY   +     +L
Sbjct: 650 QGGTFRDQIIYPMSVDRFYEKGHKDRELVRILKEVKLDYLLKRSEGLSYLDFVADWKDIL 709

Query: 610 SGGQKQRIAIARALIKKPRILILDEATSALDVESEGAINYTFGQLMKKKEMTIVSIAHRL 669
           SGG+KQR+  AR +  +P+ L+LDEAT+A+ V+ E   +Y F  +++K     +SI+ R 
Sbjct: 710 SGGEKQRMNFARIMFHRPKFLVLDEATNAISVDME---DYLFN-MLRKCRFNFISISQRP 765

Query: 670 STIRRSENVI 679
           S I+  + ++
Sbjct: 766 SLIKYHDYLL 775

>KLTH0D10890g Chr4 complement(891012..893504) [2493 bp, 830 aa] {ON}
           similar to uniprot|P41909 Saccharomyces cerevisiae
           YPL147W PXA1 Pxa1p and Pxa2p appear to be subunits of a
           peroxisomal ATP-binding cassette transporter necessary
           for transport of long-chain fatty acids into peroxisomes
           ABC family long-chain fatty acid transporter
          Length = 830

 Score = 75.5 bits (184), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 55/198 (27%), Positives = 101/198 (51%), Gaps = 21/198 (10%)

Query: 497 GSNVCIVGPSGRGKSTVALLLEKYYKPSSGEILIDGQNINDLNSKSLRRHIGLVQQEPIL 556
           GS++ I+GP+G GK+++  ++ + +            N N L S      +  V Q+P  
Sbjct: 600 GSSMLILGPNGSGKTSIQRIIAEIWPI---------YNKNGLLSIPPASDLFCVPQKPYF 650

Query: 557 MSG-TIRDNIVYGLT-----EMPTKD-EIRQVAKQCFCHNFITRFQS-SYDTVIGPHGTL 608
           + G T R+ I+Y ++     +M  +D E+  +  +      + R +   Y   +     +
Sbjct: 651 IQGGTFREQIIYPMSADQYFDMGYRDKELTHILGEVKLDYLLKRDKGWRYLDAVAEWKDV 710

Query: 609 LSGGQKQRIAIARALIKKPRILILDEATSALDVESEGAINYTFGQLMKKKEMTIVSIAHR 668
           LSGG++QRI  AR +  KPR ++LDEAT+A+  + E   +Y FG L+K+     ++I+ R
Sbjct: 711 LSGGERQRINFARIMFHKPRFVVLDEATNAISADME---DYLFG-LLKRYRFNFITISQR 766

Query: 669 LSTIRRSENVIVLGHDGS 686
            S I+  +  + +  DG+
Sbjct: 767 PSLIKYHDLALDISTDGT 784

>Kwal_26.8730 s26 complement(918498..920993) [2496 bp, 831 aa] {ON}
           YPL147W (PXA1) - ABC family long-chain fatty acid
           transporter [contig 67] FULL
          Length = 831

 Score = 75.1 bits (183), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 53/198 (26%), Positives = 102/198 (51%), Gaps = 21/198 (10%)

Query: 497 GSNVCIVGPSGRGKSTVALLLEKYYKPSSGEILIDGQNINDLNSKSLRRHIGLVQQEPIL 556
           GS++ I+GP+G GK+++  ++ + +            N N L S    R +  + Q+P  
Sbjct: 601 GSSMLILGPNGSGKTSIQRIIAEIWPI---------YNKNGLLSVPAERELICIPQKPYF 651

Query: 557 MSG-TIRDNIVYGLT-----EMPTKD-EIRQVAKQCFCHNFITRFQS-SYDTVIGPHGTL 608
           + G T R+ I+Y ++     ++  +D E+  V K+      + R +   Y   +     +
Sbjct: 652 IQGGTFREQIIYPMSADQYFDLGYRDKELVHVLKEVKLEYLLKRDKGWRYLDAVAEWKDV 711

Query: 609 LSGGQKQRIAIARALIKKPRILILDEATSALDVESEGAINYTFGQLMKKKEMTIVSIAHR 668
           LSGG++QR+  AR +  KP+ ++LDEAT+A+  + E   +Y F  ++K+     ++I+ R
Sbjct: 712 LSGGERQRMNFARIMFHKPKFVVLDEATNAISADME---DYLFN-MLKRYRFNFITISQR 767

Query: 669 LSTIRRSENVIVLGHDGS 686
            S I+  +  + +G D S
Sbjct: 768 PSLIKYHDLALEIGADES 785

>Skud_16.135 Chr16 (244860..247472) [2613 bp, 870 aa] {ON} YPL147W
           (REAL)
          Length = 870

 Score = 75.1 bits (183), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 56/197 (28%), Positives = 99/197 (50%), Gaps = 21/197 (10%)

Query: 496 AGSNVCIVGPSGRGKSTVALLLEKYYKPSSGEILIDGQNINDLNSKSLRRHIGLVQQEPI 555
           +GS++ I+GP+  GKS++  ++ + +            N N L S     +I  + Q+P 
Sbjct: 637 SGSSLLILGPNSCGKSSIQRIIAEIWPV---------YNKNGLLSIPSENNIFCIPQKPY 687

Query: 556 LMSG-TIRDNIVYGLTEMPTKD------EIRQVAKQCFCHNFITR-FQSSYDTVIGPHGT 607
              G T+RD I+Y ++     D      E+ Q+  +      + R    +Y   +     
Sbjct: 688 FSKGGTLRDQIIYPMSSDEFFDRGFKDKELVQILVEVRLDYLLKRGVGLTYLDAVADWKD 747

Query: 608 LLSGGQKQRIAIARALIKKPRILILDEATSALDVESEGAINYTFGQLMKKKEMTIVSIAH 667
           LLSGG+KQR+  AR +  KP  ++LDEAT+A+ V+ E   +Y F  L+K+     +SI+ 
Sbjct: 748 LLSGGEKQRVNFARVMFHKPLYVVLDEATNAISVDME---DYLFN-LLKRYRFNFISISQ 803

Query: 668 RLSTIRRSENVIVLGHD 684
           R + I+  E ++ +G +
Sbjct: 804 RPTLIKYHEMLLEIGEN 820

>ZYRO0F07018g Chr6 complement(571276..573861) [2586 bp, 861 aa] {ON}
           similar to uniprot|P41909 Saccharomyces cerevisiae
           YPL147W PXA1 Pxa1p and Pxa2p appear to be subunits of a
           peroxisomal ATP-binding cassette transporter necessary
           for transport of long-chain fatty acids into peroxisomes
           ABC family long-chain fatty acid transporter
          Length = 861

 Score = 75.1 bits (183), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 69/251 (27%), Positives = 120/251 (47%), Gaps = 31/251 (12%)

Query: 451 VPSISTTKGVKYKPGNGEIEFKNVSFAYPTRPSNMI--FK-----NLNFKIEAGSNVCIV 503
           +PS    +G K     G + F+  S   P+  S+ I  FK     N+      G+++ I+
Sbjct: 581 IPSRRAGRGAKLI---GTLTFQIPSVIEPSSKSSSIQDFKKNFDPNVPLIDSTGASLLIL 637

Query: 504 GPSGRGKSTVALLLEKYYKPSSGEILIDGQNINDLNSKSLRRHIGLVQQEPILM-SGTIR 562
           GP+  GKS++  ++ + +            N N L S     ++  V Q P     GT R
Sbjct: 638 GPNSCGKSSIQRIITEVWPV---------YNKNGLLSIPAPSNLFCVPQRPYFTRGGTFR 688

Query: 563 DNIVYGLT-----EMPTKDE-IRQVAKQCFCHNFITR-FQSSYDTVIGPHGTLLSGGQKQ 615
           D I+Y ++     +   KD+ + ++ K+      + R    SY   +     +LSGG+KQ
Sbjct: 689 DQIIYPMSSDEFFDRGLKDKNLARILKEVHLDYLLDREIGCSYMDAVADWKDVLSGGEKQ 748

Query: 616 RIAIARALIKKPRILILDEATSALDVESEGAINYTFGQLMKKKEMTIVSIAHRLSTIRRS 675
           R+  AR L  +PR ++LDEAT+A+ V+ E   +Y F  L+K+     ++I+ R S I+  
Sbjct: 749 RMNFARILFHRPRFVVLDEATNAISVDME---DYLFN-LLKRYRFNFITISQRPSLIKYH 804

Query: 676 ENVIVLGHDGS 686
           + ++ +   GS
Sbjct: 805 DMLLEVDSSGS 815

>KLLA0F11484g Chr6 (1052991..1055528) [2538 bp, 845 aa] {ON} similar
           to uniprot|P41909 Saccharomyces cerevisiae YPL147W PXA1
           Pxa1p and Pxa2p appear to be subunits of a peroxisomal
           ATP-binding cassette transporter necessary for transport
           of long-chain fatty acids into peroxisomes ABC family
           long-chain fatty acid transporter
          Length = 845

 Score = 74.7 bits (182), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 60/205 (29%), Positives = 103/205 (50%), Gaps = 23/205 (11%)

Query: 497 GSNVCIVGPSGRGKSTVALLLEKYYKPSSGEILIDGQNINDLNSKSLRRHIGLVQQEPIL 556
           GS++ I+GP+  GKS++  +L + +            N N L S      +  V Q P  
Sbjct: 615 GSSLLILGPNSCGKSSIERILTEIWPI---------YNKNGLLSTPPSHDLFCVPQRPYF 665

Query: 557 MSG-TIRDNIVYGLT-----EMPTKDE-IRQVAKQCFCHNFITRFQS-SYDTVIGPHGTL 608
           + G T RD I+Y +T     E   KD  + Q+ ++      + R +  +Y   I     +
Sbjct: 666 IQGGTFRDQIIYPMTYEQFHERGHKDTYLVQILREVRLDYLLKRDRGLNYFDAIADWKDV 725

Query: 609 LSGGQKQRIAIARALIKKPRILILDEATSALDVESEGAINYTFGQLMKKKEMTIVSIAHR 668
           LSGG+KQR+   R +  +PR ++LDEAT+A+ V+ E  + +T   ++K+     +SI+ R
Sbjct: 726 LSGGEKQRMNFTRIMFHRPRFVVLDEATNAISVDMEDHL-FT---MLKRYRFNFISISQR 781

Query: 669 LSTIRRSENVIVL--GHDGSVVEMG 691
            S I+  + ++ L  G D S+  +G
Sbjct: 782 PSLIKYHDYLLELTNGTDWSLQALG 806

>TPHA0D01170 Chr4 complement(245675..248422) [2748 bp, 915 aa] {ON}
           Anc_8.661 YPL147W
          Length = 915

 Score = 73.9 bits (180), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 59/203 (29%), Positives = 99/203 (48%), Gaps = 21/203 (10%)

Query: 490 LNFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPSSGEILIDGQNINDLNSKSLRRHIGL 549
           L F    GS++ I+GP+  GKS++  ++ + +            N N L S      +  
Sbjct: 676 LPFSYGPGSSLLILGPNSCGKSSIQRIIAEIWPI---------YNKNGLMSIPAEDELMC 726

Query: 550 VQQEPILMSG-TIRDNIVYGL-----TEMPTKDEIR-QVAKQCFCHNFITRFQS-SYDTV 601
           + Q P    G T RD I+Y +      +   KD++  Q+         + R +  SY   
Sbjct: 727 IPQRPYFSKGGTFRDQIIYPMGSDEFFDRGLKDKLLVQILADVKLEYLLKRDKGWSYFDA 786

Query: 602 IGPHGTLLSGGQKQRIAIARALIKKPRILILDEATSALDVESEGAINYTFGQLMKKKEMT 661
           +     +LSGG+KQR+  AR L  KPR +ILDEAT+A+ V+ E   +Y F +++KK    
Sbjct: 787 VFDWKDVLSGGEKQRMNFARILFHKPRFVILDEATNAISVDME---DYLF-KMLKKYRFN 842

Query: 662 IVSIAHRLSTIRRSENVIVLGHD 684
            +SI+ R S ++  + ++ +  D
Sbjct: 843 FISISQRPSLVKYHDLLLEISED 865

>Kpol_1012.10 s1012
           complement(20013..20741,21318..21326,21750..21968,
           21970..23580) [2568 bp, 855 aa] {ON}
           complement(20013..20741,21318..21326,21750..21968,
           21970..23580) [2568 nt, 856 aa]
          Length = 855

 Score = 70.1 bits (170), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 48/147 (32%), Positives = 81/147 (55%), Gaps = 14/147 (9%)

Query: 550 VQQEPILM-SGTIRDNIVYGLT-----EMPTKDEIR-QVAKQCFCHNFITRFQS-SYDTV 601
           + Q+P     GT+RD I+Y +T     +   KD++  Q+  +      + R +  SY  V
Sbjct: 667 IPQKPYFARGGTLRDQIIYPMTSDEFFDRGLKDKLLVQILSEVKLEYLLKRAKGWSYLDV 726

Query: 602 IGPHGTLLSGGQKQRIAIARALIKKPRILILDEATSALDVESEGAINYTFGQLMKKKEMT 661
           +     +LSGG+KQR+  AR L  KPR ++LDEAT+A+ V+ E   +Y F  L++K    
Sbjct: 727 VADWKDVLSGGEKQRMNFARILFHKPRFVVLDEATNAISVDME---DYLFN-LLRKYRFN 782

Query: 662 IVSIAHRLSTIRRSENVIVL--GHDGS 686
            +SI+ R S I+  + ++ +   +DG+
Sbjct: 783 FISISQRPSLIKYHDQLLEISESNDGT 809

>Ecym_2410 Chr2 (797543..800029) [2487 bp, 828 aa] {ON} similar to
           Ashbya gossypii ACR128C
          Length = 828

 Score = 70.1 bits (170), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 51/190 (26%), Positives = 99/190 (52%), Gaps = 19/190 (10%)

Query: 497 GSNVCIVGPSGRGKSTVALLLEKYYKPSSGEILIDGQNINDLNSKSLRRHIGLVQQEPIL 556
           GS++ I+GP+  GKS++  ++ + +   +   L+   + +D+        + + Q+   +
Sbjct: 598 GSSLLILGPNSCGKSSIQRIIAEIWPIYNKTGLLSIPSESDM--------MCIAQRPYFI 649

Query: 557 MSGTIRDNIVYGL-----TEMPTKD-EIRQVAKQCFCHNFITRFQS-SYDTVIGPHGTLL 609
             GT RD I+Y +      E   KD E+ +V K+      + R  + +Y   +     +L
Sbjct: 650 QGGTFRDQIIYPMFVDTFYEKGHKDRELVRVLKEVKLDYLLKRADALNYLDHVADWKDVL 709

Query: 610 SGGQKQRIAIARALIKKPRILILDEATSALDVESEGAINYTFGQLMKKKEMTIVSIAHRL 669
           SGG+KQR+  AR +  +P+ ++LDEAT+A+  + E   +Y F  ++KK     +SI+ R 
Sbjct: 710 SGGEKQRMNFARIMFHRPKFIVLDEATNAISADME---DYLFN-MLKKFRFNFISISQRP 765

Query: 670 STIRRSENVI 679
           S I+  + ++
Sbjct: 766 SLIKYHDYLL 775

>TBLA0D04350 Chr4 complement(1076344..1079703) [3360 bp, 1119 aa]
           {ON} Anc_1.427 YCR011C
          Length = 1119

 Score = 69.7 bits (169), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 68/238 (28%), Positives = 118/238 (49%), Gaps = 13/238 (5%)

Query: 469 IEFKNVSFAYPTRPSNM----IFKNLNFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPS 524
           + F+N+S+  P+   N     I KN++  ++ G  + I+G SG GK+T+  +L    K  
Sbjct: 433 LSFENISYNVPSISDNNSERDILKNVSGIVKPGEIMAILGGSGAGKTTLLDILAFKRKSG 492

Query: 525 --SGEILIDGQNINDLNSKSLRRHIGLVQQEPILM-SGTIRDNIV-YGLTEMPTKDEIRQ 580
             SG+I I+G+N++    + + + IG V Q+  L  + T+ + ++   L  +P      Q
Sbjct: 493 HVSGDIKINGKNVS---REIISKMIGFVDQDDFLFPTLTVYEAVLNSALLRLPNSMTFYQ 549

Query: 581 VAKQCFCHNFITRFQSSYDTVIGPHGTL-LSGGQKQRIAIARALIKKPRILILDEATSAL 639
             ++ F      R  +  D +IG      +SGG+K+R++IA  L+  P IL LDE TS L
Sbjct: 550 KQQRVFQVLEELRIYNIKDRLIGDDFERGISGGEKRRVSIACELVTSPLILFLDEPTSGL 609

Query: 640 DVESEGAINYTFGQLMKKKEMTIVSIAHR-LSTIRRSENVIVLGHDGSVVEMGKFKEL 696
           D  +   +     +L K    T+V   H+  S I    + +VL   G +V  G+ + +
Sbjct: 610 DSNNANNVVECLVRLAKNYNRTLVLTIHQPRSNIFHLFSKLVLLSSGEMVYSGEIRRV 667

>SAKL0D10208g Chr4 complement(855378..857636) [2259 bp, 752 aa] {ON}
           highly similar to uniprot|P43535 Saccharomyces
           cerevisiae YFR009W GCN20 Positive regulator of the Gcn2p
           kinase activity forms a complex with Gcn1p proposed to
           stimulate Gcn2p activation by an uncharged tRNA
          Length = 752

 Score = 68.6 bits (166), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 60/236 (25%), Positives = 105/236 (44%), Gaps = 48/236 (20%)

Query: 469 IEFKNVSFAYPTRPSNMIFKNLNFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPSSGEI 528
           I+ ++VSF Y    ++ + K++N  ++  S + +VG +G GK+T+  ++ +  +P+ G +
Sbjct: 532 IQLQDVSFGY--EENSPLLKDVNLDVQMDSRIALVGANGCGKTTLLKVMMEQLRPTKGYV 589

Query: 529 LIDGQNINDLNSKSLRRHIGLVQQEPILMSGTIRDNIVYGLTEMPTKDEIRQVAKQCFCH 588
                      S++ R  IG   Q  +       D++           ++   A      
Sbjct: 590 -----------SRNPRLRIGYFTQHHV-------DSM-----------DLNTSAVDWMSK 620

Query: 589 NFITRFQSSYDTVIGPHG----------TLLSGGQKQRIAIARALIKKPRILILDEATSA 638
            F  +    Y   +G  G           LLSGGQK R+A A   +  P IL+LDE ++ 
Sbjct: 621 TFPGKTDEEYRRHLGAFGITGSLGLQKMQLLSGGQKSRVAFAALCLNNPHILVLDEPSNH 680

