Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
CAGL0A01089g6.8ON53553527490.0
TDEL0G046306.8ON50354612391e-166
Skud_16.56.8ON51553812391e-166
NDAI0G00860singletonON52355012121e-161
Suva_16.336.8ON51854512041e-160
Smik_6.4806.8ON51653911981e-159
KNAG0E027706.8ON50854511961e-159
YPL272C6.8ON51754011961e-159
Kpol_1045.796.8ON50855011291e-149
SAKL0E00792g6.8ON51154810971e-144
TPHA0M001806.8ON50354310941e-144
KAFR0B065106.8ON50854110901e-143
TPHA0J002606.8ON51554710441e-136
NCAS0D021806.8ON5155498931e-114
TBLA0A072206.8ON5095498271e-104
Ecym_30116.8ON5095456431e-76
Kwal_56.223416.8ON5195646152e-72
KLTH0C11572g6.8ON5185456133e-72
ACR018C6.8ON4784775801e-67
Kpol_1032.1singletonON2462343486e-37
Kpol_191.16.8ON1391531152e-06
Ecym_24835.119ON461118920.013
KLTH0C02178g5.119ON464122910.016
Kwal_27.98985.119ON460122820.21
ACL138C5.119ON455134760.96
CAGL0K00737g5.119ON457117761.1
KAFR0D014203.511ON492114705.2
Kpol_1010.495.119ON48158705.7
NCAS0E025107.407ON45539705.9
Skud_7.5485.119ON47555696.5
Smik_16.945.119ON46655696.6
YGR212W (SLI1)5.119ON46855689.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0A01089g
         (535 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0A01089g Chr1 complement(109009..110616) [1608 bp, 535 aa] {...  1063   0.0  
TDEL0G04630 Chr7 complement(843474..844985) [1512 bp, 503 aa] {O...   481   e-166
Skud_16.5 Chr16 complement(5816..7363) [1548 bp, 515 aa] {ON} YP...   481   e-166
NDAI0G00860 Chr7 (181464..183035) [1572 bp, 523 aa] {ON}              471   e-161
Suva_16.33 Chr16 complement(42245..43801) [1557 bp, 518 aa] {ON}...   468   e-160
Smik_6.480 Chr6 (793043..794593) [1551 bp, 516 aa] {ON} YPL272C ...   466   e-159
KNAG0E02770 Chr5 (557579..559105) [1527 bp, 508 aa] {ON} Anc_6.8...   465   e-159
YPL272C Chr16 complement(26611..28164) [1554 bp, 517 aa] {ON} Pu...   465   e-159
Kpol_1045.79 s1045 complement(184348..185874) [1527 bp, 508 aa] ...   439   e-149
SAKL0E00792g Chr5 (58155..59690) [1536 bp, 511 aa] {ON} similar ...   427   e-144
TPHA0M00180 Chr13 (36974..38485) [1512 bp, 503 aa] {ON} Anc_6.8 ...   426   e-144
KAFR0B06510 Chr2 complement(1349540..1351066) [1527 bp, 508 aa] ...   424   e-143
TPHA0J00260 Chr10 (59857..61404) [1548 bp, 515 aa] {ON} Anc_6.8 ...   406   e-136
NCAS0D02180 Chr4 (406396..407943) [1548 bp, 515 aa] {ON} Anc_6.8      348   e-114
TBLA0A07220 Chr1 (1800531..1802060) [1530 bp, 509 aa] {ON} Anc_6...   323   e-104
Ecym_3011 Chr3 (22943..24472) [1530 bp, 509 aa] {ON} similar to ...   252   1e-76
Kwal_56.22341 s56 (56939..58498) [1560 bp, 519 aa] {ON} YPL272C ...   241   2e-72
KLTH0C11572g Chr3 complement(950297..951853) [1557 bp, 518 aa] {...   240   3e-72
ACR018C Chr3 complement(388482..389918) [1437 bp, 478 aa] {ON} S...   228   1e-67
Kpol_1032.1 s1032 (25..765) [741 bp, 246 aa] {ON} (25..765) [741...   138   6e-37
Kpol_191.1 s191 complement(429..848) [420 bp, 139 aa] {ON} compl...    49   2e-06
Ecym_2483 Chr2 (946645..948030) [1386 bp, 461 aa] {ON} similar t...    40   0.013
KLTH0C02178g Chr3 complement(196605..197999) [1395 bp, 464 aa] {...    40   0.016
Kwal_27.9898 s27 (112396..113778) [1383 bp, 460 aa] {ON} YGR212W...    36   0.21 
ACL138C Chr3 complement(109749..111116) [1368 bp, 455 aa] {ON} S...    34   0.96 
CAGL0K00737g Chr11 complement(81263..82636) [1374 bp, 457 aa] {O...    34   1.1  
KAFR0D01420 Chr4 (284515..285993) [1479 bp, 492 aa] {ON} Anc_3.5...    32   5.2  
Kpol_1010.49 s1010 (113037..114482) [1446 bp, 481 aa] {ON} (1130...    32   5.7  
NCAS0E02510 Chr5 (498000..499367) [1368 bp, 455 aa] {ON} Anc_7.4...    32   5.9  
Skud_7.548 Chr7 (891732..893159) [1428 bp, 475 aa] {ON} YGR212W ...    31   6.5  
Smik_16.94 Chr16 complement(178129..179529) [1401 bp, 466 aa] {O...    31   6.6  
YGR212W Chr7 (917040..918446) [1407 bp, 468 aa] {ON}  SLI1N-acet...    31   9.2  

