Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
CAGL0A01111g6.6ON69693523e-45
KNAG0E027906.6ON65622111e-23
NCAS0D022006.6ON85612121e-23
TDEL0G046506.6ON62602092e-23
Skud_16.66.6ON62591935e-21
NDAI0I027406.6ON66641936e-21
Kthe_YGOB_Anc_6.66.6ON62611927e-21
TBLA0A072006.6ON65611927e-21
TPHA0J002306.6ON62611919e-21
Kpol_1045.826.6ON62611883e-20
ZYRO0F00418g6.6ON62591883e-20
Sklu_YGOB_Anc_6.66.6ON61611874e-20
KAFR0B064906.6ON66621875e-20
Suva_16.346.6ON62591866e-20
Smik_6.4796.6ON62591858e-20
YPL271W (ATP15)6.6ON62591841e-19
Kwal_56.223336.6ON62611814e-19
Klac_YGOB_Anc_6.66.6ON61611613e-16
ACR021W6.6ON62611284e-11
Ecym_30086.6ON61611181e-09
CAGL0A04565g7.409ON104141601.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0A01111g
         (69 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0A01111g Chr1 (111480..111689) [210 bp, 69 aa] {ON} highly s...   140   3e-45
KNAG0E02790 Chr5 (561923..562120) [198 bp, 65 aa] {ON} Anc_6.6 Y...    86   1e-23
NCAS0D02200 Chr4 (410202..410459) [258 bp, 85 aa] {ON} Anc_6.6 Y...    86   1e-23
TDEL0G04650 Chr7 (850149..850337) [189 bp, 62 aa] {ON} Anc_6.6 Y...    85   2e-23
Skud_16.6 Chr16 (9212..9397) [186 bp, 62 aa] {ON} YPL271W (REAL)       79   5e-21
NDAI0I02740 Chr9 complement(643557..643757) [201 bp, 66 aa] {ON}...    79   6e-21
Kthe_YGOB_Anc_6.6 Chr3 (955501..955689) [189 bp, 62 aa] {ON} ANN...    79   7e-21
TBLA0A07200 Chr1 complement(1795871..1796068) [198 bp, 65 aa] {O...    79   7e-21
TPHA0J00230 Chr10 complement(54347..54535) [189 bp, 62 aa] {ON} ...    78   9e-21
Kpol_1045.82 s1045 (192421..192609) [189 bp, 62 aa] {ON} (192423...    77   3e-20
ZYRO0F00418g Chr6 complement(41813..42001) [189 bp, 62 aa] {ON} ...    77   3e-20
Sklu_YGOB_Anc_6.6 Chr5 complement(53390..53575) [186 bp, 61 aa] ...    77   4e-20
KAFR0B06490 Chr2 complement(1346858..1347058) [201 bp, 66 aa] {O...    77   5e-20
Suva_16.34 Chr16 (45660..45845) [186 bp, 62 aa] {ON} YPL271W (REAL)    76   6e-20
Smik_6.479 Chr6 complement(790945..791130) [186 bp, 62 aa] {ON} ...    76   8e-20
YPL271W Chr16 (30079..30267) [189 bp, 62 aa] {ON}  ATP15Epsilon ...    75   1e-19
Kwal_56.22333 s56 complement(53024..53212) [189 bp, 62 aa] {ON} ...    74   4e-19
Klac_YGOB_Anc_6.6 Chr4 complement(72752..72937) [186 bp, 61 aa] ...    67   3e-16
ACR021W Chr3 (394894..395082) [189 bp, 62 aa] {ON} Syntenic homo...    54   4e-11
Ecym_3008 Chr3 complement(17404..17589) [186 bp, 61 aa] {ON} sim...    50   1e-09
CAGL0A04565g Chr1 (450575..453700) [3126 bp, 1041 aa] {ON} simil...    28   1.9  

>CAGL0A01111g Chr1 (111480..111689) [210 bp, 69 aa] {ON} highly
          similar to uniprot|P21306 Saccharomyces cerevisiae
          YPL271w ATP15
          Length = 69

 Score =  140 bits (352), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 69/69 (100%), Positives = 69/69 (100%)