Query: 639 LDVESEGAI-----NYTFGQLMKKKEMTIVSIAHRLSTIRRSENVIVLGHDGSVVE 689
           LD     A+     N+T G LM   ++++  I H  S I  SE+  V   DG++ +
Sbjct: 681 LDTAGLDALIDALKNFTGGVLMVSHDISV--IDHVCSEIWVSEDGTVKRFDGTIYD 734

 Score = 42.4 bits (98), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 43/76 (56%), Gaps = 4/76 (5%)

Query: 609 LSGGQKQRIAIARALIKKPRILILDEATSALDVESEGAINYTFGQLMKKKEMTIVSIAHR 668
            SGG + R+++ARAL  +P +L+LDE ++ LDV S   I Y   + +K    T++ ++H 
Sbjct: 368 FSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPS---IAY-LSEYLKTYPATVLVVSHD 423

Query: 669 LSTIRRSENVIVLGHD 684
            + +      I+  H+
Sbjct: 424 RAFLNEVATDIIYQHN 439

>KAFR0C04540 Chr3 complement(907385..909643) [2259 bp, 752 aa] {ON}
           Anc_1.366 YFR009W
          Length = 752

 Score = 68.2 bits (165), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 60/238 (25%), Positives = 103/238 (43%), Gaps = 55/238 (23%)

Query: 469 IEFKNVSFAYPTRPSNMIFKNLNFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPSSGEI 528
           I+ ++VSF Y  +  N++ K++N  ++  S + +VG +G GK+T+  ++ +  +P  G +
Sbjct: 532 IQLQDVSFGYDEK--NLLLKDVNLDVQMDSRIALVGANGCGKTTLLKVMMEQLRPLQGYV 589

Query: 529 LIDGQNINDLNSKSLRRHIGLVQQEPILMSGTIRDNIVYGLTEMPTKDEIRQVAKQCFCH 588
                      S++ R  IG   Q  +       D++           ++   A      
Sbjct: 590 -----------SRNGRLRIGYFTQHHV-------DSM-----------DLTTSAVDWMSK 620

Query: 589 NFITRFQSSYDTVIGPHG----------TLLSGGQKQRIAIARALIKKPRILILDEATSA 638
            F  +    Y   +G  G           LLSGGQK R+A A   +  P ILILDE ++ 
Sbjct: 621 TFPGKNDEEYRRHLGAFGITGSLGLQKMQLLSGGQKSRVAFAALCLNNPHILILDEPSNH 680

Query: 639 LDVESEGAI-----NYTFGQLMKKKEMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMG 691
           LD     A+     N++ G LM         ++H +S I    N I +  +G+V + G
Sbjct: 681 LDTTGLDALIDALKNFSGGVLM---------VSHDISVINSVCNEIWVSEEGTVKKFG 729

 Score = 42.0 bits (97), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 43/76 (56%), Gaps = 4/76 (5%)

Query: 609 LSGGQKQRIAIARALIKKPRILILDEATSALDVESEGAINYTFGQLMKKKEMTIVSIAHR 668
            SGG + R+++ARAL  +P +L+LDE ++ LDV S   I Y   + +K    T++ ++H 
Sbjct: 368 FSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPS---IAY-LSEYLKTYPATLLVVSHD 423

Query: 669 LSTIRRSENVIVLGHD 684
            + +      I+  H+
Sbjct: 424 RAFLNEVATDIIYQHN 439

>KNAG0A02980 Chr1 (363468..366083) [2616 bp, 871 aa] {ON} Anc_8.661
           YPL147W
          Length = 871

 Score = 68.2 bits (165), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 69/260 (26%), Positives = 120/260 (46%), Gaps = 33/260 (12%)

Query: 443 RLFELTDRVPSISTTKGVKY--------KPGNGEIEFKNVSFAYPTRPSNMIFKNLNFKI 494
           RL  +   +PS+    G+K          P   ++  K  S    T  SN+    L F  
Sbjct: 581 RLENIDIMIPSVRGKSGIKLIKKLTFQIPPHLDQLSSKTSSLQDITSMSNI---PLPFLS 637

Query: 495 EAGSNVCIVGPSGRGKSTVALLLEKYYKPSSGEILIDGQNINDLNSKSLRRHIGLVQQEP 554
              S++ I+GP+G GKS++  ++ + +            N N L SK     +  + Q+P
Sbjct: 638 GQASSLLILGPNGCGKSSIQRIIAEIWPI---------YNKNGLLSKPDSSSLLCIPQKP 688

Query: 555 ILM-SGTIRDNIVYGLT-----EMPTKDEIR-QVAKQCFCHNFITRFQS-SYDTVIGPHG 606
                GT RD I+Y ++     +   KD++   +  +      + R    SY   +    
Sbjct: 689 YFTRGGTFRDQIIYPMSSDEFFDNGFKDKVLVWILSEVHLDYLLKRAPGWSYLDEVTEWK 748

Query: 607 TLLSGGQKQRIAIARALIKKPRILILDEATSALDVESEGAINYTFGQLMKKKEMTIVSIA 666
            +LSGG+KQR+  AR L  KP+ ++LDEAT+A+  + E   +Y F  ++KK   + ++I+
Sbjct: 749 DVLSGGEKQRMNFARILFHKPKFIVLDEATNAISADME---DYLFN-MLKKFRFSFITIS 804

Query: 667 HRLSTIRRSENVI-VLGHDG 685
            R S I+  + ++ +   DG
Sbjct: 805 QRPSLIKYHDMLLEIADRDG 824

>SAKL0F01606g Chr6 (133318..135144) [1827 bp, 608 aa] {ON} highly
           similar to uniprot|P40024 Saccharomyces cerevisiae
           YER036C
          Length = 608

 Score = 67.8 bits (164), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 55/220 (25%), Positives = 102/220 (46%), Gaps = 38/220 (17%)

Query: 469 IEFKNVSFAYPTRPSNMIFKNLNFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPSSGEI 528
           + F ++SF+Y   P N +++ LNF ++  S + +VGP+G GKST+  ++     P SG +
Sbjct: 391 LAFDDISFSYDDNPENNLYEKLNFGVDMDSRIALVGPNGVGKSTLLKIMTGQLMPQSGRV 450

Query: 529 LIDGQNINDLNSKSLRRHIGLVQQEPILMSGTIRDNIVYGLTEMP---TKDEIRQVAKQC 585
                      S+     +G+  Q         +D +   LT+ P    +D+   +++  
Sbjct: 451 -----------SRHTHVKLGVYSQHS-------QDQL--DLTKSPLEFVRDKYPNISQDF 490

Query: 586 -FCHNFITRFQSSYDTVIGPHGTLLSGGQKQRIAIARALIKKPRILILDEATSALDVES- 643
            +    + R+  + +      GT LS GQ+ R+  A   +++P +L+LDE T+ LD+ + 
Sbjct: 491 QYWRGQLGRYGLTGEAQTSQMGT-LSEGQRSRVVFALLALEQPNVLLLDEPTNGLDIPTI 549

Query: 644 ---EGAINYTFG---------QLMKKKEMTIVSIAHRLST 671
                AIN   G         +L+ K    I  + H+ +T
Sbjct: 550 DSLADAINEFNGGVVVVSHDFRLLDKIAQDIFVVEHKTAT 589

 Score = 45.4 bits (106), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 39/59 (66%), Gaps = 4/59 (6%)

Query: 609 LSGGQKQRIAIARALIKKPRILILDEATSALDVESEGAINYTFGQLMKKKEMTIVSIAH 667
           +SGG K R+A+A+AL  KP +L+LD+ T+ LD+E+         + +K+ + T+V ++H
Sbjct: 225 MSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEA----CVWLEEYLKRFDRTLVLVSH 279

>NDAI0H03570 Chr8 complement(872905..875172) [2268 bp, 755 aa] {ON}
           Anc_1.366
          Length = 755

 Score = 67.8 bits (164), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 54/204 (26%), Positives = 95/204 (46%), Gaps = 34/204 (16%)

Query: 469 IEFKNVSFAYPTRPSNMIFKNLNFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPSSGEI 528
           I+ ++VSF Y   P +++ K++N  ++  S + +VG +G GK+T+  ++ +  +P+ G +
Sbjct: 535 IQLQDVSFGYD--PESLLLKDVNLDVQMDSRIALVGANGCGKTTLLKVMMEELRPTKGFV 592

Query: 529 LIDGQNINDLNSKSLRRHIGLVQQEPILMSGTIRDNIVYGLTEMPTKDEIRQVAKQCFCH 588
                      S++ R  IG   Q  +      +  + +  T  P K++           
Sbjct: 593 -----------SRNGRLRIGYFTQHHVDSLDLTKSAVDWMSTAYPGKNDEE--------- 632

Query: 589 NFITRFQSSYDTVIGPHG----TLLSGGQKQRIAIARALIKKPRILILDEA-----TSAL 639
               R   S+  + G  G     LLSGGQK R+A A   +  P IL+LDE      TS L
Sbjct: 633 --YRRHLGSF-GITGSLGLQRMQLLSGGQKSRVAFAALCLNNPHILVLDEPSNHLDTSGL 689

Query: 640 DVESEGAINYTFGQLMKKKEMTIV 663
           D   +   N++ G LM   +++I+
Sbjct: 690 DALEDSLKNFSGGVLMVSHDISII 713

 Score = 43.9 bits (102), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 44/76 (57%), Gaps = 4/76 (5%)

Query: 609 LSGGQKQRIAIARALIKKPRILILDEATSALDVESEGAINYTFGQLMKKKEMTIVSIAHR 668
            SGG + R+++ARAL  +P +L+LDE ++ LDV S   I Y   + +K    T+++++H 
Sbjct: 371 FSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPS---IAY-LAEYLKTYPATVLTVSHD 426

Query: 669 LSTIRRSENVIVLGHD 684
            + +      I+  H+
Sbjct: 427 RAFLNEVATDIIYQHN 442

>SAKL0H06908g Chr8 (605838..608348) [2511 bp, 836 aa] {ON} similar
           to uniprot|P41909 Saccharomyces cerevisiae YPL147W PXA1
           Pxa1p and Pxa2p appear to be subunits of a peroxisomal
           ATP-binding cassette transporter necessary for transport
           of long-chain fatty acids into peroxisomes ABC family
           long-chain fatty acid transporter
          Length = 836

 Score = 67.8 bits (164), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 50/185 (27%), Positives = 95/185 (51%), Gaps = 21/185 (11%)

Query: 497 GSNVCIVGPSGRGKSTVALLLEKYYKPSSGEILIDGQNINDLNSKSLRRHIGLVQQEP-I 555
           GS++ I+GP+  GKS++  ++ + +            N N L S     ++  + Q+P  
Sbjct: 606 GSSLLILGPNSCGKSSIQRIIAEIWPI---------YNKNGLLSIPTSVNLFCIPQKPYF 656

Query: 556 LMSGTIRDNIVYGLT-----EMPTKD-EIRQVAKQCFCHNFITRFQS-SYDTVIGPHGTL 608
           L  GT+RD I+Y ++     +   KD ++ Q  ++      + R +   Y   +     +
Sbjct: 657 LQGGTLRDQIIYPMSTDEFFDRGHKDKDLVQALQEVKLEYLLKRDRGWKYLDAVADWKDV 716

Query: 609 LSGGQKQRIAIARALIKKPRILILDEATSALDVESEGAINYTFGQLMKKKEMTIVSIAHR 668
           LSGG++QR+  AR +  +PR ++LDEAT+A+  + E   +Y F  ++K+     ++I+ R
Sbjct: 717 LSGGERQRMNFARIMFHRPRFVVLDEATNAISADME---DYLFN-MLKRYRFNFITISQR 772

Query: 669 LSTIR 673
            S I+
Sbjct: 773 PSLIK 777

>TDEL0A06070 Chr1 complement(1064071..1066689) [2619 bp, 872 aa]
           {ON} Anc_8.661 YPL147W
          Length = 872

 Score = 67.4 bits (163), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 52/185 (28%), Positives = 94/185 (50%), Gaps = 21/185 (11%)

Query: 497 GSNVCIVGPSGRGKSTVALLLEKYYKPSSGEILIDGQNINDLNSKSLRRHIGLVQQEPIL 556
           G+++ I+GP+  GKS++  ++ + +            N N L S     ++  V Q+P  
Sbjct: 640 GASLLILGPNSCGKSSIQRIIAEIWPV---------YNKNGLLSIPSEGNLFCVPQKPYF 690

Query: 557 M-SGTIRDNIVYGLT-----EMPTKDE-IRQVAKQCFCHNFITRFQS-SYDTVIGPHGTL 608
              GT+RD I+Y ++     +   KD+ + Q+  +      + R +  +Y   +     +
Sbjct: 691 TRGGTLRDQIIYPMSSDEFFDRGFKDKHLVQILGEVRLEYLLKRKKGWTYLDAVADWKDV 750

Query: 609 LSGGQKQRIAIARALIKKPRILILDEATSALDVESEGAINYTFGQLMKKKEMTIVSIAHR 668
           LSGG+KQR+  AR +  KPR ++LDE T+A+  + E   +Y F  L+K+     +SI+ R
Sbjct: 751 LSGGEKQRMNFARIMFHKPRFVVLDEGTNAISADME---DYLF-NLLKRYRFNFISISQR 806

Query: 669 LSTIR 673
            S I+
Sbjct: 807 PSLIK 811

>SAKL0H21010g Chr8 (1835185..1839528) [4344 bp, 1447 aa] {ON} similar
            to uniprot|P32568 Saccharomyces cerevisiae YDR011W SNQ2
            ABC transporter
          Length = 1447

 Score = 67.8 bits (164), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 57/198 (28%), Positives = 102/198 (51%), Gaps = 13/198 (6%)

Query: 502  IVGPSGRGKSTVALLLEK---YYKPSSGEILIDGQNINDLNSKSLRRHIGLVQQEPI-LM 557
            ++G SG GK+T+  +L +   +   SSGEIL+D + ++    +  +R +G VQQ+ I   
Sbjct: 835  LMGASGAGKTTLLNVLAQRMDFGIVSSGEILVDAKPVD----RKFKRSVGYVQQQDIHTQ 890

Query: 558  SGTIRDNIVYGLTEMPTKDEIRQVAKQCFCHNFITRF--QSSYDTVIGPHGTLLSGGQKQ 615
              T+R+++ +    +   D +    K  +    I     Q   D V+G  G  L+  Q++
Sbjct: 891  ELTVRESLQFS-ARLRRPDSVPDAEKMEYVEKIIVVLGMQDYSDAVVGEAGFGLNVEQRK 949

Query: 616  RIAIARALIKKPRILI-LDEATSALDVESEGAINYTFGQLMKKKEMTIVSIAHRLSTIRR 674
            +++I   L+ KP +L+ LDE TS LD +S  AI     +L +  +  + +I    +T+  
Sbjct: 950  KLSIGVELVAKPTLLLFLDEPTSGLDSQSSWAILQLLRRLAEAGQAILCTIHQPSATLFE 1009

Query: 675  S-ENVIVLGHDGSVVEMG 691
            S + +++L   GSVV  G
Sbjct: 1010 SFDRLLLLKDGGSVVYWG 1027

>KNAG0C01960 Chr3 complement(380896..383154) [2259 bp, 752 aa] {ON}
           Anc_1.366 YFR009W
          Length = 752

 Score = 67.4 bits (163), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 57/233 (24%), Positives = 104/233 (44%), Gaps = 45/233 (19%)

Query: 469 IEFKNVSFAYPTRPSNMIFKNLNFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPSSGEI 528
           I+ ++VSF Y  +  +++ K++N  ++  S + +VG +G GK+T+  ++ +  +P+SG +
Sbjct: 532 IQLQDVSFGYEEQ--SLLLKDVNLDVQMDSRIALVGANGCGKTTLLKVMMEQLRPTSGYV 589

Query: 529 LIDGQNINDLNSKSLRRHIGLVQQEPILMSGTIRDNIVYGLTEMPTKDEIRQVAKQCFCH 588
                      S++ R  IG   Q  +       D++           ++   A      
Sbjct: 590 -----------SRNGRLRIGYFTQHHV-------DSM-----------DLNTSAVDWMSK 620

Query: 589 NFITRFQSSYDTVIGPHG----------TLLSGGQKQRIAIARALIKKPRILILDEATSA 638
            +  +    Y   +G  G           LLSGGQK R+A A   +  P IL+LDE ++ 
Sbjct: 621 TYPGKTDEEYRRHLGAFGITGTLGLQQMQLLSGGQKSRVAFAALCLNNPHILVLDEPSNH 680

Query: 639 LDVESEGAINYTFGQLMKKKEMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMG 691
           LD     A+       +KK    ++ ++H +S I    N I +  DG+V + G
Sbjct: 681 LDTTGLEAL----VDALKKFTGGVLMVSHDISVIDSVCNEIWVSEDGNVKKFG 729

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 44/76 (57%), Gaps = 4/76 (5%)

Query: 609 LSGGQKQRIAIARALIKKPRILILDEATSALDVESEGAINYTFGQLMKKKEMTIVSIAHR 668
            SGG + R+++ARAL  +P +L+LDE ++ LDV S   I Y   + +K    T+++++H 
Sbjct: 368 FSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPS---IAY-LAEYLKTYPSTVLTVSHD 423

Query: 669 LSTIRRSENVIVLGHD 684
            + +      I+  H+
Sbjct: 424 RAFLNEVATDIIYQHN 439

>CAGL0K10472g Chr11 (1020845..1023103) [2259 bp, 752 aa] {ON} highly
           similar to uniprot|P43535 Saccharomyces cerevisiae
           YFR009w GCN20 positive effector of GCN2P
          Length = 752

 Score = 67.4 bits (163), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 55/211 (26%), Positives = 94/211 (44%), Gaps = 46/211 (21%)

Query: 469 IEFKNVSFAYPTRPSNMIFKNLNFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPSSGEI 528
           I+ ++VSF Y   P  ++ K++N  I+  S + +VG +G GK+T+  ++ +  +P SG +
Sbjct: 532 IQLQDVSFGYS--PDKLLLKDVNLDIQMDSRIALVGANGCGKTTLLKVMLEQLRPLSGYV 589

Query: 529 LIDGQNINDLNSKSLRRHIGLVQQEPILMSGTIRDNIVYGLTEMPTKDEIRQVAKQCFCH 588
                      S++ R  IG   Q  +       D++           ++   A      
Sbjct: 590 -----------SRNPRLRIGYFTQHHV-------DSM-----------DLSTSAVDWMSK 620