>CAGL0A01089g Chr1 complement(109009..110616) [1608 bp, 535 aa] {ON}
           similar to uniprot|Q08984 Saccharomyces cerevisiae
           YPL272c
          Length = 535

 Score = 1063 bits (2749), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 516/535 (96%), Positives = 516/535 (96%)

Query: 1   MSRSLSSYERKLLSEILENNKNGTVFGASYIFDDSVTADEHIWDDDNDTLAATRVESRST 60
           MSRSLSSYERKLLSEILENNKNGTVFGASYIFDDSVTADEHIWDDDNDTLAATRVESRST
Sbjct: 1   MSRSLSSYERKLLSEILENNKNGTVFGASYIFDDSVTADEHIWDDDNDTLAATRVESRST 60

Query: 61  KKPALSLTLPLVTRALKSLIEKNPEMYTTVNDLLEFAPLKEIRTPDVISVVTFDNEKDEK 120
           KKPALSLTLPLVTRALKSLIEKNPEMYTTVNDLLEFAPLKEIRTPDVISVVTFDNEKDEK
Sbjct: 61  KKPALSLTLPLVTRALKSLIEKNPEMYTTVNDLLEFAPLKEIRTPDVISVVTFDNEKDEK 120

Query: 121 VNCHSGGPPPYLIRHILKNDVFQPGSNKPLWNLYLIDESQLVFHCQDILFDIFSAANFHK 180
           VNCHSGGPPPYLIRHILKNDVFQPGSNKPLWNLYLIDESQLVFHCQDILFDIFSAANFHK
Sbjct: 121 VNCHSGGPPPYLIRHILKNDVFQPGSNKPLWNLYLIDESQLVFHCQDILFDIFSAANFHK 180

Query: 181 LFLKELIAVCRPQQSYEKPLEYLFKLQKSFENNYSVPKSIYDNLKLHLPATRPELLNLQT 240
           LFLKELIAVCRPQQSYEKPLEYLFKLQKSFENNYSVPKSIYDNLKLHLPATRPELLNLQT
Sbjct: 181 LFLKELIAVCRPQQSYEKPLEYLFKLQKSFENNYSVPKSIYDNLKLHLPATRPELLNLQT 240