Query: 1  MSAVANASTAWRKAGLSYSSFLAIAARTVRESLKKELQTPAVMGRGKTDAAYTKYEKGSP 60
          MSAVANASTAWRKAGLSYSSFLAIAARTVRESLKKELQTPAVMGRGKTDAAYTKYEKGSP
Sbjct: 1  MSAVANASTAWRKAGLSYSSFLAIAARTVRESLKKELQTPAVMGRGKTDAAYTKYEKGSP 60

Query: 61 KSDPIPLQE 69
          KSDPIPLQE
Sbjct: 61 KSDPIPLQE 69

>KNAG0E02790 Chr5 (561923..562120) [198 bp, 65 aa] {ON} Anc_6.6
          YPL271W
          Length = 65

 Score = 85.9 bits (211), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 37/62 (59%), Positives = 50/62 (80%)

Query: 8  STAWRKAGLSYSSFLAIAARTVRESLKKELQTPAVMGRGKTDAAYTKYEKGSPKSDPIPL 67
          S  W+KAG++Y+++L + A+T+R +LK ELQT  V+ RG TDAAYT YEKG+PK+DP PL
Sbjct: 2  SAYWKKAGITYATYLNVTAKTLRSALKNELQTQNVLSRGTTDAAYTVYEKGTPKADPQPL 61

Query: 68 QE 69
          QE
Sbjct: 62 QE 63

>NCAS0D02200 Chr4 (410202..410459) [258 bp, 85 aa] {ON} Anc_6.6
          YPL271W
          Length = 85

 Score = 86.3 bits (212), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 39/61 (63%), Positives = 47/61 (77%)

Query: 8  STAWRKAGLSYSSFLAIAARTVRESLKKELQTPAVMGRGKTDAAYTKYEKGSPKSDPIPL 67
          S   RKAG++Y+ +L +A+RT+R SLK ELQTP VM R  TDA YTKYEKGSP +DP PL
Sbjct: 21 SATLRKAGVTYAQYLCVASRTLRASLKTELQTPVVMARSNTDAYYTKYEKGSPIADPAPL 80

Query: 68 Q 68
          Q
Sbjct: 81 Q 81

>TDEL0G04650 Chr7 (850149..850337) [189 bp, 62 aa] {ON} Anc_6.6
          YPL271W
          Length = 62

 Score = 85.1 bits (209), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 39/60 (65%), Positives = 48/60 (80%)

Query: 10 AWRKAGLSYSSFLAIAARTVRESLKKELQTPAVMGRGKTDAAYTKYEKGSPKSDPIPLQE 69
          AWRKAGL+Y+++L++AARTVR +LK ELQ   V+ R KTDA Y KYEKGS  SD +PLQE
Sbjct: 3  AWRKAGLTYNTYLSVAARTVRAALKPELQDARVLARSKTDARYVKYEKGSAASDSVPLQE 62

>Skud_16.6 Chr16 (9212..9397) [186 bp, 62 aa] {ON} YPL271W (REAL)
          Length = 62

 Score = 79.0 bits (193), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 34/59 (57%), Positives = 48/59 (81%)

Query: 9  TAWRKAGLSYSSFLAIAARTVRESLKKELQTPAVMGRGKTDAAYTKYEKGSPKSDPIPL 67
          +AWRKAG+SY+++L +AA+T+R SLK ELQT +V+ R KTDA YTKY+ G+  S+P P+
Sbjct: 2  SAWRKAGISYAAYLNVAAQTIRSSLKTELQTASVLSRSKTDAFYTKYKNGAAASEPTPI 60

>NDAI0I02740 Chr9 complement(643557..643757) [201 bp, 66 aa] {ON}
          Anc_6.6 YPL271W
          Length = 66

 Score = 79.0 bits (193), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 36/64 (56%), Positives = 50/64 (78%)

Query: 6  NASTAWRKAGLSYSSFLAIAARTVRESLKKELQTPAVMGRGKTDAAYTKYEKGSPKSDPI 65
          ++S  WRKAG++YS++L+IAART+R +LK ELQT  VM R  TDA +TKY+ G+P S+P 
Sbjct: 2  SSSAVWRKAGITYSAYLSIAARTLRAALKPELQTATVMARSHTDAYFTKYKDGAPASEPE 61