Query: 589 NFITRFQSSYDTVIGPHG----------TLLSGGQKQRIAIARALIKKPRILILDEATSA 638
            F  +    Y   +G  G           LLSGGQK R+A A   +  P ILILDE ++ 
Sbjct: 621 TFPGKTDEEYRRHLGSFGITGTLGLQKMQLLSGGQKSRVAFAALCLNNPHILILDEPSNH 680

Query: 639 LDVESEGAI-----NYTFGQLMKKKEMTIVS 664
           LD     A+     N+T G LM   ++++++
Sbjct: 681 LDTTGIDALVDAMKNFTGGILMVSHDISVIN 711

 Score = 43.9 bits (102), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 44/76 (57%), Gaps = 4/76 (5%)

Query: 609 LSGGQKQRIAIARALIKKPRILILDEATSALDVESEGAINYTFGQLMKKKEMTIVSIAHR 668
            SGG + R+++ARAL  +P +L+LDE ++ LDV S   I Y   + +K    T+++++H 
Sbjct: 368 FSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPS---IAY-LAEYLKSYPSTVLTVSHD 423

Query: 669 LSTIRRSENVIVLGHD 684
            + +      I+  H+
Sbjct: 424 RAFLNEVATDIIYQHN 439

>AEL032W Chr5 (572196..574457) [2262 bp, 753 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YFR009W (GCN20)
          Length = 753

 Score = 67.4 bits (163), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 60/240 (25%), Positives = 105/240 (43%), Gaps = 48/240 (20%)

Query: 469 IEFKNVSFAYPTRPSNMIFKNLNFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPSSGEI 528
           I+ ++VSF Y    S ++ K++N  ++  S + +VG +G GK+T+  ++ +  +P +G +
Sbjct: 533 IQLQDVSFGYD--ESQLLLKDVNLDVQMDSRIALVGANGCGKTTLLKVMMEQLRPITGHV 590

Query: 529 LIDGQNINDLNSKSLRRHIGLVQQEPILMSGTIRDNIVYGLTEMPTKDEIRQVAKQCFCH 588
                      S++ R  IG   Q  I       D++           ++   A      
Sbjct: 591 -----------SRNPRLRIGYFTQHHI-------DSM-----------DLNASAVDWMSK 621

Query: 589 NFITRFQSSYDTVIGPHG----------TLLSGGQKQRIAIARALIKKPRILILDEATSA 638
            F  +    Y   +G  G           LLSGGQK R+A A   +  P ILILDE ++ 
Sbjct: 622 TFPGKTDEEYRRHLGAFGITGSLGLQKMQLLSGGQKSRVAFAALCLNSPHILILDEPSNH 681

Query: 639 LDVESEGAI-----NYTFGQLMKKKEMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKF 693
           LD     A+     N++ G LM   +++++        I  SE+  V   DG++ +  K+
Sbjct: 682 LDTAGLDALVQALKNFSGGVLMVSHDISVIDSV--CDEIWVSESGTVKRFDGNIHDYKKY 739

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/76 (32%), Positives = 43/76 (56%), Gaps = 4/76 (5%)

Query: 609 LSGGQKQRIAIARALIKKPRILILDEATSALDVESEGAINYTFGQLMKKKEMTIVSIAHR 668
            SGG + R+++ARAL  +P +L+LDE ++ LDV S   I Y   + +K    T++ ++H 
Sbjct: 369 FSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPS---IAY-LAEYLKTYPATVLVVSHD 424

Query: 669 LSTIRRSENVIVLGHD 684
            S +      I+  H+
Sbjct: 425 RSFLNEVATDIIYQHN 440

>NCAS0B01530 Chr2 complement(249743..252349) [2607 bp, 868 aa] {ON}
           Anc_8.661
          Length = 868

 Score = 67.0 bits (162), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 52/197 (26%), Positives = 97/197 (49%), Gaps = 21/197 (10%)

Query: 497 GSNVCIVGPSGRGKSTVALLLEKYYKPSSGEILIDGQNINDLNSKSLRRHIGLVQQEPIL 556
           GS++ I+GP+  GK+++  ++ + +            N N L S     ++  V Q+P  
Sbjct: 637 GSSLLILGPNSCGKTSIQRIIAEIWPI---------YNKNGLLSIPAEDNLFCVPQKPYF 687

Query: 557 M-SGTIRDNIVYGLTEMPTKD------EIRQVAKQCFCHNFITRFQS-SYDTVIGPHGTL 608
              GT+RD I+Y ++     D      ++ Q+  +      + R    SY   +     +
Sbjct: 688 TRGGTLRDQIIYPMSSDEFYDRGIKDAQLVQIMAEVHLDYLLKRGTGFSYLDNVADWKDV 747

Query: 609 LSGGQKQRIAIARALIKKPRILILDEATSALDVESEGAINYTFGQLMKKKEMTIVSIAHR 668
           LSGG+KQR+  AR L  KPR ++LDEAT+A+  + E   ++ F  ++KK     ++I+ R
Sbjct: 748 LSGGEKQRMNFARILFHKPRFVVLDEATNAISADME---DHLFN-ILKKYRFNFITISQR 803

Query: 669 LSTIRRSENVIVLGHDG 685
            + I   + ++ +  +G
Sbjct: 804 PALIEYHDLLLEILEEG 820

>ZYRO0G01144g Chr7 (89341..91599) [2259 bp, 752 aa] {ON} highly
           similar to uniprot|P43535 Saccharomyces cerevisiae
           YFR009W GCN20 Positive regulator of the Gcn2p kinase
           activity forms a complex with Gcn1p proposed to
           stimulate Gcn2p activation by an uncharged tRNA
          Length = 752

 Score = 66.6 bits (161), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 59/234 (25%), Positives = 99/234 (42%), Gaps = 55/234 (23%)

Query: 469 IEFKNVSFAYPTRPSNMIFKNLNFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPSSGEI 528
           I+ ++V+F Y    +N++ K++N  ++  S + +VG +G GK+T+  ++ +   P  G +
Sbjct: 532 IQLQDVTFGY--NENNLLLKDVNLDVQLNSRIALVGANGCGKTTLLKIMMETLTPLKGYV 589

Query: 529 LIDGQNINDLNSKSLRRHIGLVQQEPILMSGTIRDNIVYGLTEMPTKDEIRQVAKQCFCH 588
                      S++ R  +G   Q  +       D +           ++   A +    
Sbjct: 590 -----------SRNPRLRLGYFAQHHV-------DAM-----------DLNASAVEWMSK 620

Query: 589 NFITRFQSSYDTVIGPHG----------TLLSGGQKQRIAIARALIKKPRILILDEATSA 638
            F  R    Y   +G  G           LLSGGQK R+A A   +  P +LILDE ++ 
Sbjct: 621 TFPGRSDEEYRRHLGSFGITGSLGLQRMELLSGGQKSRVAFAALCLNNPHVLILDEPSNH 680

Query: 639 LDVESEGAI-----NYTFGQLMKKKEMTIVSIAHRLSTIRRSENVIVLGHDGSV 687
           LD     A+     N+T G LM         ++H +S I    N I +  DGS 
Sbjct: 681 LDTSGIDALVDALKNFTGGVLM---------VSHDISVINSVCNEIWVSEDGSA 725

 Score = 42.7 bits (99), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 25/76 (32%), Positives = 43/76 (56%), Gaps = 4/76 (5%)

Query: 609 LSGGQKQRIAIARALIKKPRILILDEATSALDVESEGAINYTFGQLMKKKEMTIVSIAHR 668
            SGG + R+++ARAL  +P +L+LDE ++ LDV S   I Y   + +K    TI+ ++H 
Sbjct: 368 FSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPS---IAY-LSEYLKSYPSTILVVSHD 423

Query: 669 LSTIRRSENVIVLGHD 684
            + +      I+  H+
Sbjct: 424 RAFLNEVATDIIYQHN 439

>TBLA0C01220 Chr3 complement(263093..265348) [2256 bp, 751 aa] {ON}
           Anc_1.366 YFR009W
          Length = 751

 Score = 66.2 bits (160), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 61/236 (25%), Positives = 106/236 (44%), Gaps = 40/236 (16%)

Query: 469 IEFKNVSFAYPTRPSNMIFKNLNFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPSSGEI 528
           I+ ++VSF Y  +  N++ K++N  ++  S + +VG +G GK+T+  ++    KP  G +
Sbjct: 531 IQLQDVSFGYDEK--NLLLKDVNLDVQMDSRIALVGANGCGKTTLLKVMMNQLKPLKGYV 588

Query: 529 LIDGQNINDLNSKSLRRHIGLVQQEPILMSGTIRDNIVYGLTEMP--TKDEIRQVAKQCF 586
             +G           R  IG   Q  +      +  + +   + P  T +E R       
Sbjct: 589 SSNG-----------RLRIGYFTQHHVDSMDLTKSAVDWMSVKYPGKTDEEYR------- 630

Query: 587 CHNFITRFQSSYDTVIGPHG----TLLSGGQKQRIAIARALIKKPRILILDEATSALDVE 642
                 R   S+  + G  G     LLSGGQK R+A A   +  P IL+LDE ++ LD  
Sbjct: 631 ------RHLGSF-GITGTLGLQKMQLLSGGQKSRVAFAALCLNNPHILVLDEPSNHLDNT 683

Query: 643 SEGAI-----NYTFGQLMKKKEMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKF 693
              A+     N++ G LM   +++++    +   I  SEN  V   DG++ +   +
Sbjct: 684 GLDALVESLKNFSGGVLMVSHDISVIDSVCK--EIWVSENGTVRRFDGTIHDYKDY 737

 Score = 41.6 bits (96), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 43/76 (56%), Gaps = 4/76 (5%)

Query: 609 LSGGQKQRIAIARALIKKPRILILDEATSALDVESEGAINYTFGQLMKKKEMTIVSIAHR 668
            SGG + R+++ARAL  +P +L+LDE ++ LDV S   I Y   + +K    T++ ++H 
Sbjct: 367 FSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPS---IAY-LSEYLKTYPSTLLVVSHD 422

Query: 669 LSTIRRSENVIVLGHD 684
            + +      I+  H+
Sbjct: 423 RAFLNEVATDIIYQHN 438

>ZYRO0D11880g Chr4 (1003647..1008143) [4497 bp, 1498 aa] {ON} similar
            to uniprot|Q04182 Saccharomyces cerevisiae YDR406W PDR15
            ATP binding cassette (ABC) transporter of the plasma
            membrane general stress response factor implicated in
            cellular detoxification target of Pdr1p Pdr3p and Pdr8p
            transcription regulators promoter contains a PDR
            responsive element
          Length = 1498

 Score = 66.6 bits (161), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 58/222 (26%), Positives = 110/222 (49%), Gaps = 18/222 (8%)

Query: 481  RPSNMIFKNLNFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPS--SGEILIDGQNINDL 538
            R S  I  N++  ++ G+   ++G SG GK+T+   L +       +G I +DG+    L
Sbjct: 866  RESKRILNNIDGWVKPGTLTALMGASGAGKTTLLDCLAERVTTGVITGGIFVDGK----L 921

Query: 539  NSKSLRRHIGLVQQEPI-LMSGTIRDNIVY-GLTEMPTK---DEIRQVAKQCFCHNFITR 593
              +S  R IG  QQ+ + L + T+R+++++  +   P      E R+  ++      +  
Sbjct: 922  RDESFPRSIGYCQQQDLHLKTATVRESLLFSAMLRQPKSVPASEKRKYVEEVIN---VLE 978

Query: 594  FQSSYDTVIGPHGTLLSGGQKQRIAIARALIKKPRILI-LDEATSALDVESEGAINYTFG 652
             +   D ++G  G  L+  Q++R+ I   L+ KP++LI LDE TS LD ++  +I     
Sbjct: 979  MEPYADAIVGVAGEGLNVEQRKRLTIGVELVAKPKLLIFLDEPTSGLDSQTAWSICQLIR 1038

Query: 653  QLMKKKEMTIVSIAHRLST--IRRSENVIVLGHDGSVVEMGK 692
            +L  + +  + +I H+ S   I+  + ++ L   G  V  G+
Sbjct: 1039 KLANRGQAILCTI-HQPSAVLIQEFDRLLFLQKGGETVYFGE 1079

>KLTH0H13442g Chr8 complement(1175860..1178118) [2259 bp, 752 aa]
           {ON} highly similar to uniprot|P43535 Saccharomyces
           cerevisiae YFR009W GCN20 Positive regulator of the Gcn2p
           kinase activity forms a complex with Gcn1p proposed to
           stimulate Gcn2p activation by an uncharged tRNA
          Length = 752

 Score = 66.2 bits (160), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 57/229 (24%), Positives = 100/229 (43%), Gaps = 45/229 (19%)

Query: 469 IEFKNVSFAYPTRPSNMIFKNLNFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPSSGEI 528
           I+ ++VSF +   PS ++ K++N  ++  S + IVG +G GK+T+  +L +  +P  G +
Sbjct: 532 IQLQDVSFGFD--PSQLLLKDVNLDVQMDSRIAIVGANGCGKTTLLKILMEQLRPLQGYV 589

Query: 529 LIDGQNINDLNSKSLRRHIGLVQQEPILMSGTIRDNIVYGLTEMPTKDEIRQVAKQCFCH 588
                      S++ R  +    Q  +       D++           ++   A     +
Sbjct: 590 -----------SRNPRLRVAYFTQHHV-------DSM-----------DLNASAVDWMSN 620

Query: 589 NFITRFQSSYDTVIGPHG----------TLLSGGQKQRIAIARALIKKPRILILDEATSA 638
            F  R    Y   +G  G           LLSGGQK R+A A   +  P IL+LDE ++ 
Sbjct: 621 TFPGRTDEEYRRHLGAFGITGSLGLQRMQLLSGGQKSRVAFAALCLNNPHILVLDEPSNH 680

Query: 639 LDVESEGAINYTFGQLMKKKEMTIVSIAHRLSTIRRSENVIVLGHDGSV 687
           LD     A+       +KK    ++ ++H +S I    N I +  +G+V
Sbjct: 681 LDTAGLDAL----MDALKKFTGGVLMVSHDISVIDGVCNEIWVSENGTV 725

 Score = 43.9 bits (102), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/76 (32%), Positives = 43/76 (56%), Gaps = 4/76 (5%)

Query: 609 LSGGQKQRIAIARALIKKPRILILDEATSALDVESEGAINYTFGQLMKKKEMTIVSIAHR 668
            SGG + R+++ARAL  +P +L+LDE ++ LDV S   I Y   + +K    T+V ++H 
Sbjct: 368 FSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPS---IAY-LSEYLKTYPATVVVVSHD 423

Query: 669 LSTIRRSENVIVLGHD 684
            + +      I+  H+
Sbjct: 424 RAFLNEVATDIIYQHN 439

>TBLA0C01780 Chr3 complement(421045..423711) [2667 bp, 888 aa] {ON}
           Anc_8.661 YPL147W
          Length = 888

 Score = 66.2 bits (160), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 53/197 (26%), Positives = 98/197 (49%), Gaps = 21/197 (10%)

Query: 498 SNVCIVGPSGRGKSTVALLLEKYYKPSSGEILIDGQNINDLNSKSLRRHIGLVQQEP-IL 556
           S++ I+G +  GK+++  ++ K +   +   L+         S     ++  + Q+P  L
Sbjct: 648 SSLLILGSNSCGKTSIQRIIAKLWPIYNKSGLL---------SIPTDDNLLFIPQKPYFL 698

Query: 557 MSGTIRDNIVYGLT-----EMPTKDEIR-QVAKQCFCHNFITRFQSS-YDTVIGPHGTLL 609
             GT+RD I+Y ++     ++   D++   +         I R Q   Y   I     LL
Sbjct: 699 KGGTLRDQIIYPMSPDEFFDIGLNDKLLIDILTDVKLDYLIKRDQGWMYLDHIAEWKDLL 758

Query: 610 SGGQKQRIAIARALIKKPRILILDEATSALDVESEGAINYTFGQLMKKKEMTIVSIAHRL 669
           SGG+KQR+  AR L  +P+ +ILDEAT+A+ ++ E   +Y F  L+K+     V+I+ R 
Sbjct: 759 SGGEKQRMNFARILFHRPKFIILDEATNAISIDME---DYLFN-LLKRYRFNFVTISQRP 814

Query: 670 STIRRSENVIVLGHDGS 686
           S I+  + ++ + H  +
Sbjct: 815 SLIKYHDLLLEINHSSN 831

>Kwal_27.9666 s27 complement(9636..14060) [4425 bp, 1474 aa] {ON}
            YOR153W (PDR5) - multidrug resistance transporter [contig
            336] FULL
          Length = 1474

 Score = 66.2 bits (160), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 74/290 (25%), Positives = 133/290 (45%), Gaps = 38/290 (13%)

Query: 429  TFYSEIMQGAGAAS----RLFELTDRV-PSISTTKGVKYKPGNGEIEFKNVSFAYPTRP- 482
            T  +++   AGA S    RLF+ T  V  SIS    V+         +K++ +  P +  
Sbjct: 782  TVLNDVENDAGAQSATEKRLFDDTTEVGSSISVLGNVQLSKSEAIFHWKSLCYDVPIKGG 841

Query: 483  SNMIFKNLNFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPS--SGEILIDGQNINDLNS 540
            +  I  +++  ++ G+   ++G SG GK+T+   L         +G+ILI+G        
Sbjct: 842  TRRILDHVDGWVKPGTLTALMGASGAGKTTLLDCLASRVTTGVVTGDILINGNK----RD 897

Query: 541  KSLRRHIGLVQQEPI-LMSGTIRDNIVYGL-----TEMPTKDE---IRQVAKQCFCHNFI 591
             S  R IG  QQ+ + L + T+R+++ +         +P+ ++   + +V K       I
Sbjct: 898  ASFARSIGYCQQQDLHLQTATVRESLRFAAHLRQPQSVPSSEKDKYVDEVIK-------I 950

Query: 592  TRFQSSYDTVIGPHGTLLSGGQKQRIAIARALIKKPRILI-LDEATSALDVESEGAINYT 650
               +   D V+G  G  L+  Q++R+ I   L  +P++L+ LDE TS LD ++  +I   
Sbjct: 951  LEMEKYADAVVGVAGEGLNVEQRKRLTIGVELAARPKLLLFLDEPTSGLDSQTAWSI--- 1007