Query: 241 QSFFKSIFCNAVKKPLDFIQMPXXXXXXXXXXXXXXXXXXXQEGNQLKLFRTRYTNILTS 300
           QSFFKSIFCNAVKKPLDFIQMP                   QEGNQLKLFRTRYTNILTS
Sbjct: 241 QSFFKSIFCNAVKKPLDFIQMPITSITNSSSNSDNSTTVISQEGNQLKLFRTRYTNILTS 300

Query: 301 ATSNCGHTIFGSVSNERFNYLNSVVKNEKICLRSFIAAITMLCLKPMVKSFNGTLIFSMP 360
           ATSNCGHTIFGSVSNERFNYLNSVVKNEKICLRSFIAAITMLCLKPMVKSFNGTLIFSMP
Sbjct: 301 ATSNCGHTIFGSVSNERFNYLNSVVKNEKICLRSFIAAITMLCLKPMVKSFNGTLIFSMP 360

Query: 361 MNLRDSMNEKRDFGLVYKDIRVECPLSMIDDKQCSVPGLNESDPEYNEKLLEIQFQQIAT 420
           MNLRDSMNEKRDFGLVYKDIRVECPLSMIDDKQCSVPGLNESDPEYNEKLLEIQFQQIAT
Sbjct: 361 MNLRDSMNEKRDFGLVYKDIRVECPLSMIDDKQCSVPGLNESDPEYNEKLLEIQFQQIAT 420

Query: 421 YVTESIEQRMSTWKKYGYNDNDMKRMKFTKYDEKFAPNTRLIKINDVSEVSFDDNDIRFP 480
           YVTESIEQRMSTWKKYGYNDNDMKRMKFTKYDEKFAPNTRLIKINDVSEVSFDDNDIRFP
Sbjct: 421 YVTESIEQRMSTWKKYGYNDNDMKRMKFTKYDEKFAPNTRLIKINDVSEVSFDDNDIRFP 480

Query: 481 HIKSPGFTTSLSQNTLMSLSYTHCEEDGLNICIHYPDGYNMENFVDCFESFMEEQ 535
           HIKSPGFTTSLSQNTLMSLSYTHCEEDGLNICIHYPDGYNMENFVDCFESFMEEQ
Sbjct: 481 HIKSPGFTTSLSQNTLMSLSYTHCEEDGLNICIHYPDGYNMENFVDCFESFMEEQ 535

>TDEL0G04630 Chr7 complement(843474..844985) [1512 bp, 503 aa] {ON}
           Anc_6.8 YPL272C
          Length = 503

 Score =  481 bits (1239), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 260/546 (47%), Positives = 350/546 (64%), Gaps = 61/546 (11%)

Query: 3   RSLSSYERKLLSEILENNKNGTVFGASYIFDDSVTADEHIWDDDNDTLAATRVESRSTKK 62
           RSL  +E+K+LS+ LE ++NG VFGA Y    S T +E  W DD   L  T  +SR    
Sbjct: 4   RSLGGFEKKILSQSLEGHRNGVVFGAMY----STTPEE--WSDDATLL--TYKDSR---- 51

Query: 63  PALSLTLPLVTRALKSLIEKNPEMYTTVNDLLEFAPLKEIRTPDVISVVTFDNEKDEKVN 122
               L L L++R L  +I  + E++TT+N+ LEFAP+KEI+  +VI+ VTF + KDE VN
Sbjct: 52  ----LNLSLLSRTLAKMISDHVELFTTINEKLEFAPVKEIKAEEVINAVTFGSYKDEFVN 107

Query: 123 CHSGGPPPYLIRHILKNDVFQPGSNKPLWNLYLIDESQLVFHCQDILFDIFSAANFHKLF 182
           C  G PP YL+RHI     FQPGS   LW +Y++DE+ +VFH  D+LFDIFSAANFHK+F
Sbjct: 108 CRFGAPP-YLLRHIFNQTTFQPGSGNVLWQIYVVDETLVVFHGHDVLFDIFSAANFHKIF 166