Query: 66 PLQE 69
           LQ+
Sbjct: 62 SLQK 65

>Kthe_YGOB_Anc_6.6 Chr3 (955501..955689) [189 bp, 62 aa] {ON}
          ANNOTATED BY YGOB -
          Length = 62

 Score = 78.6 bits (192), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 34/61 (55%), Positives = 50/61 (81%)

Query: 9  TAWRKAGLSYSSFLAIAARTVRESLKKELQTPAVMGRGKTDAAYTKYEKGSPKSDPIPLQ 68
          +AWRKAGL+Y++++AIAA+TVR +LK +LQT  V+GR KT+A + KYEKG+P ++  PL+
Sbjct: 2  SAWRKAGLTYNNYMAIAAQTVRSALKNDLQTAQVLGRSKTEARFIKYEKGTPVAEAQPLK 61

Query: 69 E 69
           
Sbjct: 62 N 62

>TBLA0A07200 Chr1 complement(1795871..1796068) [198 bp, 65 aa]
          {ON} Anc_6.6 YPL271W
          Length = 65

 Score = 78.6 bits (192), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 36/61 (59%), Positives = 50/61 (81%)

Query: 9  TAWRKAGLSYSSFLAIAARTVRESLKKELQTPAVMGRGKTDAAYTKYEKGSPKSDPIPLQ 68
          +AWRKAG++Y++++AIAA+TVR +LK ELQT AV+ R  T+A +TKY KGSP +DP  L+
Sbjct: 2  SAWRKAGITYNAYIAIAAKTVRNALKPELQTAAVIDRSFTEARFTKYTKGSPDADPALLK 61

Query: 69 E 69
          E
Sbjct: 62 E 62

>TPHA0J00230 Chr10 complement(54347..54535) [189 bp, 62 aa] {ON}
          Anc_6.6 YPL271W
          Length = 62

 Score = 78.2 bits (191), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 33/61 (54%), Positives = 49/61 (80%)

Query: 9  TAWRKAGLSYSSFLAIAARTVRESLKKELQTPAVMGRGKTDAAYTKYEKGSPKSDPIPLQ 68
          + WRKAGL+YS++LA+AA+TVR+SLK +L+T +V+ R KTD  YT +EKG+ KS+P  + 
Sbjct: 2  STWRKAGLTYSNYLAVAAKTVRQSLKNDLKTNSVLSRSKTDIKYTIFEKGTAKSEPTSIS 61

Query: 69 E 69
          +
Sbjct: 62 D 62

>Kpol_1045.82 s1045 (192421..192609) [189 bp, 62 aa] {ON}
          (192423..192611) [189 nt, 63 aa]
          Length = 62

 Score = 77.0 bits (188), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 49/61 (80%)

Query: 9  TAWRKAGLSYSSFLAIAARTVRESLKKELQTPAVMGRGKTDAAYTKYEKGSPKSDPIPLQ 68
          +AWRKAG++Y+ ++ IAA+TVR++LK EL+T  V+ R KT+A +  +E G+PK +P+P+Q
Sbjct: 2  SAWRKAGITYNGYVNIAAQTVRKALKNELKTNTVLARSKTEAKFVSFENGAPKGEPVPIQ 61

Query: 69 E 69
          +
Sbjct: 62 Q 62

>ZYRO0F00418g Chr6 complement(41813..42001) [189 bp, 62 aa] {ON}
          similar to uniprot|P21306 Saccharomyces cerevisiae
          YPL271W ATP15 Epsilon subunit of the F1 sector of
          mitochondrial F1F0 ATP synthase which is a large
          evolutionarily conserved enzyme complex required for
          ATP synthesis
          Length = 62

 Score = 77.0 bits (188), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 33/59 (55%), Positives = 48/59 (81%)

Query: 9  TAWRKAGLSYSSFLAIAARTVRESLKKELQTPAVMGRGKTDAAYTKYEKGSPKSDPIPL 67
          +AWRKAGL+Y+++L++AA+TVR +LK E QT AV+ R + D+ YTK+EKG P+ +P PL
Sbjct: 2  SAWRKAGLTYNAYLSVAAKTVRSALKPEAQTAAVLSRDRVDSKYTKFEKGEPQGEPKPL 60