Query: 651  FGQLMKK---KEMTIVSIAHRLSTIRRSE--NVIVLGHDGSVVEMGKFKE 695
              QLM+K       I+   H+ S +   E   ++ L   G  V  G+  +
Sbjct: 1008 -CQLMRKLANHGQAILCTIHQPSALLMQEFDRLLFLQRGGQTVYFGELGD 1056

>Kpol_1043.43 s1043 complement(86642..88900) [2259 bp, 752 aa] {ON}
           complement(86642..88900) [2259 nt, 753 aa]
          Length = 752

 Score = 65.5 bits (158), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 58/229 (25%), Positives = 97/229 (42%), Gaps = 45/229 (19%)

Query: 469 IEFKNVSFAYPTRPSNMIFKNLNFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPSSGEI 528
           I+ ++VSF Y  +  N++  ++N  ++  S + +VG +G GK+T+  ++ +  +P  G +
Sbjct: 532 IQLQDVSFGYNEK--NLLLADVNLDVQMDSRIALVGANGCGKTTLLKVMMEQLRPLKGYV 589

Query: 529 LIDGQNINDLNSKSLRRHIGLVQQEPILMSGTIRDNIVYGLTEMPTKDEIRQVAKQCFCH 588
             +G           R  IG   Q  +      +  + +  T  P K +           
Sbjct: 590 SQNG-----------RLRIGYFTQHHVDSLDLTKSAVDWMSTAYPGKTD----------- 627

Query: 589 NFITRFQSSYDTVIGPHG----------TLLSGGQKQRIAIARALIKKPRILILDEATSA 638
                    Y   +G  G           LLSGGQK R+A A   +  P ILILDE ++ 
Sbjct: 628 -------EEYRRHLGAFGITGSLSLQKMQLLSGGQKSRVAFAALCLNNPHILILDEPSNH 680

Query: 639 LDVESEGAINYTFGQLMKKKEMTIVSIAHRLSTIRRSENVIVLGHDGSV 687
           LD     A+       MKK    I+ ++H +S I    N I +  +G+V
Sbjct: 681 LDTSGIDAL----VDAMKKFTGGILMVSHDISVISNVCNEIWVSENGTV 725

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 25/76 (32%), Positives = 44/76 (57%), Gaps = 4/76 (5%)

Query: 609 LSGGQKQRIAIARALIKKPRILILDEATSALDVESEGAINYTFGQLMKKKEMTIVSIAHR 668
            SGG + R+++ARAL  +P +L+LDE T+ LDV S   I Y   + +K    T+++++H 
Sbjct: 368 FSGGWRMRLSLARALFCQPDLLLLDEPTNMLDVPS---IAY-LSEYLKTYPSTVLTVSHD 423

Query: 669 LSTIRRSENVIVLGHD 684
            + +      I+  H+
Sbjct: 424 RAFLNEVATDIIYQHN 439

>KNAG0B03870 Chr2 complement(741637..746178) [4542 bp, 1513 aa] {ON}
            Anc_5.500 YDR406W
          Length = 1513

 Score = 65.5 bits (158), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 58/218 (26%), Positives = 104/218 (47%), Gaps = 14/218 (6%)

Query: 486  IFKNLNFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPS--SGEILIDGQNINDLNSKSL 543
            I  N++  ++ G+   ++G SG GK+T+   L +       +G+I +DG   N+    S 
Sbjct: 887  ILNNVDGWVKPGTLTALMGSSGAGKTTLLDCLAERVTMGVITGDIFVDGLPRNE----SF 942

Query: 544  RRHIGLVQQEPI-LMSGTIRDNIVYGLTEMPTKDEIRQVAKQCFCHNFIT--RFQSSYDT 600
             R IG  QQ+ + L + T+R+++ +    +    E+    K  +    I     +   D 
Sbjct: 943  PRSIGYCQQQDLHLKTSTVRESLRFS-AYLRQPKEVSVEEKNAYVEEIIKILEMEKYADA 1001

Query: 601  VIGPHGTLLSGGQKQRIAIARALIKKPRILI-LDEATSALDVESEGAINYTFGQLMKKKE 659
            ++G  G  L+  Q++R+ I   L  KP++L+ LDE TS LD ++  AI     +L K  +
Sbjct: 1002 IVGVAGEGLNVEQRKRLTIGVELAAKPKLLVFLDEPTSGLDSQTAWAICQLMKKLCKHGQ 1061

Query: 660  MTIVSIAHRLSTIRRSE--NVIVLGHDGSVVEMGKFKE 695
              + +I H+ S I   E   ++ +   G  V  G+  E
Sbjct: 1062 AILCTI-HQPSAILMQEFDRLLFMQKGGKTVYFGELGE 1098

>ZYRO0E08800g Chr5 complement(702554..704386) [1833 bp, 610 aa] {ON}
           highly similar to uniprot|P40024 Saccharomyces
           cerevisiae YER036C
          Length = 610

 Score = 65.1 bits (157), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 52/217 (23%), Positives = 97/217 (44%), Gaps = 39/217 (17%)

Query: 469 IEFKNVSFAYPTRPSNMIFKNLNFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPSSGEI 528
           + F  +SFAY   P + +++NLNF ++  S + +VGP+G GKST+  ++     P +G +
Sbjct: 393 LAFDEISFAYDGNPEHNLYENLNFGVDMDSRIALVGPNGVGKSTLLKIMTGDLTPQAGRV 452

Query: 529 LIDGQNINDLNSKSLRRHIGLVQQEPILMSGTIRDNIVYGLTEMPTKDEIRQVAKQC-FC 587
                      S+     +G+  Q         +  + +       +++   +++   + 
Sbjct: 453 -----------SRHTHVKLGVYSQHSQDQLDLTKSALEF------VREKYSHISQDFQYW 495

Query: 588 HNFITRFQSSYDTVIGPHGTLLSGGQKQRIAIARALIKKPRILILDEATSALDVESEGAI 647
              + R+  + D      GT LS GQ+ R+  A   ++ P IL+LDE T+ LD+      
Sbjct: 496 RGQLGRYGLTGDGQKAQMGT-LSEGQRSRVVFALLALQAPNILLLDEPTNGLDIP----- 549

Query: 648 NYTFGQLMKKKEMTIVSIAHRLSTIRRSENVIVLGHD 684
                        TI S+A  ++T   +  V+V+ HD
Sbjct: 550 -------------TIDSLAEAINTF--NGGVVVVSHD 571

 Score = 43.1 bits (100), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 18/35 (51%), Positives = 28/35 (80%)

Query: 609 LSGGQKQRIAIARALIKKPRILILDEATSALDVES 643
           +SGG K R+A+A+AL  KP +L+LD+ T+ LD+E+
Sbjct: 227 MSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEA 261

>ZYRO0D17710g Chr4 complement(1466189..1470649) [4461 bp, 1486 aa]
            {ON} highly similar to uniprot|P33302 Saccharomyces
            cerevisiae YOR153W PDR5 Short-lived membrane ABC (ATP-
            binding cassette) transporter actively exports various
            drugs expression regulated by Pdr1p also involved in
            steroid transport cation resistance and cellular
            detoxification during exponential growth
          Length = 1486

 Score = 65.5 bits (158), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 58/238 (24%), Positives = 114/238 (47%), Gaps = 27/238 (11%)

Query: 469  IEFKNVSFAYP-TRPSNMIFKNLNFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPS--S 525
              ++N+S+     + +  I  N++  ++ G+   ++G SG GK+T+   L +       +
Sbjct: 844  FHWRNLSYDVQIKKDTRRILDNVDGWVKPGTLTALMGASGAGKTTLLDCLAERVTMGVIT 903

Query: 526  GEILIDGQNINDLNSKSLRRHIGLVQQEPI-LMSGTIRDNIVYG--------LTEMPTKD 576
            G++ ++G+        S  R IG  QQ+ + L + T+R+++ +         ++E    D
Sbjct: 904  GDVFVNGKP----RDTSFPRSIGYCQQQDLHLTTSTVRESLRFSAYLRQPSTVSEQEKDD 959

Query: 577  EIRQVAKQCFCHNFITRFQSSYDTVIGPHGTLLSGGQKQRIAIARALIKKPRILI-LDEA 635
             + QV K       I   ++  D V+G  G  L+  Q++R+ I   L+ KP++L+ LDE 
Sbjct: 960  YVEQVIK-------ILEMEAYADAVVGVAGEGLNVEQRKRLTIGVELVAKPKLLLFLDEP 1012

Query: 636  TSALDVESEGAINYTFGQLMKKKEMTIVSIAHRLSTIRRSE--NVIVLGHDGSVVEMG 691
            TS LD ++  ++     +L K  +  + +I H+ S I   E   ++ +   G  V  G
Sbjct: 1013 TSGLDSQTAWSVCQLMKKLAKHGQAILCTI-HQPSAILMQEFDRLLFMQRGGKTVYFG 1069

>Ecym_1194 Chr1 (393697..395526) [1830 bp, 609 aa] {ON} similar to
           Ashbya gossypii AFR232C
          Length = 609

 Score = 64.7 bits (156), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 43/174 (24%), Positives = 82/174 (47%), Gaps = 19/174 (10%)

Query: 469 IEFKNVSFAYPTRPSNMIFKNLNFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPSSGEI 528
           + F  +SF+Y  +P N +++NLNF ++  S V +VGP+G GKST+  ++     P  G +
Sbjct: 392 LAFDEISFSYDEKPENNLYENLNFGVDMDSRVALVGPNGVGKSTLLKIMTGELTPQGGRV 451

Query: 529 LIDGQNINDLNSKSLRRHIGLVQQEPILMSGTIRDNIVYGLTEMPTKDEIRQVAKQC-FC 587
                      S+     +G+  Q         +  + +       +D+   +++   + 
Sbjct: 452 -----------SRHTHVKLGVYSQHSQDQLDLTKSALEF------VRDKYGHISEDFQYW 494

Query: 588 HNFITRFQSSYDTVIGPHGTLLSGGQKQRIAIARALIKKPRILILDEATSALDV 641
              + R+  + +      GT LS GQ+ R+  A   + +P +L+LDE T+ LD+
Sbjct: 495 RGQLGRYGLTGEGQTVQMGT-LSEGQRSRVVFALLALDQPNVLLLDEPTNGLDI 547

 Score = 45.1 bits (105), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 39/59 (66%), Gaps = 4/59 (6%)

Query: 609 LSGGQKQRIAIARALIKKPRILILDEATSALDVESEGAINYTFGQLMKKKEMTIVSIAH 667
           +SGG K R+A+A+AL  KP +L+LD+ T+ LD+E+         + +K+ + T+V ++H
Sbjct: 226 MSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEA----CVWLEEYLKRFDRTLVLVSH 280

>TPHA0A05890 Chr1 complement(1334117..1335949) [1833 bp, 610 aa]
           {ON} Anc_3.534 YER036C
          Length = 610

 Score = 64.7 bits (156), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 45/173 (26%), Positives = 83/173 (47%), Gaps = 17/173 (9%)

Query: 469 IEFKNVSFAYPTRPSNMIFKNLNFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPSSGEI 528
           + F ++SFAY  +P N ++ +LNF ++  S + +VGP+G GKST+  ++    +  SG +
Sbjct: 393 LSFDDISFAYDGKPENNLYNHLNFGVDMDSRIALVGPNGVGKSTLLKIMTGELQAQSGRV 452

Query: 529 LIDGQNINDLNSKSLRRHIGLVQQEPILMSGTIRDNIVYGLTEMPTKDEIRQVAKQCFCH 588
                      S+     +G+  Q         +  + +   + P   EI Q  +  +  
Sbjct: 453 -----------SRHSHVKLGVYSQHSQDQLDLTKSALEFVRDKYP---EISQDFQ--YWR 496

Query: 589 NFITRFQSSYDTVIGPHGTLLSGGQKQRIAIARALIKKPRILILDEATSALDV 641
             + R+  + +      GT LS GQ+ R+  A   ++ P +L+LDE T+ LD+
Sbjct: 497 GQLGRYGLTGEAQTVQMGT-LSEGQRSRVVFALLALEAPNVLLLDEPTNGLDI 548

 Score = 45.1 bits (105), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 39/59 (66%), Gaps = 4/59 (6%)

Query: 609 LSGGQKQRIAIARALIKKPRILILDEATSALDVESEGAINYTFGQLMKKKEMTIVSIAH 667
           +SGG K R+A+A+AL  KP +L+LD+ T+ LD+E+         + +K+ + T+V ++H
Sbjct: 227 MSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEA----CVWLEEYLKRFDRTLVLVSH 281

>Suva_5.134 Chr5 complement(199609..201441) [1833 bp, 610 aa] {ON}
           YER036C (REAL)
          Length = 610

 Score = 64.7 bits (156), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 43/173 (24%), Positives = 82/173 (47%), Gaps = 17/173 (9%)

Query: 469 IEFKNVSFAYPTRPSNMIFKNLNFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPSSGEI 528
           + F ++SF Y + PS  +++NLNF ++  S + +VGP+G GKST+  ++     P SG +
Sbjct: 393 LAFDDISFHYESNPSENLYENLNFGVDMDSRIALVGPNGVGKSTLLKIMTGELTPQSGRV 452

Query: 529 LIDGQNINDLNSKSLRRHIGLVQQEPILMSGTIRDNIVYGLTEMPTKDEIRQVAKQCFCH 588
                      S+     +G+  Q         +  + +   + P+  +  Q     +  
Sbjct: 453 -----------SRHTHVKLGVYSQHSQDQLDLTKSALEFVRDKYPSVSQDFQ-----YWR 496

Query: 589 NFITRFQSSYDTVIGPHGTLLSGGQKQRIAIARALIKKPRILILDEATSALDV 641
             + R+  + +       T LS GQ+ R+  A   +++P +L+LDE T+ LD+
Sbjct: 497 GQLGRYGLTGEGQTVQMAT-LSEGQRSRVVFALLALEQPNVLLLDEPTNGLDI 548

 Score = 45.1 bits (105), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 39/59 (66%), Gaps = 4/59 (6%)

Query: 609 LSGGQKQRIAIARALIKKPRILILDEATSALDVESEGAINYTFGQLMKKKEMTIVSIAH 667
           +SGG K R+A+A+AL  KP +L+LD+ T+ LD+E+         + +K+ + T+V ++H
Sbjct: 227 MSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEA----CVWLEEYLKRFDRTLVLVSH 281

>KAFR0C05220 Chr3 (1042497..1046996) [4500 bp, 1499 aa] {ON} Anc_5.500
            YDR406W
          Length = 1499

 Score = 65.1 bits (157), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 65/255 (25%), Positives = 121/255 (47%), Gaps = 22/255 (8%)

Query: 455  STTKGVKYKPGNGEIEFKNVSFAYPTRP-SNMIFKNLNFKIEAGSNVCIVGPSGRGKSTV 513
            S+T G +         ++N+ +  P +  +  +  N++  ++ G+   ++G SG GK+T+
Sbjct: 837  SSTNGARLLKSQAVFHWRNLCYDIPIKHGTRRLLDNVDGWVKPGTLTALMGASGAGKTTL 896

Query: 514  ALLLEKYYKPS--SGEILIDGQNINDLNSKSLRRHIGLVQQEPI-LMSGTIRDNIVYGLT 570
               L +       +G++L+DG+  ++    S  R IG  QQ+ + L + T+R+++ +   
Sbjct: 897  LDCLAERVTMGVITGDVLVDGRPRDE----SFPRSIGYCQQQDLHLKTSTVRESLRFS-A 951

Query: 571  EMPTKDEIRQVAKQCFCHNFIT--RFQSSYDTVIGPHGTLLSGGQKQRIAIARALIKKPR 628
             +    E+    K  +    I     +   D V+G  G  L+  Q++R+ I   L  KP+
Sbjct: 952  YLRQPAEVSVEEKDAYVEEVIKILEMEKYADAVVGVAGEGLNVEQRKRLTIGVELAAKPK 1011

Query: 629  ILI-LDEATSALDVESEGAINYTFGQLMKK---KEMTIVSIAHRLSTIRRSE-NVIVLGH 683
            +L+ LDE TS LD ++  +I     QLM+K       I+   H+ S I   E + ++   
Sbjct: 1012 LLVFLDEPTSGLDSQTAWSI----CQLMRKLASHGQAILCTIHQPSAILMQEFDRLLFLQ 1067

Query: 684  DGSVVEMGKFKELWD 698
            DG   +   F EL D
Sbjct: 1068 DGG--QTTYFGELGD 1080

>ZYRO0D11858g Chr4 (998646..1003157) [4512 bp, 1503 aa] {ON} highly
            similar to gnl|GLV|CAGL0M01760g Candida glabrata
            CAGL0M01760g and similar to YOR153W uniprot|P33302
            Saccharomyces cerevisiae YOR153W PDR5 Short- lived
            membrane ABC (ATP-binding cassette) transporter actively
            exports various drugs expression regulated by Pdr1p also
            involved in steroid transport cation resistance and
            cellular detoxification during exponential growth
          Length = 1503

 Score = 65.1 bits (157), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 60/223 (26%), Positives = 109/223 (48%), Gaps = 24/223 (10%)

Query: 486  IFKNLNFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPS--SGEILIDGQNINDLNSKSL 543
            I  N++  ++ G+   ++G SG GK+T+   L +       +G+I ++G+    L  +S 
Sbjct: 866  ILNNVDGWVKPGTLTALMGSSGAGKTTLLDCLAERVTMGVITGDIFVNGK----LRDESF 921

Query: 544  RRHIGLVQQEPI-LMSGTIRDNIVY-GLTEMPTK---DEIRQVAKQCFCHNFITRFQSSY 598
             R IG  QQ+ + L + T+R+++++  +   P      E R+  ++      I   +   
Sbjct: 922  PRSIGYCQQQDLHLKTATVRESLLFSAMLRQPKSVPASEKRKYVEEVIK---ILEMEPYA 978

Query: 599  DTVIGPHGTLLSGGQKQRIAIARALIKKPRILI-LDEATSALDVESEGAINYTFGQLMKK 657
            D ++G  G  L+  Q++R+ I   L+ KP++L+ LDE TS LD ++  +I     QLMKK
Sbjct: 979  DAIVGVAGEGLNVEQRKRLTIGVELVAKPKLLVFLDEPTSGLDSQTAWSI----CQLMKK 1034

Query: 658  ---KEMTIVSIAHRLSTIRRSE--NVIVLGHDGSVVEMGKFKE 695
                   I+   H+ S +   E   ++ L   G  V  G+  E
Sbjct: 1035 LSNHGQAILCTIHQPSAMLMQEFDRLLFLQKGGKTVYFGELGE 1077