Query: 183 LKELIAVCRPQQSYEKPLEYLFKLQKSFENNYSVPKSIYDNLKLHLPATRPELLNLQTQS 242
           L+ L ++ +        L  +FKL+K+    +  PKSIYDN KL LPA   +L NLQTQS
Sbjct: 167 LQTLNSISKSGSK----LSTIFKLEKAVLPPF--PKSIYDNAKLRLPAKAADLFNLQTQS 220

Query: 243 FFKSIFCNAVKKPLDFIQMPXXXXXXXXXXXXXXXXXXXQEGNQLKLFRTRYTNILTSAT 302
           FFKS++ NAVKKPLD+I                          QLK +RTRY +IL +  
Sbjct: 221 FFKSLYFNAVKKPLDYIN--------------------SNPPQQLKEYRTRYADILRTDN 260

Query: 303 SNCGHTIFGSVSNERFNYLNSVVKNEKICLRSFIAAITMLCLKPMVKSFNGTLIFSMPMN 362
           + CG TIFG +  +R   L+ + K + ICL+SF+  ITMLCLKP+VK++ G++ F +P++
Sbjct: 261 NLCGTTIFGRILPKRLESLDCIFKQQNICLKSFVCGITMLCLKPIVKNYTGSITFCVPVD 320

Query: 363 LRDSMNEKRDFGLVYKDIRVECPLSMIDDKQ-----------CSVPGLNESDPEYNEKLL 411
           LR S+    +FG+ YKDIRVECPLS+IDDK             S   + E DP Y E+LL
Sbjct: 321 LRSSLEASSEFGMFYKDIRVECPLSLIDDKNFNSLTVYNGYDSSAVKMPEKDPGYKEQLL 380

Query: 412 EIQFQQIATYVTESIEQRMSTWKKYGYNDNDMKRMKFTKYDEKFAPNTRLIKINDVSEVS 471
           E QF+Q+  +V  ++ QRM  W+K+G+ND+D+KRMKF   D   A NT+LI+INDVS++ 
Sbjct: 381 EYQFKQVTDHVVAALRQRMKAWEKFGFNDDDIKRMKFGSDDT--ATNTKLIQINDVSDIP 438

Query: 472 FD---DNDIRFPHIKSPGFTTSLSQNTLMSLSYTHCEEDGLNICIHYPDGYNMENFVDCF 528
            D   D   +F H++    T SL    LMSLSYTH E+ GL+ICIHYPDGYNME+FV+CF
Sbjct: 439 VDAHEDISGKF-HMRELNMTQSLKPGQLMSLSYTHSEK-GLDICIHYPDGYNMESFVECF 496

Query: 529 ESFMEE 534
           +SF+E+
Sbjct: 497 QSFIED 502

>Skud_16.5 Chr16 complement(5816..7363) [1548 bp, 515 aa] {ON}
           YPL272C (REAL)
          Length = 515

 Score =  481 bits (1239), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 250/538 (46%), Positives = 352/538 (65%), Gaps = 34/538 (6%)

Query: 3   RSLSSYERKLLSEILENNKNGTVFGASYIFDDSVTADEHIWDDDNDTLAATRVESRSTKK 62
           R LSS+E+KLL++ L + +NGT+F ++Y    +   D   W+ D  TL        ++ K
Sbjct: 5   RPLSSFEKKLLTQSLNDQRNGTIFSSTYSKSPNRGNDAD-WNSDEVTLGT------NSSK 57

Query: 63  PALSLTLPLVTRALKSLIEKNPEMYTTVNDLLEFAPLKEIRTPDVISVVTFDNEKDEKVN 122
               LTLP +   LK LI+  P ++ TVN+  EF PLK+++T D+++V+ F+  KD++VN
Sbjct: 58  DDSRLTLPSIAATLKRLIKSQPALFATVNEEWEFEPLKQLKTSDIVNVIEFETIKDKEVN 117