>Sklu_YGOB_Anc_6.6 Chr5 complement(53390..53575) [186 bp, 61 aa]
          {ON} ANNOTATED BY YGOB -
          Length = 61

 Score = 76.6 bits (187), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 34/61 (55%), Positives = 50/61 (81%), Gaps = 1/61 (1%)

Query: 9  TAWRKAGLSYSSFLAIAARTVRESLKKELQTPAVMGRGKTDAAYTKYEKGSPKSDPIPLQ 68
          +AWRKAGL+Y+++L+IAA+TVR +LK E QT  V+ R K++A + K+E G+P SDPIPL+
Sbjct: 2  SAWRKAGLTYNNYLSIAAKTVRAALKTEFQTAQVLSRSKSEAKFIKFENGTP-SDPIPLK 60

Query: 69 E 69
          +
Sbjct: 61 K 61

>KAFR0B06490 Chr2 complement(1346858..1347058) [201 bp, 66 aa]
          {ON} Anc_6.6 YPL271W
          Length = 66

 Score = 76.6 bits (187), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 36/62 (58%), Positives = 47/62 (75%)

Query: 8  STAWRKAGLSYSSFLAIAARTVRESLKKELQTPAVMGRGKTDAAYTKYEKGSPKSDPIPL 67
          S+ WRKAGL+Y+S+L+IA++T+RE LK E QT AV  R  T+A  T Y+ GSP SDP PL
Sbjct: 2  SSVWRKAGLTYASYLSIASKTLREVLKTEYQTAAVASRSVTEAHVTNYKNGSPLSDPEPL 61

Query: 68 QE 69
          Q+
Sbjct: 62 QK 63

>Suva_16.34 Chr16 (45660..45845) [186 bp, 62 aa] {ON} YPL271W
          (REAL)
          Length = 62

 Score = 76.3 bits (186), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 32/59 (54%), Positives = 47/59 (79%)

Query: 9  TAWRKAGLSYSSFLAIAARTVRESLKKELQTPAVMGRGKTDAAYTKYEKGSPKSDPIPL 67
          +AWRKAG+SY+++L +AA+T+R SLK ELQT  V+ R +TDA YTKY+ G+  S+P+ +
Sbjct: 2  SAWRKAGVSYAAYLNVAAQTIRSSLKTELQTANVLSRSRTDAYYTKYKNGTAASEPVSI 60

>Smik_6.479 Chr6 complement(790945..791130) [186 bp, 62 aa] {ON}
          YPL271W (REAL)
          Length = 62

 Score = 75.9 bits (185), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 32/59 (54%), Positives = 47/59 (79%)

Query: 9  TAWRKAGLSYSSFLAIAARTVRESLKKELQTPAVMGRGKTDAAYTKYEKGSPKSDPIPL 67
          +AWRKAG+SY+++L +AA+ +R SLK ELQT +V+ R KTDA YT+Y+ G+  S+P P+
Sbjct: 2  SAWRKAGISYAAYLNVAAKAIRSSLKTELQTASVLSRSKTDAFYTQYKNGAAASEPTPI 60

>YPL271W Chr16 (30079..30267) [189 bp, 62 aa] {ON}  ATP15Epsilon
          subunit of the F1 sector of mitochondrial F1F0 ATP
          synthase, which is a large, evolutionarily conserved
          enzyme complex required for ATP synthesis;
          phosphorylated
          Length = 62

 Score = 75.5 bits (184), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 31/59 (52%), Positives = 47/59 (79%)

Query: 9  TAWRKAGLSYSSFLAIAARTVRESLKKELQTPAVMGRGKTDAAYTKYEKGSPKSDPIPL 67
          +AWRKAG+SY+++L +AA+ +R SLK ELQT +V+ R +TDA YT+Y+ G+  S+P P+
Sbjct: 2  SAWRKAGISYAAYLNVAAQAIRSSLKTELQTASVLNRSQTDAFYTQYKNGTAASEPTPI 60

>Kwal_56.22333 s56 complement(53024..53212) [189 bp, 62 aa] {ON}
          YPL271W (ATP15) - nuclear gene for ATP synthase epsilon
          subunit [contig 186] FULL
          Length = 62