>CAGL0C02343g Chr3 (236112..236391,236790..238672) [2163 bp, 720 aa]
           {ON} highly similar to uniprot|P40024 Saccharomyces
           cerevisiae YER036c ARB1
          Length = 720

 Score = 64.7 bits (156), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 44/176 (25%), Positives = 83/176 (47%), Gaps = 19/176 (10%)

Query: 469 IEFKNVSFAYPTRPSNMIFKNLNFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPSSGEI 528
           + F ++SFAY   P N ++++LNF ++  S   +VGP+G GKST+  ++     P SG +
Sbjct: 503 LAFDDISFAYDGNPENNLYEHLNFGVDMDSRTALVGPNGVGKSTLLKIMTGELMPQSGRV 562

Query: 529 LIDGQNINDLNSKSLRRHIGLVQQEPILMSGTIRDNIVYGLTEMPTKDEIRQVAKQC-FC 587
                      S+     +G+  Q         +  + +       +D+   +++   + 
Sbjct: 563 -----------SRHTHVKLGVYSQHSQDQLDLTKSALEF------VRDKYSNISQDFQYW 605

Query: 588 HNFITRFQSSYDTVIGPHGTLLSGGQKQRIAIARALIKKPRILILDEATSALDVES 643
              + R+  + D      GT LS GQ+ R+  A   ++ P +L+LDE T+ LD+ +
Sbjct: 606 RGQLGRYGLTGDAQKVQMGT-LSEGQRSRVVFALLALENPNVLLLDEPTNGLDIPT 660

 Score = 45.8 bits (107), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 40/59 (67%), Gaps = 4/59 (6%)

Query: 609 LSGGQKQRIAIARALIKKPRILILDEATSALDVESEGAINYTFGQLMKKKEMTIVSIAH 667
           +SGG K R+A+A+AL  KP +L+LD+ T+ LD+E+   +     + +K+ + T+V ++H
Sbjct: 337 MSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEACVWLE----EYLKRFDRTLVLVSH 391

>NCAS0E00480 Chr5 (81549..83381) [1833 bp, 610 aa] {ON} 
          Length = 610

 Score = 64.3 bits (155), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 43/173 (24%), Positives = 82/173 (47%), Gaps = 17/173 (9%)

Query: 469 IEFKNVSFAYPTRPSNMIFKNLNFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPSSGEI 528
           + F ++SF+Y   P N +++NL+F ++  S + +VGP+G GKST+  ++     P SG +
Sbjct: 393 LAFDSISFSYDGNPENNLYENLDFGVDMDSRIALVGPNGVGKSTLLKIMTGELTPQSGRV 452

Query: 529 LIDGQNINDLNSKSLRRHIGLVQQEPILMSGTIRDNIVYGLTEMPTKDEIRQVAKQCFCH 588
                      S+     +G+  Q         +  + +   + P   +  Q     +  
Sbjct: 453 -----------SRHTHVKLGVYSQHSQDQLDLTKSALEFVRDKYPNISQDFQ-----YWR 496

Query: 589 NFITRFQSSYDTVIGPHGTLLSGGQKQRIAIARALIKKPRILILDEATSALDV 641
             + R+  + +      GT LS GQ+ R+  A   +++P +L+LDE T+ LD+
Sbjct: 497 GQLGRYGLTGEGQTVQMGT-LSEGQRSRVVFALLALEQPNVLLLDEPTNGLDI 548

 Score = 45.4 bits (106), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 39/59 (66%), Gaps = 4/59 (6%)

Query: 609 LSGGQKQRIAIARALIKKPRILILDEATSALDVESEGAINYTFGQLMKKKEMTIVSIAH 667
           +SGG K R+A+A+AL  KP +L+LD+ T+ LD+E+         + +K+ + T+V ++H
Sbjct: 227 MSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEA----CVWLEEYLKRFDRTLVLVSH 281

>TBLA0I03330 Chr9 complement(806242..808074) [1833 bp, 610 aa] {ON}
           Anc_3.534 YER036C
          Length = 610

 Score = 64.3 bits (155), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 53/233 (22%), Positives = 109/233 (46%), Gaps = 38/233 (16%)

Query: 469 IEFKNVSFAYPTRPSNMIFKNLNFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPSSGEI 528
           + F ++SF+Y  +P N ++++LNF ++  S + +VGP+G GKST+  ++       SG +
Sbjct: 393 LAFDDISFSYDGKPENNLYEHLNFGVDMDSRIALVGPNGVGKSTLLKIMTGELMSQSGRV 452

Query: 529 LIDGQNINDLNSKSLRRHIGLVQQEPILMSGTIRDNIVYGLTEMPTKDEIRQVAKQC-FC 587
                      S+     +G+  Q         +  + +       +D+   +++   + 
Sbjct: 453 -----------SRHTHVKLGVYSQHSQDQLDLTKSALEF------VRDKYSNISQDFQYW 495

Query: 588 HNFITRFQSSYDTVIGPHGTLLSGGQKQRIAIARALIKKPRILILDEATSALDVES---- 643
              + R+  + +      GT LS GQ+ R+  A   +++P +L+LDE T+ LD+ +    
Sbjct: 496 RGQLGRYGLTGEAQTVLMGT-LSEGQRSRVVFALLALEQPNVLLLDEPTNGLDIPTIDSL 554

Query: 644 EGAINYTFGQLMKKKEMTIVSIAHRLSTIRR-SENVIVLGH------DGSVVE 689
             AIN   G         +V ++H    + + ++++ V+ H      DGS++E
Sbjct: 555 ADAINEFNG--------GVVVVSHDFRLLDKIAKDIFVVEHKTATRWDGSILE 599

 Score = 45.4 bits (106), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 39/59 (66%), Gaps = 4/59 (6%)

Query: 609 LSGGQKQRIAIARALIKKPRILILDEATSALDVESEGAINYTFGQLMKKKEMTIVSIAH 667
           +SGG K R+A+A+AL  KP +L+LD+ T+ LD+E+         + +K+ + T+V ++H
Sbjct: 227 MSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEA----CVWLEEYLKRFDRTLVLVSH 281

>Skud_14.404 Chr14 (733442..737716) [4275 bp, 1424 aa] {ON} YNR070W
            (REAL)
          Length = 1424

 Score = 64.7 bits (156), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 63/235 (26%), Positives = 115/235 (48%), Gaps = 16/235 (6%)

Query: 467  GEIEFKNVSFAYPTRPSN---MIFKNLNFKIEAGSNVCIVGPSGRGKSTVA-LLLEKYYK 522
            G   ++NVSF    R SN    +  N++     G+   ++G SG GK+T+   L ++   
Sbjct: 773  GVFIWRNVSFT--IRHSNGQRKLLDNVSGYCVPGTLTALIGESGAGKTTLLNTLAQRNVG 830

Query: 523  PSSGEILIDGQNINDLNSKSLRRHIGLVQQEPILMSG-TIRDNIVYGLTEMPTKDEIRQV 581
              +G+IL+DG  ++     S  R  G VQQ+ +  +  T+R+++ +    M     I  V
Sbjct: 831  TVTGDILVDGLPMD----ASFERRTGYVQQQDLHTAELTVRESLQFS-ARMRRPQSIPDV 885

Query: 582  AKQCFCHNFIT--RFQSSYDTVIGPHGTLLSGGQKQRIAIARALIKKPRILI-LDEATSA 638
             K  +    I     Q   + ++G  G  L+  Q+++++I   L+ KP +L+ LDE TS 
Sbjct: 886  EKMEYVEKIIDILEMQEFSEALVGEIGYGLNVEQRKKLSIGVELVGKPDLLLFLDEPTSG 945

Query: 639  LDVESEGAINYTFGQLMKKKEMTIVSIAHRLSTI-RRSENVIVLGHDGSVVEMGK 692
            LD +S  +I     +L +  +  + +I    +T+  + E +++LG  G  V  G+
Sbjct: 946  LDSQSAWSIVKMLKRLTQAGQSILCTIHQPSATLFEQFERLLLLGKGGQTVYFGE 1000

>Kwal_47.19116 s47 complement(1101559..1103382) [1824 bp, 607 aa]
           {ON} YER036C (KRE30) - Hypothetical ORF [contig 188]
           FULL
          Length = 607

 Score = 63.9 bits (154), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 50/178 (28%), Positives = 83/178 (46%), Gaps = 27/178 (15%)

Query: 469 IEFKNVSFAYPTRPSNMIFKNLNFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPSSGEI 528
           + F ++SFAY  +P N ++++LNF ++  S V +VGP+G GKST+  ++       SG +
Sbjct: 390 LAFDDISFAYDGKPENNLYEHLNFGVDMDSRVALVGPNGVGKSTLLKIMTGELATQSGRV 449

Query: 529 LIDGQNINDLNSKSLRRHIGLVQQEPILMSGTIRDNIVYGLTEMPTKDEIRQVAKQCFCH 588
                      S+     +G+  Q         +D +   LT+ P   E  +       H
Sbjct: 450 -----------SRHTHVKLGVYSQHS-------QDQL--DLTKSPL--EFVRDKYSHISH 487

Query: 589 NF-ITRFQSSYDTVIGPHGT----LLSGGQKQRIAIARALIKKPRILILDEATSALDV 641
           +F   R Q     + G   T     LS GQ+ R+  A   ++ P +L+LDE T+ LD+
Sbjct: 488 DFQYWRGQLGRYGLTGEGQTSQMATLSEGQRSRVVFALLALQAPNVLLLDEPTNGLDI 545

 Score = 45.1 bits (105), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 39/59 (66%), Gaps = 4/59 (6%)

Query: 609 LSGGQKQRIAIARALIKKPRILILDEATSALDVESEGAINYTFGQLMKKKEMTIVSIAH 667
           +SGG K R+A+A+AL  KP +L+LD+ T+ LD+E+         + +K+ + T+V ++H
Sbjct: 224 MSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEA----CVWLEEYLKRFDRTLVLVSH 278

>TBLA0D01820 Chr4 (448516..453171) [4656 bp, 1551 aa] {ON} 
          Length = 1551

 Score = 64.3 bits (155), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 58/221 (26%), Positives = 105/221 (47%), Gaps = 20/221 (9%)

Query: 486  IFKNLNFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPS--SGEILIDGQNINDLNSKSL 543
            I  N++  ++ G+   ++G SG GK+T+   L +       +G++ IDG+       +S 
Sbjct: 911  ILNNVDGWVKPGTLTALMGASGAGKTTLLDCLAERVTMGVITGDVFIDGKP----RDESF 966

Query: 544  RRHIGLVQQEPI-LMSGTIRDNIVYGLTEMPTKDEIRQVAKQCFCHNFIT--RFQSSYDT 600
             R IG  QQ+ + L + T+R+++ +    +    E+    K  +  + I     +   D 
Sbjct: 967  PRSIGYCQQQDLHLKTATVRESLRFS-AYLRQPAEVSIAEKNAYVEDIIKILEMEKYADA 1025

Query: 601  VIGPHGTLLSGGQKQRIAIARALIKKPRILI-LDEATSALDVESEGAINYTFGQLMKK-- 657
            ++G  G  L+  Q++R+ I   L  KP++L+ LDE TS LD ++  AI     QLM+K  
Sbjct: 1026 IVGVAGEGLNVEQRKRLTIGVELAAKPKLLVFLDEPTSGLDSQTAWAI----CQLMRKLC 1081

Query: 658  -KEMTIVSIAHRLSTIRRSE--NVIVLGHDGSVVEMGKFKE 695
             +   I+   H+ S I   E   ++ +   G     G+  E
Sbjct: 1082 NQGQAILCTIHQPSAILMQEFDRLLFMQRGGQTCYFGELGE 1122

>CAGL0M01760g Chr13 (203616..208115) [4500 bp, 1499 aa] {ON} highly
            similar to uniprot|P33302 Saccharomyces cerevisiae
            YOR153w PDR5 or uniprot|Q04182 Saccharomyces cerevisiae
            YDR406w PDR15 or uniprot|P51533 Saccharomyces cerevisiae
            YOR328w
          Length = 1499

 Score = 63.9 bits (154), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 62/218 (28%), Positives = 104/218 (47%), Gaps = 22/218 (10%)

Query: 486  IFKNLNFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPS--SGEILIDGQNINDLNSKSL 543
            I  N++  ++ G+   ++G SG GK+T+   L +       +GE+ +DG+  +D    S 
Sbjct: 875  ILNNVDGWVKPGTLTALMGASGAGKTTLLDCLAERVTMGVITGEVSVDGKQRDD----SF 930

Query: 544  RRHIGLVQQEPI-LMSGTIRDNIVY-GLTEMPTKDEIRQVAKQCFCHNFIT--RFQSSYD 599
             R IG  QQ+ + L + T+R+++ +      P    I +  K  +  + I     +   D
Sbjct: 931  ARSIGYCQQQDLHLKTSTVRESLRFSAYLRQPADVSIEE--KNQYVEDVIKILEMEQYAD 988

Query: 600  TVIGPHGTLLSGGQKQRIAIARALIKKPRILI-LDEATSALDVESEGAINYTFGQLMKK- 657
             V+G  G  L+  Q++R+ I   L  KP++L+ LDE TS LD ++  +I     QLMKK 
Sbjct: 989  AVVGVPGEGLNVEQRKRLTIGVELAAKPKLLVFLDEPTSGLDSQTAWSI----CQLMKKL 1044

Query: 658  --KEMTIVSIAHRLSTIRRSE--NVIVLGHDGSVVEMG 691
                  I+   H+ S I   E   ++ L   G  V  G
Sbjct: 1045 ANHGQAILCTIHQPSAILMQEFDRLLFLQRGGKTVYFG 1082

>TPHA0D04700 Chr4 (1026978..1031510) [4533 bp, 1510 aa] {ON} 
          Length = 1510

 Score = 63.9 bits (154), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 66/242 (27%), Positives = 113/242 (46%), Gaps = 25/242 (10%)

Query: 486  IFKNLNFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPS--SGEILIDGQNINDLNSKSL 543
            I  N++  ++ G+   ++G SG GK+T+   L +       +G+I +DG         S 
Sbjct: 886  ILNNVDGWVKPGTLTALMGSSGAGKTTLLDCLAERVTMGVITGDIFVDGLP----RDTSF 941

Query: 544  RRHIGLVQQEPI-LMSGTIRDNIVYGLTEMPTKDEIRQVAKQCFCHNFIT--RFQSSYDT 600
             R IG  QQ+ + L + T+R+++ +   E+    ++    K  +    I     +   D 
Sbjct: 942  PRSIGYCQQQDLHLTTATVRESLRFS-AELRQPADVSVSEKHAYVEEVIKILEMEKYADA 1000

Query: 601  VIGPHGTLLSGGQKQRIAIARALIKKPRILI-LDEATSALDVESEGAINYTFGQLMKKKE 659
            V+G  G  L+  Q++R+ I   L  KP++L+ LDE TS LD ++  +I     QLMKK  
Sbjct: 1001 VVGVAGEGLNVEQRKRLTIGVELAAKPKLLVFLDEPTSGLDSQTAWSI----CQLMKKLA 1056

Query: 660  ---MTIVSIAHRLSTIRRSE--NVIVLGHDGSVVEMGKFKELWDDPTSELSQLLNEKSTP 714
                 I+   H+ S I   E   ++ L   G  V  G   EL D+ T+ +     E++  
Sbjct: 1057 KFGQAILCTIHQPSAILMQEFDRLLFLQKGGKTVYFG---ELGDNCTTMIDYF--ERNGA 1111

Query: 715  HQ 716
            H+
Sbjct: 1112 HK 1113

>CAGL0M02387g Chr13 (280372..282942) [2571 bp, 856 aa] {ON} similar
           to uniprot|P41909 Saccharomyces cerevisiae YPL147w PXA1
           Peroxisomal long-chain fatty acid import protein 2
          Length = 856

 Score = 63.9 bits (154), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 50/193 (25%), Positives = 96/193 (49%), Gaps = 21/193 (10%)

Query: 489 NLNFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPSSGEILIDGQNINDLNSKSLRRHIG 548
           NL F    GS++ I+GP+  GK+++  ++ + +            N   L S   + ++ 
Sbjct: 616 NLPFLQGPGSSLLILGPNSCGKTSIQRIIAEIWPI---------YNKKGLMSIPAQENLI 666

Query: 549 LVQQEPILM-SGTIRDNIVYGLT-----EMPTKDE-IRQVAKQCFCHNFITRFQS-SYDT 600
            + Q+P     GT+RD ++Y ++     +   KD+ + Q+  +      + R    SY  
Sbjct: 667 CIPQKPYFTRGGTLRDQLIYPMSSDEFFDRGFKDKYLVQIMSEVKLDYLLKRGTGLSYLD 726

Query: 601 VIGPHGTLLSGGQKQRIAIARALIKKPRILILDEATSALDVESEGAINYTFGQLMKKKEM 660
            +     +LSGG+KQR+  AR +  +P  ++LDEAT+A+  + E   +Y F  L+K+   
Sbjct: 727 TVADWKDVLSGGEKQRVNFARIMFHRPLFVVLDEATNAISADME---DYLF-NLLKRYRF 782

Query: 661 TIVSIAHRLSTIR 673
             ++I+ R + I+
Sbjct: 783 NFITISQRPTLIK 795

>AGL142C Chr7 complement(434247..438740) [4494 bp, 1497 aa] {ON}
            Non-syntenic homolog of Saccharomyces cerevisiae YPL058C
            (PDR12)
          Length = 1497

 Score = 63.9 bits (154), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 57/218 (26%), Positives = 104/218 (47%), Gaps = 14/218 (6%)

Query: 486  IFKNLNFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPS--SGEILIDGQNINDLNSKSL 543
            I  N++  ++ G+   ++G SG GK+T+  +L    +    +G I +DG     L   S 
Sbjct: 860  ILTNVDGWVKPGTLTALMGYSGAGKTTLLDVLANRVRVGVVTGNIFVDGH----LRDTSF 915

Query: 544  RRHIGLVQQEPIL-MSGTIRDNIVYGLTEMPTKDEIRQVAKQCFCHNFITRF--QSSYDT 600
            +R  G  QQ+ +   + T+RD + +    +     I +  K  +  + I     ++  D 
Sbjct: 916  QRKTGYCQQQDLHGRTQTVRDALKFS-AYLRQPQSISRAEKNAYVEDIIKLLGMEAYADA 974