Query: 123 CHSGGPPPYLIRHILKNDVFQPGSNKPLWNLYLIDESQLVFHCQDILFDIFSAANFHKLF 182
           CH G PPPYL+RH      F PGSNKPLW LY+IDE+ LVFH  D+LFDIFSAANFHKLF
Sbjct: 118 CHWGVPPPYLLRHAFNKTRFVPGSNKPLWTLYVIDEALLVFHGHDVLFDIFSAANFHKLF 177

Query: 183 LKELIAVCRPQQSYEKPLEYLFKLQKSFENNYSVPKSIYDNLKLHLPATRPELLNLQTQS 242
           LKEL  +     S ++    LF +     +N + PKSIYD+ KLHLPA  P++ + QTQS
Sbjct: 178 LKELNNISLEAHSDDR---VLFDISDVNISNLNFPKSIYDSAKLHLPAMTPQIFHKQTQS 234

Query: 243 FFKSIFCNAVKKPLDFIQMPXXXXXXXXXXXXXXXXXXXQEGNQLKLFRTRYTNILTSAT 302
           FFKSIF N +K+P  ++                          QLK    +Y +IL + +
Sbjct: 235 FFKSIFYNTLKRPFGYL-------------TNQTSLGPSTSTTQLK----KYNDILNAHS 277

Query: 303 SNCGHTIFGSVSNERFNYLNSVVKNEKICLRSFIAAITMLCLKPMVKSFNGTLIFSMPMN 362
           S CG T+FG V+N+RFNYL S+V  E ICLRSFI  I M+CLKP+VK F G ++FS+P++
Sbjct: 278 SLCGTTVFGIVNNQRFNYLKSIVNQEHICLRSFICGIAMICLKPLVKDFTGAIVFSIPID 337

Query: 363 LRDSMNEKRDFGLVYKDIRVECPLSMIDDKQCSVPGL-----NESDPEYNEKLLEIQFQQ 417
           LR +++     GL +K++R+ECPLS+IDD+  +   L      E D E+NEKL+E QF +
Sbjct: 338 LRKNLDLGESLGLFFKELRIECPLSLIDDELSADEFLANRNDKEDDDEFNEKLMEYQFNK 397

Query: 418 IATYVTESIEQRMSTWKKYGYNDNDMKRMKFTKYDEKFA-PNTRLIKINDVSEVSFD-DN 475
           +  +V++ I  ++ +W+K G+ND+D++RMK+   D       T+LI+INDVS++S   +N
Sbjct: 398 VTKHVSDFIMAKLKSWEKNGFNDDDIRRMKYDNDDCHIQNSKTKLIQINDVSDISLSMNN 457

Query: 476 DIRFPHIKSPGFTTSLSQNTLMSLSYTHCEEDGLNICIHYPDGYNMENFVDCFESFME 533
           D +   I S GFT+S+++ TLMSLSYT+CEE GLNICIHYPD YN+E+FV+CFESF+E
Sbjct: 458 DEKAFKIISSGFTSSINRPTLMSLSYTYCEEMGLNICIHYPDSYNLESFVECFESFIE 515

>NDAI0G00860 Chr7 (181464..183035) [1572 bp, 523 aa] {ON} 
          Length = 523

 Score =  471 bits (1212), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 246/550 (44%), Positives = 366/550 (66%), Gaps = 48/550 (8%)

Query: 3   RSLSSYERKLLSEILENNKNGTVFGASYIFDDSVTADEHIWDDDNDTLAATRVESRSTKK 62
           R+LSS+E+K+LS+ L++ +NG  + A Y+     ++D  + D      AAT + ++  + 
Sbjct: 4   RALSSFEKKVLSQTLDSKRNGISYTARYVSKVGSSSDSTLSD------AATLLATKDIR- 56