 Score = 74.3 bits (181), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 33/61 (54%), Positives = 48/61 (78%)

Query: 9  TAWRKAGLSYSSFLAIAARTVRESLKKELQTPAVMGRGKTDAAYTKYEKGSPKSDPIPLQ 68
          +AWRKAGL+Y++++AIAA+TVR +LKKE QT  V+ R KT+A + KYE G+  ++  PL+
Sbjct: 2  SAWRKAGLTYNNYMAIAAQTVRSALKKEAQTARVLDRSKTEARFVKYENGTATAESQPLK 61

Query: 69 E 69
          E
Sbjct: 62 E 62

>Klac_YGOB_Anc_6.6 Chr4 complement(72752..72937) [186 bp, 61 aa]
          {ON} ANNOTATED BY YGOB -
          Length = 61

 Score = 66.6 bits (161), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 28/61 (45%), Positives = 48/61 (78%), Gaps = 1/61 (1%)

Query: 9  TAWRKAGLSYSSFLAIAARTVRESLKKELQTPAVMGRGKTDAAYTKYEKGSPKSDPIPLQ 68
          + WRKAGL++++++++AA TVR +LK ELQT +V+ R K++A + K+E G   S+P+PL+
Sbjct: 2  STWRKAGLTFNNYVSVAANTVRAALKPELQTNSVLARSKSEAKFIKFENGVA-SEPVPLK 60

Query: 69 E 69
          +
Sbjct: 61 K 61

>ACR021W Chr3 (394894..395082) [189 bp, 62 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YPL271W (ATP15)
          Length = 62

 Score = 53.9 bits (128), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 32/61 (52%), Positives = 46/61 (75%)

Query: 9  TAWRKAGLSYSSFLAIAARTVRESLKKELQTPAVMGRGKTDAAYTKYEKGSPKSDPIPLQ 68
          +AWRKAGL+Y+S+LA+AARTVR +LKKELQ+PAV+ R  T+A    Y      ++ +PL+
Sbjct: 2  SAWRKAGLTYNSYLAVAARTVRAALKKELQSPAVLNRSVTEAKVIDYASKGSAAEAVPLR 61

Query: 69 E 69
          +
Sbjct: 62 K 62

>Ecym_3008 Chr3 complement(17404..17589) [186 bp, 61 aa] {ON}
          similar to Ashbya gossypii ACR021W
          Length = 61

 Score = 50.1 bits (118), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 45/61 (73%), Gaps = 1/61 (1%)

Query: 9  TAWRKAGLSYSSFLAIAARTVRESLKKELQTPAVMGRGKTDAAYTKYEKGSPKSDPIPLQ 68
          +AWRKAGLSY++++A+AAR VR +LK EL+  AV+ R  T+A    Y+ G+  SD +PL+
Sbjct: 2  SAWRKAGLSYNTYMAVAARAVRSALKPELKNAAVLSRSNTEAKVINYKDGAA-SDAVPLK 60

Query: 69 E 69
          +
Sbjct: 61 K 61

>CAGL0A04565g Chr1 (450575..453700) [3126 bp, 1041 aa] {ON} similar
           to uniprot|P25302 Saccharomyces cerevisiae YER111c SWI4
          Length = 1041

 Score = 27.7 bits (60), Expect = 1.9,   Method: Composition-based stats.
 Identities = 15/41 (36%), Positives = 20/41 (48%)

Query: 28  TVRESLKKELQTPAVMGRGKTDAAYTKYEKGSPKSDPIPLQ 68
           T   S KK  + P      K   +YTK +K S + +P PLQ
Sbjct: 167 TSPSSYKKTPKKPNANSASKLSTSYTKRKKNSTQPNPSPLQ 207

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.309    0.121    0.333 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 6,551,071
Number of extensions: 190250
Number of successful extensions: 360
Number of sequences better than 10.0: 21
Number of HSP's gapped: 360
Number of HSP's successfully gapped: 21
Length of query: 69
Length of database: 53,481,399
Length adjustment: 42
Effective length of query: 27
Effective length of database: 48,665,427
Effective search space: 1313966529
Effective search space used: 1313966529
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 59 (27.3 bits)