Query: 601  VIGPHGTLLSGGQKQRIAIARALIKKPRILI-LDEATSALDVESEGAINYTFGQLMKKKE 659
            V+G  G  L+  Q++R+ I   L+ KP +L+ LDE TS LD ++  +I     +L+   +
Sbjct: 975  VVGVTGEGLNVEQRKRLTIGVELVAKPELLLFLDEPTSGLDSQTAWSICQLIKKLVNHGQ 1034

Query: 660  MTIVSIAHRLSTIRRSE--NVIVLGHDGSVVEMGKFKE 695
              + +I H+ S I   E   +++L + G  V  G   E
Sbjct: 1035 AILCTI-HQPSAILMQEFDRLLLLSNGGRTVYFGPLGE 1071

>TBLA0D01780 Chr4 complement(438830..443617) [4788 bp, 1595 aa] {ON}
            Anc_5.500 YDR406W
          Length = 1595

 Score = 63.9 bits (154), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 58/221 (26%), Positives = 106/221 (47%), Gaps = 20/221 (9%)

Query: 486  IFKNLNFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPS--SGEILIDGQNINDLNSKSL 543
            I  N++  ++ G+   ++G SG GK+T+   L +       +G++ IDG+  ++    S 
Sbjct: 969  ILNNVDGWVKPGTLTALMGASGAGKTTLLDCLAERVTMGVITGDVFIDGKPRDE----SF 1024

Query: 544  RRHIGLVQQEPI-LMSGTIRDNIVYGLTEMPTKDEIRQVAKQCFCHNFIT--RFQSSYDT 600
             R IG  QQ+ + L + T+R+++ +    +    E+    K  +  + I     +   D 
Sbjct: 1025 PRSIGYCQQQDLHLKTATVRESLRFS-AYLRQPAEVSIAEKNAYVEDIIKILEMEKYADA 1083

Query: 601  VIGPHGTLLSGGQKQRIAIARALIKKPRILI-LDEATSALDVESEGAINYTFGQLMKK-- 657
            ++G  G  L+  Q++R+ I   L  KP++L+ LDE TS LD ++  AI     QLM+K  
Sbjct: 1084 IVGVAGEGLNVEQRKRLTIGVELAAKPKLLVFLDEPTSGLDSQTAWAI----CQLMRKLC 1139

Query: 658  -KEMTIVSIAHRLSTIRRSE--NVIVLGHDGSVVEMGKFKE 695
             +   I+   H+ S I   E   ++ +   G     G+  E
Sbjct: 1140 NQGQAILCTIHQPSAILMQEFDRLLFMQRGGQTCYFGELGE 1180

>KAFR0E03450 Chr5 complement(689571..694232) [4662 bp, 1553 aa] {ON} 
          Length = 1553

 Score = 63.9 bits (154), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 64/223 (28%), Positives = 106/223 (47%), Gaps = 32/223 (14%)

Query: 486  IFKNLNFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPS--SGEILIDGQNINDLNSKSL 543
            +  N++  ++ G+   ++G SG GK+T+   L +       +G I +DG+    L  +S 
Sbjct: 926  LLNNVDGWVKPGTLTALMGASGAGKTTLLDCLAERVTMGVITGNIFVDGR----LRDESF 981

Query: 544  RRHIGLVQQEPI-LMSGTIRDNIVY-GLTEMP---TKDE----IRQVAKQCFCHNFITRF 594
             R IG  QQ+ + L + T+R+++ +      P   TK+E    + QV K       I   
Sbjct: 982  PRSIGYCQQQDLHLKTATVRESLRFSAYLRQPASVTKEEKDHYVEQVIK-------ILEM 1034

Query: 595  QSSYDTVIGPHGTLLSGGQKQRIAIARALIKKPRILI-LDEATSALDVESEGAINYTFGQ 653
            ++  D V+G  G  L+  Q++R+ I   L  KP++L+ LDE TS LD ++  A      Q
Sbjct: 1035 ETYADAVVGVPGEGLNVEQRKRLTIGVELAAKPKLLVFLDEPTSGLDSQTAWAT----CQ 1090

Query: 654  LMKK---KEMTIVSIAHRLSTIRRSE--NVIVLGHDGSVVEMG 691
            LM+K       I+   H+ S I   E   ++ L   G  V  G
Sbjct: 1091 LMRKLANHGQAILCTIHQPSAILMQEFDRLLFLQKGGKTVYFG 1133

>KAFR0C05210 Chr3 (1037177..1041658) [4482 bp, 1493 aa] {ON} 
          Length = 1493

 Score = 63.9 bits (154), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 60/221 (27%), Positives = 106/221 (47%), Gaps = 20/221 (9%)

Query: 486  IFKNLNFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPS--SGEILIDGQNINDLNSKSL 543
            I  N++  ++ G+   ++G SG GK+T+   L +       +G++L+DG+  ++    S 
Sbjct: 871  ILNNVDGWVKPGTLTALMGSSGAGKTTLLDCLAERVTMGVITGDVLVDGRPRDE----SF 926

Query: 544  RRHIGLVQQEPI-LMSGTIRDNIVYGLTEMPTKDEIRQVAKQCFCHNFIT--RFQSSYDT 600
             R IG  QQ+ + L + T+R+++ +    +    E+    K  +    I     +   D 
Sbjct: 927  PRSIGYCQQQDLHLKTSTVRESLRFS-AYLRQPAEVSVEEKDAYVEEVIKILEMEKYADA 985

Query: 601  VIGPHGTLLSGGQKQRIAIARALIKKPRILI-LDEATSALDVESEGAINYTFGQLMKK-- 657
            V+G  G  L+  Q++R+ I   L  KP++L+ LDE TS LD ++  +I     QLM+K  
Sbjct: 986  VVGVAGEGLNVEQRKRLTIGVELAAKPKLLVFLDEPTSGLDSQTAWSI----CQLMRKLA 1041

Query: 658  -KEMTIVSIAHRLSTIRRSE--NVIVLGHDGSVVEMGKFKE 695
                 I+   H+ S I   E   ++ L   G  V  G+  E
Sbjct: 1042 SHGQAILCTIHQPSAILMQEFDRLLFLQKGGKTVYFGELGE 1082

>TDEL0D06020 Chr4 complement(1087102..1088934) [1833 bp, 610 aa]
           {ON} Anc_3.534 YER036C
          Length = 610

 Score = 63.2 bits (152), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 48/229 (20%), Positives = 108/229 (47%), Gaps = 30/229 (13%)

Query: 469 IEFKNVSFAYPTRPSNMIFKNLNFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPSSGEI 528
           + F  ++F+Y   P N ++++LNF ++  S + +VGP+G GKST+  ++     P +G +
Sbjct: 393 LAFDEINFSYDGNPENNLYEHLNFGVDMDSRIALVGPNGVGKSTLLKIMTGELTPQAGRV 452

Query: 529 LIDGQNINDLNSKSLRRHIGLVQQEPILMSGTIRDNIVYGLTEMPTKDEIRQVAKQC-FC 587
                      S+     +G+  Q         +  + +       +D+  Q+++   + 
Sbjct: 453 -----------SRHTHVKLGVYSQHSQDQLDLTKSALEF------VRDKYPQISQDFQYW 495

Query: 588 HNFITRFQSSYDTVIGPHGTLLSGGQKQRIAIARALIKKPRILILDEATSALDVESEGAI 647
              + R+  + +      GT LS GQ+ R+  A   +++P +L+LDE T+ LD+ +  ++
Sbjct: 496 RGQLGRYGLTGEGQTVQMGT-LSEGQRSRVVFALLALEQPNVLLLDEPTNGLDIPTIDSL 554

Query: 648 NYTFGQLMKKKEMTIVSIAHRLSTIRR-SENVIVLGH------DGSVVE 689
                +        +V ++H    + + ++++ V+ H      DGS+++
Sbjct: 555 ADAISEF----NGGVVVVSHDFRLLDKIAKDIFVVEHKTATRWDGSILQ 599

 Score = 45.1 bits (105), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 39/59 (66%), Gaps = 4/59 (6%)

Query: 609 LSGGQKQRIAIARALIKKPRILILDEATSALDVESEGAINYTFGQLMKKKEMTIVSIAH 667
           +SGG K R+A+A+AL  KP +L+LD+ T+ LD+E+         + +K+ + T+V ++H
Sbjct: 227 MSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEA----CVWLEEYLKRFDRTLVLVSH 281

>YOR328W Chr15 (931803..936497) [4695 bp, 1564 aa] {ON}
            PDR10ATP-binding cassette (ABC) transporter, multidrug
            transporter involved in the pleiotropic drug resistance
            network; regulated by Pdr1p and Pdr3p
          Length = 1564

 Score = 63.5 bits (153), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 59/236 (25%), Positives = 112/236 (47%), Gaps = 21/236 (8%)

Query: 469  IEFKNVSFAYPTRPSNM-IFKNLNFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPS--S 525
              +KN+ +  P +     I  N++  ++ G+   ++G SG GK+T+   L +       +
Sbjct: 923  FHWKNLCYDIPIKNGKRRILDNVDGWVKPGTLTALIGASGAGKTTLLDCLAERTTMGLIT 982

Query: 526  GEILIDGQNINDLNSKSLRRHIGLVQQEPI-LMSGTIRDNIVYGLTEMPTKDEIRQVAKQ 584
            G++ +DG+       +S  R IG  QQ+ + L + T+R+++ +    +   D++    K 
Sbjct: 983  GDVFVDGRP----RDQSFPRSIGYCQQQDLHLKTATVRESLRFS-AYLRQADDVSIEEKD 1037

Query: 585  CFCHNFITRFQSSY--DTVIGPHGTLLSGGQKQRIAIARALIKKPRILI-LDEATSALDV 641
             +    I   +     D ++G  G  L+  Q++R+ I   L  KP++L+ LDE TS LD 
Sbjct: 1038 KYVEEVIEVLEMKLYADAIVGVPGEGLNVEQRKRLTIGVELAAKPKLLVFLDEPTSGLDS 1097

Query: 642  ESEGAINYTFGQLMKK---KEMTIVSIAHRLSTIRRSE--NVIVLGHDGSVVEMGK 692
            ++     ++  QLMKK   +   I+   H+ S +   E   ++ L   G  V  G+
Sbjct: 1098 QTA----WSTCQLMKKLASRGQAILCTIHQPSALLMQEFDRLLFLQEGGQTVYFGE 1149

>KAFR0E03480 Chr5 complement(701160..705818) [4659 bp, 1552 aa] {ON} 
          Length = 1552

 Score = 63.5 bits (153), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 65/223 (29%), Positives = 106/223 (47%), Gaps = 32/223 (14%)

Query: 486  IFKNLNFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPS--SGEILIDGQNINDLNSKSL 543
            I  N++  ++ G+   ++G SG GK+T+   L +       +G I +DG+    L  +S 
Sbjct: 920  ILNNVDGWVKPGTLTALMGASGAGKTTLLDCLAERVTMGVITGNIFVDGR----LRDESF 975

Query: 544  RRHIGLVQQEPI-LMSGTIRDNIVY-GLTEMP---TKDE----IRQVAKQCFCHNFITRF 594
             R IG  QQ+ + L + T+R+++ +      P   TK+E    I QV K       I   
Sbjct: 976  PRSIGYCQQQDLHLKTATVRESLRFSAYLRQPASVTKEEKDRYIEQVIK-------ILEM 1028

Query: 595  QSSYDTVIGPHGTLLSGGQKQRIAIARALIKKPRILI-LDEATSALDVESEGAINYTFGQ 653
            ++  D V+G  G  L+  Q +R+ I   L  KP++L+ LDE TS LD ++     ++  Q
Sbjct: 1029 ETYADAVVGVPGEGLNVEQGKRLTIGVELAAKPKLLVFLDEPTSGLDSQTA----WSTCQ 1084

Query: 654  LMKK---KEMTIVSIAHRLSTIRRSE--NVIVLGHDGSVVEMG 691
            LM+K       I+   H+ S I   E   ++ L   G  V  G
Sbjct: 1085 LMRKLANHGQAILCTIHQPSAILMQEFDRLLFLQKGGKTVYFG 1127

>TDEL0A03640 Chr1 (646252..650781) [4530 bp, 1509 aa] {ON} Anc_5.500
            YDR406W
          Length = 1509

 Score = 63.5 bits (153), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 61/220 (27%), Positives = 103/220 (46%), Gaps = 18/220 (8%)

Query: 486  IFKNLNFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPS--SGEILIDGQNINDLNSKSL 543
            I  N++  ++ G+   ++G SG GK+T+   L         +GEI ++G+    L  +S 
Sbjct: 881  ILNNVDGWVKPGTLTALMGASGAGKTTLLDCLADRTTMGVITGEIFVNGR----LRDESF 936

Query: 544  RRHIGLVQQEPI-LMSGTIRDNIVY-GLTEMPTKDEIRQVAKQCFCHNFITRFQSSYDTV 601
             R IG  QQ+ + L + T+R+++ +      P K  I +  K       I   +   D V
Sbjct: 937  PRTIGYCQQQDLHLKTSTVRESLRFSAYLRQPAKVSIEEKNKYVEEVIKILEMEHYADAV 996

Query: 602  IGPHGTLLSGGQKQRIAIARALIKKPRILI-LDEATSALDVESEGAINYTFGQLMKK--- 657
            +G  G  L+  Q++R+ I   L+ KP +L+ LDE TS LD ++  +I     QLM+K   
Sbjct: 997  VGVAGEGLNVEQRKRLTIGVELVAKPALLVFLDEPTSGLDSQTAWSI----CQLMRKLAN 1052

Query: 658  KEMTIVSIAHRLSTIRRSE--NVIVLGHDGSVVEMGKFKE 695
                I+   H+ S +   E   ++ +   G  V  G   E
Sbjct: 1053 HGQAILCTIHQPSAMLMQEFDRLLFMRRGGETVYFGDLGE 1092

>Smik_7.313 Chr7 (524077..526335) [2259 bp, 752 aa] {ON} YFR009W
           (REAL)
          Length = 752

 Score = 63.2 bits (152), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 56/232 (24%), Positives = 102/232 (43%), Gaps = 52/232 (22%)

Query: 469 IEFKNVSFAYPTRPSNMIFKNLNFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPSSGEI 528
           I+ ++VSF Y  +  N++ K++N  ++  S + +VG +G GK+T+  ++ +  +P  G +
Sbjct: 532 IQLQDVSFGYDEK--NLLLKDVNLDVQMDSRIALVGANGCGKTTLLKIMMEQLRPLKGFV 589

Query: 529 LIDGQNINDLNSKSLRRHIGLVQQEPILMSGTIRDNIVYGLTEMPTKDEIRQVAKQCFCH 588
                      S++ R  IG   Q  +       D++           ++   A      
Sbjct: 590 -----------SRNPRLRIGYFTQHHV-------DSM-----------DLTTSAVDWMSK 620

Query: 589 NFITRFQSSYDTVIGPHG----------TLLSGGQKQRIAIARALIKKPRILILDEATSA 638
           +F  +    Y   +G  G           LLSGGQK R+A A   +  P IL+LDE ++ 
Sbjct: 621 SFPGKTDEEYRRHLGSFGITGTLGLQKMQLLSGGQKSRVAFAALCLNNPHILVLDEPSNH 680

Query: 639 LDVESEGAI-----NYTFGQLMKKKEMTIV-SIAHRL-----STIRRSENVI 679
           LD     A+     N+  G LM   +++++ S+   +      T++R E  I
Sbjct: 681 LDTTGLDALVDALKNFNGGVLMVSHDISVIDSVCKEIWVSEQGTVKRFEGTI 732

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 44/76 (57%), Gaps = 4/76 (5%)

Query: 609 LSGGQKQRIAIARALIKKPRILILDEATSALDVESEGAINYTFGQLMKKKEMTIVSIAHR 668
            SGG + R+++ARAL  +P +L+LDE ++ LDV S   I Y   + +K    T+++++H 
Sbjct: 368 FSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPS---IAY-LAEYLKTYPNTVLTVSHD 423

Query: 669 LSTIRRSENVIVLGHD 684
            + +      I+  H+
Sbjct: 424 RAFLNEVATDIIYQHN 439

>YFR009W Chr6 (162488..164746) [2259 bp, 752 aa] {ON}  GCN20Positive
           regulator of the Gcn2p kinase activity, forms a complex
           with Gcn1p; proposed to stimulate Gcn2p activation by an
           uncharged tRNA
          Length = 752

 Score = 63.2 bits (152), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 57/232 (24%), Positives = 101/232 (43%), Gaps = 52/232 (22%)

Query: 469 IEFKNVSFAYPTRPSNMIFKNLNFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPSSGEI 528
           I+ ++VSF Y    +N++ K++N  ++  S + +VG +G GK+T+  ++ +  +P  G +
Sbjct: 532 IQLQDVSFGYD--ENNLLLKDVNLDVQMDSRIALVGANGCGKTTLLKIMMEQLRPLKGFV 589

Query: 529 LIDGQNINDLNSKSLRRHIGLVQQEPILMSGTIRDNIVYGLTEMPTKDEIRQVAKQCFCH 588
                      S++ R  IG   Q  +       D++           ++   A      
Sbjct: 590 -----------SRNPRLRIGYFTQHHV-------DSM-----------DLTTSAVDWMSK 620

Query: 589 NFITRFQSSYDTVIGPHG----------TLLSGGQKQRIAIARALIKKPRILILDEA--- 635
           +F  +    Y   +G  G           LLSGGQK R+A A   +  P IL+LDE    
Sbjct: 621 SFPGKTDEEYRRHLGSFGITGTLGLQKMQLLSGGQKSRVAFAALCLNNPHILVLDEPSNH 680

Query: 636 --TSALDVESEGAINYTFGQLMKKKEMTIV-SIAHRL-----STIRRSENVI 679
             T+ LD   E   N+  G LM   +++++ S+   +      T++R E  I
Sbjct: 681 LDTTGLDALVEALKNFNGGVLMVSHDISVIDSVCKEIWVSEQGTVKRFEGTI 732

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 44/76 (57%), Gaps = 4/76 (5%)

Query: 609 LSGGQKQRIAIARALIKKPRILILDEATSALDVESEGAINYTFGQLMKKKEMTIVSIAHR 668
            SGG + R+++ARAL  +P +L+LDE ++ LDV S   I Y   + +K    T+++++H 
Sbjct: 368 FSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPS---IAY-LAEYLKTYPNTVLTVSHD 423

Query: 669 LSTIRRSENVIVLGHD 684
            + +      I+  H+
Sbjct: 424 RAFLNEVATDIIYQHN 439

>YER036C Chr5 complement(223367..225199) [1833 bp, 610 aa] {ON}
           ARB1ATPase of the ATP-binding cassette (ABC) family
           involved in 40S and 60S ribosome biogenesis, has
           similarity to Gcn20p; shuttles from nucleus to
           cytoplasm, physically interacts with Tif6p, Lsg1p
          Length = 610