Query: 63  PALSLTLPLVTRALKSLIEKNPEMYTTVNDLLEFAPLKEIRTPDVISVVTFDNEKDEKVN 122
               L + +VTR L+ LI+K+ E+Y+T+N+  EF  L +I+  DVISV+TFD  KDE++N
Sbjct: 57  ----LNIGIVTRVLERLIKKHIELYSTINENYEFQILTKIKPEDVISVITFDTYKDEQIN 112

Query: 123 CHSGGPPPYLIRHILKNDVFQPGSNKPLWNLYLIDESQLVFHCQDILFDIFSAANFHKLF 182
           CHSG PP YL+RHI   + F+   NKPLW LY+IDE+ ++FH  D+LFDIFSAANFHKLF
Sbjct: 113 CHSGAPP-YLLRHIFNKEKFEL--NKPLWKLYIIDETMIIFHGFDMLFDIFSAANFHKLF 169

Query: 183 LKEL---IAVCRPQQSYEKPLEYLFKLQ---KSFENNYS-VPKSIYDNLKLHLPATRPEL 235
             EL          +S  KPL+ +FK+    K+F  N+   P+SI+DN KLHLPA  P+L
Sbjct: 170 FDELNDYFLTNTFSKSNSKPLDVVFKINVSDKNFVPNFEEFPRSIFDNPKLHLPAMTPDL 229

Query: 236 LNLQTQSFFKSIFCNAVKKPLDFIQMPXXXXXXXXXXXXXXXXXXXQEGNQLKLFRTR-Y 294
            NLQT+SFFK+I+ N +KKP+D                           +QLK ++T  Y
Sbjct: 230 FNLQTKSFFKTIYSNTIKKPIDLFNGSNSHTKNDIT-------------SQLKEYQTHNY 276

Query: 295 TNILTSATSNCGHTIFGSVSNERFNYLNSVVKNEKICLRSFIAAITMLCLKPMVKSFNGT 354
            ++L   +S CG T+FG+VS  R+NYL  ++K ++ICLRSFI  I M+CLKP +K+++G 
Sbjct: 277 LDMLGITSSLCGTTVFGTVSPTRYNYLKGMMKQDEICLRSFICGIVMICLKPSIKNYSGN 336

Query: 355 LIFSMPMNLRDSMNEKRDFGLVYKDIRVECPLSMIDD--------KQCSVPGLNESDPEY 406
           +IFS+P+NLR+ ++  ++FGL YKD++++CPLS+IDD        K  S+P  +E+D E+
Sbjct: 337 IIFSIPINLRNYIDGAKNFGLFYKDVKIDCPLSLIDDRNFKYNGYKDSSIP--DENDLEF 394

Query: 407 NEKLLEIQFQQIATYVTESIEQRMSTWKKYGYNDNDMKRMKFTKYDEKFAPNTRLIKIND 466
           NEKLLE QF+Q+  ++   I +R+  W+K+ +ND+D+KRMKF  +DE    N+++I+IND
Sbjct: 395 NEKLLEYQFKQVTEFIENVILERLKIWEKFNFNDDDIKRMKF-DHDEVLGQNSKIIQIND 453

Query: 467 VSEVSF--DDNDIRFPHIKSPGFTTSLSQNTLMSLSYTHCEEDGLNICIHYPDGYNMENF 524
            +E+    +DN+ +   + +P FT +LS N  MS+S+  CEE GLN+CIHYPDGY+ME F
Sbjct: 454 TTEIMLGENDNNNKAFTLTNPNFTRTLSGNEFMSVSFAICEETGLNVCIHYPDGYSMETF 513

Query: 525 VDCFESFMEE 534
           V+CF++F+EE
Sbjct: 514 VECFQTFIEE 523

>Suva_16.33 Chr16 complement(42245..43801) [1557 bp, 518 aa] {ON}
           YPL272C (REAL)
          Length = 518