 Score = 62.8 bits (151), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 42/174 (24%), Positives = 83/174 (47%), Gaps = 19/174 (10%)

Query: 469 IEFKNVSFAYPTRPSNMIFKNLNFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPSSGEI 528
           + F ++SF Y + PS  ++++LNF ++  S + +VGP+G GKST+  ++     P SG +
Sbjct: 393 LAFDDISFHYESNPSENLYEHLNFGVDMDSRIALVGPNGVGKSTLLKIMTGELTPQSGRV 452

Query: 529 LIDGQNINDLNSKSLRRHIGLVQQEPILMSGTIRDNIVYGLTEMPTKDEIRQVAKQC-FC 587
                      S+     +G+  Q         +  + +       +D+   +++   F 
Sbjct: 453 -----------SRHTHVKLGVYSQHSQDQLDLTKSALEF------VRDKYSNISQDFQFW 495

Query: 588 HNFITRFQSSYDTVIGPHGTLLSGGQKQRIAIARALIKKPRILILDEATSALDV 641
              + R+  + +       T LS GQ+ R+  A   +++P +L+LDE T+ LD+
Sbjct: 496 RGQLGRYGLTGEGQTVQMAT-LSEGQRSRVVFALLALEQPNVLLLDEPTNGLDI 548

 Score = 45.4 bits (106), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 39/59 (66%), Gaps = 4/59 (6%)

Query: 609 LSGGQKQRIAIARALIKKPRILILDEATSALDVESEGAINYTFGQLMKKKEMTIVSIAH 667
           +SGG K R+A+A+AL  KP +L+LD+ T+ LD+E+         + +K+ + T+V ++H
Sbjct: 227 MSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEA----CVWLEEYLKRFDRTLVLVSH 281

>Ecym_8014 Chr8 (37756..42309) [4554 bp, 1517 aa] {ON} similar to
            Ashbya gossypii AFR326WABR125C/AGL142C/ABR126W
          Length = 1517

 Score = 63.2 bits (152), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 57/235 (24%), Positives = 114/235 (48%), Gaps = 21/235 (8%)

Query: 469  IEFKNVSFAYPTRPSN-MIFKNLNFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPS--S 525
              ++NV ++   +  N +I  +++  ++ G+   ++G SG GK+T+   L         +
Sbjct: 868  FHWRNVCYSVKIKDENRLILDHVDGWVKPGTLTALMGASGAGKTTLLDCLASRVTTGVLT 927

Query: 526  GEILIDGQNINDLNSKSLRRHIGLVQQEPI-LMSGTIRDNIVYGL-----TEMPTKDEIR 579
            G + ++G    +L  KS  R IG  QQ+ + L + T+++++ +        ++P +++ R
Sbjct: 928  GSMFVNG----NLRDKSFPRSIGYCQQQDLHLSTATVKESLRFSAYLRQSADIPKEEKDR 983

Query: 580  QVAKQCFCHNFITRFQSSYDTVIGPHGTLLSGGQKQRIAIARALIKKPRILI-LDEATSA 638
             V +       I   +   D V+G  G  L+  Q++R+ I   L+ KP++L+ LDE TS 
Sbjct: 984  YVDEVIK----ILDMEQYVDAVVGVAGEGLNVEQRKRLTIGVELVAKPKLLLFLDEPTSG 1039

Query: 639  LDVESEGAINYTFGQLMKKKEMTIVSIAHRLSTIRRSE--NVIVLGHDGSVVEMG 691
            LD ++  +I      L    +  + +I H+ S +   E   +++L   G  V  G
Sbjct: 1040 LDSQTAWSICQLMRSLADHGQAVLCTI-HQPSALLMQEFDRLLLLQKHGQTVYFG 1093

>Skud_5.145 Chr5 complement(221173..223005) [1833 bp, 610 aa] {ON}
           YER036C (REAL)
          Length = 610

 Score = 62.4 bits (150), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 42/174 (24%), Positives = 83/174 (47%), Gaps = 19/174 (10%)

Query: 469 IEFKNVSFAYPTRPSNMIFKNLNFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPSSGEI 528
           + F ++SF Y + PS  ++++LNF ++  S + +VGP+G GKST+  ++     P SG +
Sbjct: 393 LAFDDISFHYESNPSENLYEHLNFGVDMDSRIALVGPNGVGKSTLLKIMTGELTPQSGRV 452

Query: 529 LIDGQNINDLNSKSLRRHIGLVQQEPILMSGTIRDNIVYGLTEMPTKDEIRQVAKQC-FC 587
                      S+     +G+  Q         +  + +       +D+   +++   F 
Sbjct: 453 -----------SRHTHVKLGVYSQHSQDQLDLTKSALEF------VRDKYSNISQDFQFW 495

Query: 588 HNFITRFQSSYDTVIGPHGTLLSGGQKQRIAIARALIKKPRILILDEATSALDV 641
              + R+  + +       T LS GQ+ R+  A   +++P +L+LDE T+ LD+
Sbjct: 496 RGQLGRYGLTGEGQTVQMAT-LSEGQRSRVVFALLALEQPNVLLLDEPTNGLDI 548

 Score = 45.1 bits (105), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 39/59 (66%), Gaps = 4/59 (6%)

Query: 609 LSGGQKQRIAIARALIKKPRILILDEATSALDVESEGAINYTFGQLMKKKEMTIVSIAH 667
           +SGG K R+A+A+AL  KP +L+LD+ T+ LD+E+         + +K+ + T+V ++H
Sbjct: 227 MSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEA----CVWLEEYLKRFDRTLVLVSH 281

>Smik_5.159 Chr5 complement(228179..230011) [1833 bp, 610 aa] {ON}
           YER036C (REAL)
          Length = 610

 Score = 62.4 bits (150), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 42/174 (24%), Positives = 83/174 (47%), Gaps = 19/174 (10%)

Query: 469 IEFKNVSFAYPTRPSNMIFKNLNFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPSSGEI 528
           + F ++SF Y + PS  ++++LNF ++  S + +VGP+G GKST+  ++     P SG +
Sbjct: 393 LAFDDISFHYESNPSENLYEHLNFGVDMDSRIALVGPNGVGKSTLLKIMTGELTPQSGRV 452

Query: 529 LIDGQNINDLNSKSLRRHIGLVQQEPILMSGTIRDNIVYGLTEMPTKDEIRQVAKQC-FC 587
                      S+     +G+  Q         +  + +       +D+   +++   F 
Sbjct: 453 -----------SRHTHVKLGVYSQHSQDQLDLTKSALEF------VRDKYSNISQDFQFW 495

Query: 588 HNFITRFQSSYDTVIGPHGTLLSGGQKQRIAIARALIKKPRILILDEATSALDV 641
              + R+  + +       T LS GQ+ R+  A   +++P +L+LDE T+ LD+
Sbjct: 496 RGQLGRYGLTGEGQTVQMAT-LSEGQRSRVVFALLALEQPNVLLLDEPTNGLDI 548

 Score = 45.1 bits (105), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 39/59 (66%), Gaps = 4/59 (6%)

Query: 609 LSGGQKQRIAIARALIKKPRILILDEATSALDVESEGAINYTFGQLMKKKEMTIVSIAH 667
           +SGG K R+A+A+AL  KP +L+LD+ T+ LD+E+         + +K+ + T+V ++H
Sbjct: 227 MSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEA----CVWLEEYLKRFDRTLVLVSH 281

>Kpol_1050.26 s1050 complement(62452..64284) [1833 bp, 610 aa] {ON}
           complement(62452..64284) [1833 nt, 611 aa]
          Length = 610

 Score = 62.4 bits (150), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 42/174 (24%), Positives = 84/174 (48%), Gaps = 19/174 (10%)

Query: 469 IEFKNVSFAYPTRPSNMIFKNLNFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPSSGEI 528
           + F ++SFAY     N +++NLNF ++  S + +VGP+G GKST+  ++    +  +G +
Sbjct: 393 LSFDDISFAYDGNKENNLYQNLNFGVDMDSRIALVGPNGVGKSTLLKIMTGELQAQAGRV 452

Query: 529 LIDGQNINDLNSKSLRRHIGLVQQEPILMSGTIRDNIVYGLTEMPTKDEIRQVAKQC-FC 587
                      S+     +G+  Q         +  + +       +D+  Q+++   + 
Sbjct: 453 -----------SRHTHVKLGVYSQHSQDQLDLTKSALEF------VRDKYPQISQDFQYW 495

Query: 588 HNFITRFQSSYDTVIGPHGTLLSGGQKQRIAIARALIKKPRILILDEATSALDV 641
              + R+  + +      GT LS GQ+ R+  A   +++P +L+LDE T+ LD+
Sbjct: 496 RGQLGRYGLTGEGQTVQMGT-LSEGQRSRVVFALLALEQPNVLLLDEPTNGLDI 548

 Score = 45.1 bits (105), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 39/59 (66%), Gaps = 4/59 (6%)

Query: 609 LSGGQKQRIAIARALIKKPRILILDEATSALDVESEGAINYTFGQLMKKKEMTIVSIAH 667
           +SGG K R+A+A+AL  KP +L+LD+ T+ LD+E+         + +K+ + T+V ++H
Sbjct: 227 MSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEA----CVWLEEYLKRFDRTLVLVSH 281

>Suva_8.379 Chr8 (672487..677184) [4698 bp, 1565 aa] {ON} YPL058C
            (REAL)
          Length = 1565

 Score = 62.8 bits (151), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 57/221 (25%), Positives = 107/221 (48%), Gaps = 20/221 (9%)

Query: 486  IFKNLNFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPS--SGEILIDGQNINDLNSKSL 543
            I  N++  +  G+   ++G SG GK+T+   L +       +G++ +DG+  ++    S 
Sbjct: 942  ILDNVDGWVRPGTLTALIGASGAGKTTLLDCLAERTTMGVITGDVFVDGRPRDE----SF 997

Query: 544  RRHIGLVQQEPI-LMSGTIRDNIVYGLTEMPTKDEIRQVAKQCFCHNFITRFQSSY--DT 600
             R IG  QQ+ + L + T+R+++ +    +   D++    K  +    I   +     D 
Sbjct: 998  PRSIGYCQQQDLHLKTATVRESLRFS-AYLRQPDDVSIEKKDKYVEEVIKVLEMELYADA 1056

Query: 601  VIGPHGTLLSGGQKQRIAIARALIKKPRILI-LDEATSALDVESEGAINYTFGQLMKK-- 657
            ++G  G  L+  Q++R+ I   L  KP++L+ LDE TS LD ++     ++  QLMKK  
Sbjct: 1057 IVGVPGEGLNVEQRKRLTIGVELAAKPKLLVFLDEPTSGLDSQTA----WSTCQLMKKLT 1112

Query: 658  -KEMTIVSIAHRLSTIRRSE--NVIVLGHDGSVVEMGKFKE 695
             +   I+   H+ S +   E   ++ L + G  V  G+  E
Sbjct: 1113 ARGQAILCTIHQPSALLMQEFDRLLFLQYGGQTVYFGELGE 1153

>KAFR0E03460 Chr5 complement(695361..700001) [4641 bp, 1546 aa] {ON} 
          Length = 1546

 Score = 62.8 bits (151), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 63/223 (28%), Positives = 106/223 (47%), Gaps = 32/223 (14%)

Query: 486  IFKNLNFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPS--SGEILIDGQNINDLNSKSL 543
            +  N++  ++ G+   ++G SG GK+T+   L +       +G I +DG+    L  +S 
Sbjct: 921  LLSNVDGWVKPGTLTALMGASGAGKTTLLDCLAERVTMGVITGNIFVDGR----LRDESF 976

Query: 544  RRHIGLVQQEPI-LMSGTIRDNIVY-GLTEMP---TKDE----IRQVAKQCFCHNFITRF 594
             R IG  QQ+ + L + T+R+++ +      P   +K+E    + QV K       I   
Sbjct: 977  PRSIGYCQQQDLHLKTATVRESLRFSAYLRQPASVSKEEKDHYVEQVIK-------ILEM 1029

Query: 595  QSSYDTVIGPHGTLLSGGQKQRIAIARALIKKPRILI-LDEATSALDVESEGAINYTFGQ 653
            ++  D V+G  G  L+  Q++R+ I   L  KP++L+ LDE TS LD ++  A      Q
Sbjct: 1030 ETYADAVVGVPGEGLNVEQRKRLTIGVELAAKPKLLVFLDEPTSGLDSQTAWAT----CQ 1085

Query: 654  LMKK---KEMTIVSIAHRLSTIRRSE--NVIVLGHDGSVVEMG 691
            LM+K       I+   H+ S I   E   ++ L   G  V  G
Sbjct: 1086 LMRKLANHGQAILCTIHQPSAILMQEFDRLLFLQKGGQTVYFG 1128

>NDAI0I03020 Chr9 complement(713821..715650) [1830 bp, 609 aa] {ON}
           Anc_3.534
          Length = 609

 Score = 62.0 bits (149), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 42/173 (24%), Positives = 82/173 (47%), Gaps = 17/173 (9%)

Query: 469 IEFKNVSFAYPTRPSNMIFKNLNFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPSSGEI 528
           + F ++SF+Y   P + +++NL+F ++  S + +VGP+G GKST+  ++     P SG +
Sbjct: 392 LAFDSISFSYDGNPEHNLYENLDFGVDMDSRIALVGPNGVGKSTLLKIMTGELMPQSGRV 451

Query: 529 LIDGQNINDLNSKSLRRHIGLVQQEPILMSGTIRDNIVYGLTEMPTKDEIRQVAKQCFCH 588
                      S+     +G+  Q         +  + +   + P   +  Q     +  
Sbjct: 452 -----------SRHTHVKLGVYSQHSQDQLDLTKSALEFVRDKYPNISQDFQ-----YWR 495

Query: 589 NFITRFQSSYDTVIGPHGTLLSGGQKQRIAIARALIKKPRILILDEATSALDV 641
             + R+  + +      GT LS GQ+ R+  A   +++P +L+LDE T+ LD+
Sbjct: 496 GQLGRYGLTGEGQTVQMGT-LSEGQRSRVVFALLALEQPNVLLLDEPTNGLDI 547

 Score = 45.4 bits (106), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 39/59 (66%), Gaps = 4/59 (6%)

Query: 609 LSGGQKQRIAIARALIKKPRILILDEATSALDVESEGAINYTFGQLMKKKEMTIVSIAH 667
           +SGG K R+A+A+AL  KP +L+LD+ T+ LD+E+         + +K+ + T+V ++H
Sbjct: 226 MSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEA----CVWLEEYLKRFDRTLVLVSH 280

>ZYRO0D11836g Chr4 (993707..998095) [4389 bp, 1462 aa] {ON} similar to
            uniprot|Q04182 Saccharomyces cerevisiae YDR406W PDR15 ATP
            binding cassette (ABC) transporter of the plasma membrane
            general stress response factor implicated in cellular
            detoxification target of Pdr1p Pdr3p and Pdr8p
            transcription regulators promoter contains a PDR
            responsive element
          Length = 1462

 Score = 62.4 bits (150), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 58/219 (26%), Positives = 106/219 (48%), Gaps = 24/219 (10%)

Query: 486  IFKNLNFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPS--SGEILIDGQNINDLNSKSL 543
            I  N++  ++ G+   ++G +G GK+T+   L +       +G I +DG+    L  +S 
Sbjct: 837  ILDNIDGWVKPGTLTALMGATGAGKTTLLDSLAQRVTTGVLTGSIFVDGK----LRDESF 892

Query: 544  RRHIGLVQQEPI-LMSGTIRDNIVY-GLTEMPTK---DEIRQVAKQCFCHNFITRFQSSY 598
             R IG  QQ+ + L + T+R+++++  +   P      E R+  ++      +   +   
Sbjct: 893  ARSIGYCQQQDLHLTTATVRESLLFSAMLRQPKSVPASEKRKYVEEVIN---VLEMEPYA 949

Query: 599  DTVIGPHGTLLSGGQKQRIAIARALIKKPRILI-LDEATSALDVESEGAINYTFGQLMKK 657
            D ++G  G  L+  Q++R+ I   L  KP +L+ LDE TS LD ++  +I     QLMKK
Sbjct: 950  DAIVGVAGEGLNVEQRKRLTIGVELAAKPNLLLFLDEPTSGLDSQTAWSI----CQLMKK 1005

Query: 658  ---KEMTIVSIAHRLST--IRRSENVIVLGHDGSVVEMG 691
               +   I+   H+ S   I+  + ++ L   G  V  G
Sbjct: 1006 LANRGQAILCTIHQPSAMLIQEFDRLLFLQKGGQTVYFG 1044

>Smik_15.333 Chr15 (575791..580323) [4533 bp, 1510 aa] {ON} YOR153W
            (REAL)
          Length = 1510

 Score = 62.4 bits (150), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 61/220 (27%), Positives = 102/220 (46%), Gaps = 18/220 (8%)

Query: 486  IFKNLNFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPS--SGEILIDGQNINDLNSKSL 543
            I  N++  ++ G+   ++G SG GK+T+   L +       +G+I +DG        KS 
Sbjct: 886  ILNNVDGWVKPGTLTALMGASGAGKTTLLDCLAERVTMGVITGDIFVDGIP----RDKSF 941

Query: 544  RRHIGLVQQEPI-LMSGTIRDNIVY-GLTEMPTKDEIRQVAKQCFCHNFITRFQSSYDTV 601
             R IG  QQ+ + L + T+R+++ +      P +  I +  +       I   +   D V
Sbjct: 942  PRSIGYCQQQDLHLKTATVRESLRFSAYLRQPAEVSIEEKDRYVEEVIKILEMEKYADAV 1001

Query: 602  IGPHGTLLSGGQKQRIAIARALIKKPRILI-LDEATSALDVESEGAINYTFGQLMKK--- 657
            +G  G  L+  Q++R+ I   L  KP++L+ LDE TS LD ++  +I     QLMKK   
Sbjct: 1002 VGIAGEGLNVEQRKRLTIGVELTAKPKLLVFLDEPTSGLDSQTAWSI----CQLMKKLAN 1057

Query: 658  KEMTIVSIAHRLSTIRRSE--NVIVLGHDGSVVEMGKFKE 695
                I+   H+ S I   E   ++ +   G  V  G   E
Sbjct: 1058 HGQAILCTIHQPSAILMQEFDRLLFMQRGGKTVYFGDLGE 1097