 Score =  468 bits (1204), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 253/545 (46%), Positives = 355/545 (65%), Gaps = 45/545 (8%)

Query: 3   RSLSSYERKLLSEILENNKNGTVFGASYIFDDSVTADEHIWDDDNDTLAATRVESRSTKK 62
           R LSS+E+KLL++ L + +NGT+F ++Y    S  AD   W  D  TL        ++ K
Sbjct: 5   RPLSSFEKKLLTQSLNDQRNGTIFSSTYSKSSSKEADAD-WHSDEVTLGT------NSSK 57

Query: 63  PALSLTLPLVTRALKSLIEKNPEMYTTVNDLLEFAPLKEIRTPDVISVVTFDNEKDEKVN 122
               LTLPL+   LK LI+  P ++ TVN+  E+APLK+++T D+++V+ F+  KD++VN
Sbjct: 58  DDSRLTLPLIATTLKKLIKSQPALFATVNEDWEYAPLKQLKTSDIVNVIEFETTKDKEVN 117

Query: 123 CHSGGPPPYLIRHILKNDVFQPGSNKPLWNLYLIDESQLVFHCQDILFDIFSAANFHKLF 182
           CH G PPPYL+RH      F PGSNKPLW LY+IDE+ LVFH  D+LFDIFSAANFHKLF
Sbjct: 118 CHWGVPPPYLLRHAFNKTRFVPGSNKPLWTLYVIDETLLVFHGHDVLFDIFSAANFHKLF 177

Query: 183 LKELIAVCRPQQSYEKPLEYLFKLQKSFENNYSVPKSIYDNLKLHLPATRPELLNLQTQS 242
           LKEL ++    +S ++    LF +        S PKSIYD+ KL LPA  P++L+ QTQS
Sbjct: 178 LKELNSITSVSRSDDR---VLFDINDVNFAELSFPKSIYDSAKLRLPAMTPQILHKQTQS 234

Query: 243 FFKSIFCNAVKKPLDFIQMPXXXXXXXXXXXXXXXXXXXQEGNQLKLFRTRYTNILTSAT 302
           FFKSIF N +K+P  ++                         +QLK    RY +IL + +
Sbjct: 235 FFKSIFYNTLKRPFGYL-------------TNQTSFSSPAPTSQLK----RYNDILNTNS 277

Query: 303 SNCGHTIFGSVSNERFNYLNSVVKNEKICLRSFIAAITMLCLKPMVKSFNGTLIFSMPMN 362
           S CG T+FG V+N+RF+YL S+V  E ICLRSFI  I M+CLKP+VK F+GT++FS+P++
Sbjct: 278 SLCGTTVFGIVNNQRFSYLKSIVNQEHICLRSFICGIAMICLKPLVKDFSGTIVFSIPID 337

Query: 363 LRDSMNEKRDFGLVYKDIRVECPLSMIDDKQCSVPGLNE-----------SDPEYNEKLL 411
           LR  +N     GL +K++R+ECPLS+IDD+      +NE            + E+NEKL+
Sbjct: 338 LRKHLNLGESLGLFFKELRIECPLSLIDDEL----SINEFLVNSNDNENNDNDEFNEKLM 393

Query: 412 EIQFQQIATYVTESIEQRMSTWKKYGYNDNDMKRMKFTKYDEKFAPN--TRLIKINDVSE 469
           E QF ++  +V+  I  ++ +W++ G+ND+D++RMK+   D+    N  T+LI+INDVS+
Sbjct: 394 EYQFNKVTKHVSNYIMTKLKSWERNGFNDDDIRRMKYDNDDDFHVQNSKTKLIQINDVSD 453