>Skud_4.262 Chr4 (456192..460697) [4506 bp, 1501 aa] {ON} YDR011W
            (REAL)
          Length = 1501

 Score = 62.4 bits (150), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 61/238 (25%), Positives = 116/238 (48%), Gaps = 24/238 (10%)

Query: 467  GEIEFKNVSFAYPTRPSN-MIFKNLNFKIEAGSNVCIVGPSGRGKSTVA-LLLEKYYKPS 524
            G   +K+V F  P   S  M+  N++     G+   ++G SG GK+T+   L ++     
Sbjct: 851  GVFIWKDVCFTIPYEGSTRMLLDNVSGYCVPGTMTALMGESGAGKTTLLNTLAQRNVGII 910

Query: 525  SGEILIDGQNINDLNSKSLRRHIGLVQQEPILMSG-TIRDNIVYGL-----TEMPTKDEI 578
            +G++L++G+ I+     S  R  G VQQ+ I ++  T+R+++ +         +P  +++
Sbjct: 911  TGDMLVNGRPID----ASFERRTGYVQQQDIHIAELTVRESLQFSARMRRPQRLPDSEKM 966

Query: 579  RQVAKQCFCHNFITR---FQSSYDTVIGPHGTLLSGGQKQRIAIARALIKKPRILI-LDE 634
              V K       I R    +   + ++G  G  L+  Q+++++I   L+ KP +L+ LDE
Sbjct: 967  EYVEK-------IIRVLGMEEYAEALVGEVGCGLNVEQRKKLSIGVELVAKPDLLLFLDE 1019

Query: 635  ATSALDVESEGAINYTFGQLMKKKEMTIVSIAHRLSTI-RRSENVIVLGHDGSVVEMG 691
             TS LD +S  AI     +L K  +  + +I    +T+    + +++L   G  V  G
Sbjct: 1020 PTSGLDSQSSWAIIQLLRKLSKAGQSILCTIHQPSATLFEEFDRLLLLKKGGQTVYFG 1077

 Score = 40.0 bits (92), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 44/175 (25%), Positives = 80/175 (45%), Gaps = 13/175 (7%)

Query: 486 IFKNLNFKIEAGSNVCIVGPSGRGKST----VALLLEKYYKPSSGEILIDGQNINDLNSK 541
           I  N+N   EAG  + ++G  G G S+     A  ++++    SG+I  DG    ++  +
Sbjct: 175 IICNVNALAEAGEMILVLGRPGAGCSSFLKVTAGEIDQFAGGVSGDIAYDGIPQKEMMKR 234

Query: 542 SLRRHIGLVQQEPILMSGTIRDNIVYGLTEMPTKDEIRQVAKQCFC----HNFITRF--Q 595
                I   + +      T++  + + +        +  V+K+ +     H + T F  +
Sbjct: 235 YKADVIYNGELDVHFPYLTVKQTLDFAIACKTPALRVNNVSKEEYIASRRHLYATIFGLR 294

Query: 596 SSYDTVIGPHGTL-LSGGQKQRIAIARALIKKPRILILDEATSALDVESEGAINY 649
            +Y+T +G      +SGG+++R++IA AL  K  I   D AT  LD  S  A+ Y
Sbjct: 295 HTYNTKVGNDFVRGVSGGERKRVSIAEALAAKGSIYCWDNATRGLD--SSTALEY 347

>KAFR0J02700 Chr10 complement(515978..517804) [1827 bp, 608 aa] {ON}
           Anc_3.534 YER036C
          Length = 608

 Score = 62.0 bits (149), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 41/174 (23%), Positives = 87/174 (50%), Gaps = 19/174 (10%)

Query: 469 IEFKNVSFAYPTRPSNMIFKNLNFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPSSGEI 528
           + F N+SFAY   P + +++NL+F ++  S + +VGP+G GKST+  ++       +G++
Sbjct: 391 LAFDNISFAYDGNPEHNLYENLDFGVDMDSRIALVGPNGVGKSTLLKIM-------TGQL 443

Query: 529 LIDGQNINDLNSKSLRRHIGLVQQEPILMSGTIRDNIVYGLTEMPTKDEIRQVAKQC-FC 587
           +     +    S+     +G+  Q         +  + +       +D+   +++   + 
Sbjct: 444 MAQAGRV----SRHTHVKLGVYSQHSQDQLDLTKSALEF------VRDKYSSISQDFQYW 493

Query: 588 HNFITRFQSSYDTVIGPHGTLLSGGQKQRIAIARALIKKPRILILDEATSALDV 641
              + R+  + ++     GT LS GQ+ R+  A   +++P +L+LDE T+ LD+
Sbjct: 494 RGQLGRYGLTGESQTVQMGT-LSEGQRSRVVFALLALEQPNVLLLDEPTNGLDI 546

 Score = 45.1 bits (105), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 39/59 (66%), Gaps = 4/59 (6%)

Query: 609 LSGGQKQRIAIARALIKKPRILILDEATSALDVESEGAINYTFGQLMKKKEMTIVSIAH 667
           +SGG K R+A+A+AL  KP +L+LD+ T+ LD+E+         + +K+ + T+V ++H
Sbjct: 225 MSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEA----CVWLEEYLKRFDRTLVLVSH 279

>YDR406W Chr4 (1279210..1283799) [4590 bp, 1529 aa] {ON}  PDR15Plasma
            membrane ATP binding cassette (ABC) transporter,
            multidrug transporter and general stress response factor
            implicated in cellular detoxification; regulated by
            Pdr1p, Pdr3p and Pdr8p; promoter contains a PDR
            responsive element
          Length = 1529

 Score = 62.4 bits (150), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 59/220 (26%), Positives = 104/220 (47%), Gaps = 18/220 (8%)

Query: 486  IFKNLNFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPS--SGEILIDGQNINDLNSKSL 543
            I  N++  ++ G+   ++G SG GK+T+   L +       +G I +DG+    L  +S 
Sbjct: 902  ILNNVDGWVKPGTLTALMGASGAGKTTLLDCLAERVTMGVITGNIFVDGR----LRDESF 957

Query: 544  RRHIGLVQQEPI-LMSGTIRDNIVY-GLTEMPTKDEIRQVAKQCFCHNFITRFQSSYDTV 601
             R IG  QQ+ + L + T+R+++ +      P+   I +  +       I   Q   D V
Sbjct: 958  PRSIGYCQQQDLHLKTATVRESLRFSAYLRQPSSVSIEEKNRYVEEVIKILEMQQYSDAV 1017

Query: 602  IGPHGTLLSGGQKQRIAIARALIKKPRILI-LDEATSALDVESEGAINYTFGQLMKK--- 657
            +G  G  L+  Q++R+ I   L  +P++L+ LDE TS LD ++     +   QLM+K   
Sbjct: 1018 VGVAGEGLNVEQRKRLTIGVELAARPKLLVFLDEPTSGLDSQTA----WDTCQLMRKLAT 1073

Query: 658  KEMTIVSIAHRLSTI--RRSENVIVLGHDGSVVEMGKFKE 695
                I+   H+ S I  ++ + ++ L   G  V  G   E
Sbjct: 1074 HGQAILCTIHQPSAILMQQFDRLLFLQKGGQTVYFGDLGE 1113

>NCAS0E01630 Chr5 complement(308563..313260) [4698 bp, 1565 aa] {ON} 
          Length = 1565

 Score = 62.0 bits (149), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 58/237 (24%), Positives = 114/237 (48%), Gaps = 13/237 (5%)

Query: 467  GEIEFKNVSFAYP-TRPSNMIFKNLNFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPS- 524
            G   +K V +  P  R   M+  +++     G+   ++G SG GK+T+   L K  +   
Sbjct: 910  GVFLWKEVCYTIPYERGKRMLLDHVSGYCVPGTLTALMGESGAGKTTLLNTLAKRNEIGV 969

Query: 525  -SGEILIDGQNINDLNSKSLRRHIGLVQQEPILMSG-TIRDNIVYGLTEMPTKDEIRQVA 582
             +G++L++G+ ++     S  R  G VQQ+ I ++  T+R+++ +    M   + +    
Sbjct: 970  VTGDMLVNGRPVD----ASFERRTGYVQQQDIHIAELTVRESLQFS-ARMRRSEHVSDEE 1024

Query: 583  KQCFCHNFI--TRFQSSYDTVIGPHGTLLSGGQKQRIAIARALIKKPRILI-LDEATSAL 639
            K  +    I     +   D ++G  G  L+  Q+++++I   L+ KP +L+ LDE TS L
Sbjct: 1025 KLAYVEKIIRVLEMEEFADALVGAIGCGLNVEQRKKLSIGVELVAKPDLLLFLDEPTSGL 1084

Query: 640  DVESEGAINYTFGQLMKKKEMTIVSIAHRLSTI-RRSENVIVLGHDGSVVEMGKFKE 695
            D +S  AI     +L +  +  + +I    +T+  + + +++L   G  V  G   E
Sbjct: 1085 DSQSSWAIVQLLRKLAQAGQSILCTIHQPSATLFEQFDRLLLLKKGGQTVYFGDIGE 1141

>Skud_4.680 Chr4 (1201243..1205580) [4338 bp, 1445 aa] {ON} YDR406W
            (REAL)
          Length = 1445

 Score = 62.0 bits (149), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 59/220 (26%), Positives = 104/220 (47%), Gaps = 18/220 (8%)

Query: 486  IFKNLNFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPS--SGEILIDGQNINDLNSKSL 543
            I  N+N  ++ G+   ++G SG GK+T+   L +       +G I +DG+    L  +S 
Sbjct: 818  ILNNVNGWVKPGTLTALMGASGAGKTTLLDCLAERVTMGVITGGIFVDGR----LRDESF 873

Query: 544  RRHIGLVQQEPI-LMSGTIRDNIVY-GLTEMPTKDEIRQVAKQCFCHNFITRFQSSYDTV 601
             R IG  QQ+ + L + T+R+++ +      P+   + +  K       I   +   D V
Sbjct: 874  PRSIGYCQQQDLHLKTATVRESLRFSAYLRQPSSVSVEEKNKYVEEVIKILEMEKYSDAV 933

Query: 602  IGPHGTLLSGGQKQRIAIARALIKKPRILI-LDEATSALDVESEGAINYTFGQLMKK--- 657
            +G  G  L+  Q++R+ I   L  +P++L+ LDE TS LD ++     +   QLM+K   
Sbjct: 934  VGIAGEGLNVEQRKRLTIGVELAARPKLLVFLDEPTSGLDSQTA----WDTCQLMRKLAT 989

Query: 658  KEMTIVSIAHRLSTI--RRSENVIVLGHDGSVVEMGKFKE 695
                I+   H+ S I  ++ + ++ L   G  V  G   E
Sbjct: 990  HGQAILCTIHQPSAILMQQFDRLLFLQRGGQTVYFGDLGE 1029

>Skud_4.681 Chr4 (1201243..1205580) [4338 bp, 1445 aa] {ON} YDR406W
            (REAL)
          Length = 1445

 Score = 62.0 bits (149), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 59/220 (26%), Positives = 104/220 (47%), Gaps = 18/220 (8%)

Query: 486  IFKNLNFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPS--SGEILIDGQNINDLNSKSL 543
            I  N+N  ++ G+   ++G SG GK+T+   L +       +G I +DG+    L  +S 
Sbjct: 818  ILNNVNGWVKPGTLTALMGASGAGKTTLLDCLAERVTMGVITGGIFVDGR----LRDESF 873

Query: 544  RRHIGLVQQEPI-LMSGTIRDNIVY-GLTEMPTKDEIRQVAKQCFCHNFITRFQSSYDTV 601
             R IG  QQ+ + L + T+R+++ +      P+   + +  K       I   +   D V
Sbjct: 874  PRSIGYCQQQDLHLKTATVRESLRFSAYLRQPSSVSVEEKNKYVEEVIKILEMEKYSDAV 933

Query: 602  IGPHGTLLSGGQKQRIAIARALIKKPRILI-LDEATSALDVESEGAINYTFGQLMKK--- 657
            +G  G  L+  Q++R+ I   L  +P++L+ LDE TS LD ++     +   QLM+K   
Sbjct: 934  VGIAGEGLNVEQRKRLTIGVELAARPKLLVFLDEPTSGLDSQTA----WDTCQLMRKLAT 989

Query: 658  KEMTIVSIAHRLSTI--RRSENVIVLGHDGSVVEMGKFKE 695
                I+   H+ S I  ++ + ++ L   G  V  G   E
Sbjct: 990  HGQAILCTIHQPSAILMQQFDRLLFLQRGGQTVYFGDLGE 1029

>NCAS0A12060 Chr1 (2388467..2393098) [4632 bp, 1543 aa] {ON} Anc_5.500
          Length = 1543

 Score = 62.0 bits (149), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 61/216 (28%), Positives = 104/216 (48%), Gaps = 18/216 (8%)

Query: 486  IFKNLNFKIEAGSNVCIVGPSGRGKSTVA-LLLEKYYKPS-SGEILIDGQNINDLNSKSL 543
            I  N++  ++ G+   ++G SG GK+T+   L E+    + +G I +DG+    L  +S 
Sbjct: 896  ILNNVDGWVKPGTLTALMGASGAGKTTLLDCLAERVTMGTITGNIYVDGR----LRDESF 951

Query: 544  RRHIGLVQQEPI-LMSGTIRDNIVY-GLTEMPTKDEIRQVAKQCFCHNFITRFQSSYDTV 601
             R IG  QQ+ + L + T+R+++ +      P    I +  K       I   ++  D V
Sbjct: 952  PRSIGYCQQQDLHLKTSTVRESLRFSAYLRQPAAVSIEEKNKYVEEVIRILEMEAYADAV 1011

Query: 602  IGPHGTLLSGGQKQRIAIARALIKKPRILI-LDEATSALDVESEGAINYTFGQLMKK--- 657
            +G  G  L+  Q++R+ I   L  KP++L+ LDE TS LD ++  A      QLM+K   
Sbjct: 1012 VGVAGEGLNVEQRKRLTIGVELAAKPKLLVFLDEPTSGLDSQTAWAT----CQLMRKLAE 1067

Query: 658  KEMTIVSIAHRLSTI--RRSENVIVLGHDGSVVEMG 691
                I+   H+ S I  +  + ++ L   G  V  G
Sbjct: 1068 NGQAILCTIHQPSAILMQDFDRLLFLQKGGQTVYFG 1103

>YOR153W Chr15 (619840..624375) [4536 bp, 1511 aa] {ON}  PDR5Plasma
            membrane ATP-binding cassette (ABC) transporter,
            multidrug transporter actively regulated by Pdr1p; also
            involved in steroid transport, cation resistance, and
            cellular detoxification during exponential growth
          Length = 1511

 Score = 62.0 bits (149), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 61/220 (27%), Positives = 103/220 (46%), Gaps = 18/220 (8%)

Query: 486  IFKNLNFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPS--SGEILIDGQNINDLNSKSL 543
            I  N++  ++ G+   ++G SG GK+T+   L +       +G+IL++G        KS 
Sbjct: 887  ILNNVDGWVKPGTLTALMGASGAGKTTLLDCLAERVTMGVITGDILVNGIP----RDKSF 942

Query: 544  RRHIGLVQQEPI-LMSGTIRDNIVY-GLTEMPTKDEIRQVAKQCFCHNFITRFQSSYDTV 601
             R IG  QQ+ + L + T+R+++ +      P +  I +  +       I   +   D V
Sbjct: 943  PRSIGYCQQQDLHLKTATVRESLRFSAYLRQPAEVSIEEKNRYVEEVIKILEMEKYADAV 1002

Query: 602  IGPHGTLLSGGQKQRIAIARALIKKPRILI-LDEATSALDVESEGAINYTFGQLMKK--- 657
            +G  G  L+  Q++R+ I   L  KP++L+ LDE TS LD ++  +I     QLMKK   
Sbjct: 1003 VGVAGEGLNVEQRKRLTIGVELTAKPKLLVFLDEPTSGLDSQTAWSI----CQLMKKLAN 1058

Query: 658  KEMTIVSIAHRLSTIRRSE--NVIVLGHDGSVVEMGKFKE 695
                I+   H+ S I   E   ++ +   G  V  G   E
Sbjct: 1059 HGQAILCTIHQPSAILMQEFDRLLFMQRGGKTVYFGDLGE 1098

>Kwal_0.327 s0 complement(154643..157702) [3060 bp, 1019 aa] {ON}
           YCR011C (ADP1) - Active transport ATPase [contig 86]
           FULL
          Length = 1019

 Score = 61.6 bits (148), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 65/230 (28%), Positives = 110/230 (47%), Gaps = 10/230 (4%)

Query: 469 IEFKNVSFAYPT-RPSNMIFKNLNFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKP--SS 525
           + F+N+ +   + +   MI   ++  ++ G  + ++G SG GK+T+  +L    K   +S
Sbjct: 366 LTFENIEYNIRSEKGERMILNGISGSVKPGEIMALMGGSGAGKTTLLDILAMKDKAGKAS 425

Query: 526 GEILIDGQNINDLNSKSLRRHIGLVQQEPILM-SGTIRDNIV-YGLTEMPTKDEIRQVAK 583
           G I I+G  I   N   L +  G V QE  L+ + T+ + ++   L  +P K    Q  K
Sbjct: 426 GSIKINGSEITKQN---LSKIAGFVDQENFLLPTLTVYETVLNSALLRLPRKLSFVQKQK 482

Query: 584 QCFCHNFITRFQSSYDTVIGPHGTL-LSGGQKQRIAIARALIKKPRILILDEATSALDVE 642
           + +      R     D +IG      +SGG+K+R++IA  L+  P +L LDE TS LD  
Sbjct: 483 RVYQVLEELRILDIKDRIIGDDLERGISGGEKRRVSIACELVTSPSVLFLDEPTSGLDSN 542

Query: 643 SEGAINYTFGQL-MKKKEMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMG 691
           +   +     +L +      I+SI    S I +S + +VL   G +V  G
Sbjct: 543 NANNVIECLVRLALHYNRTLILSIHQPRSNIFKSFDKLVLLSQGEMVFSG 592

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.134    0.375 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 71,133,493
Number of extensions: 2746710
Number of successful extensions: 10621
Number of sequences better than 10.0: 512
Number of HSP's gapped: 10137
Number of HSP's successfully gapped: 928
Length of query: 801
Length of database: 53,481,399
Length adjustment: 118
Effective length of query: 683
Effective length of database: 39,950,811
Effective search space: 27286403913
Effective search space used: 27286403913
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 70 (31.6 bits)