Query: 470 VSFD-DNDIRFPHIKSPGFTTSLSQNTLMSLSYTHCEEDGLNICIHYPDGYNMENFVDCF 528
           +S    ND +   I S GFT S+++ TLMSLSYT+CE+ GLNICIHYPD YN+E+FV+CF
Sbjct: 454 ISLSMSNDDKSFKIVSSGFTNSINRPTLMSLSYTYCEDMGLNICIHYPDSYNLESFVECF 513

Query: 529 ESFME 533
           ESF+E
Sbjct: 514 ESFIE 518

>Smik_6.480 Chr6 (793043..794593) [1551 bp, 516 aa] {ON} YPL272C
           (REAL)
          Length = 516

 Score =  466 bits (1198), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 247/539 (45%), Positives = 349/539 (64%), Gaps = 35/539 (6%)

Query: 3   RSLSSYERKLLSEILENNKNGTVFGASYIFDDSVTADEHIWDDDNDTLAATRVESRSTKK 62
           R LSS+E+KLL++ L + +NGT+F ++Y        D   W  D  TL        ++ K
Sbjct: 5   RPLSSFEKKLLTQSLNDQRNGTIFSSTYSKSLGKENDAD-WHSDEVTLGT------NSSK 57

Query: 63  PALSLTLPLVTRALKSLIEKNPEMYTTVNDLLEFAPLKEIRTPDVISVVTFDNEKDEKVN 122
               LTLPL+   LK LI+  P ++ T+N+  EF PL++++T D+++V+ F+  KD++VN
Sbjct: 58  DDSRLTLPLIATTLKRLIKSQPALFATINEEWEFEPLEQLKTSDIVNVIEFETLKDKEVN 117

Query: 123 CHSGGPPPYLIRHILKNDVFQPGSNKPLWNLYLIDESQLVFHCQDILFDIFSAANFHKLF 182
           CH G PPPYL+RH      F PGSN+PLW LY+IDE+ LVFH  D+LFDIFSAANFHKLF
Sbjct: 118 CHWGVPPPYLLRHAFNKTRFIPGSNRPLWTLYVIDETLLVFHGHDVLFDIFSAANFHKLF 177

Query: 183 LKELIAVCRPQQSYEKPLEYLFKLQKSFENNYSVPKSIYDNLKLHLPATRPELLNLQTQS 242
           LKEL  +      YE  +  LF +     ++ + PKSIYD+ KLHLPA  P++ + QTQS
Sbjct: 178 LKELNNISSVTH-YEDRI--LFDINNVSISDLNFPKSIYDSAKLHLPAMTPQIFHKQTQS 234

Query: 243 FFKSIFCNAVKKPLDFIQMPXXXXXXXXXXXXXXXXXXXQEGNQLKLFRTRYTNILTSAT 302
           FFKSIF N +K+P  ++                          QLK    +Y +IL + +
Sbjct: 235 FFKSIFYNTLKRPFGYL-------------TNQTSISSPASATQLK----KYNDILNAHS 277

Query: 303 SNCGHTIFGSVSNERFNYLNSVVKNEKICLRSFIAAITMLCLKPMVKSFNGTLIFSMPMN 362
           S CG T+FG VSN+RFNYL S+V  E ICLRSFI  I M+CLKP+VK F+GT++FS+P++
Sbjct: 278 SLCGTTVFGIVSNQRFNYLKSIVNQEHICLRSFICGIAMICLKPLVKDFSGTIVFSIPID 337

Query: 363 LRDSMNEKRDFGLVYKDIRVECPLSMIDDKQCSVPGLNES-----DPEYNEKLLEIQFQQ 417
           LR  +      GL +K++R+ CPLS+IDD+      L  S     D E++EKL+E QF  
Sbjct: 338 LRKHLGLGESLGLFFKELRIACPLSLIDDELSVNEFLANSNDNEEDEEFDEKLMEYQFNN 397

Query: 418 IATYVTESIEQRMSTWKKYGYNDNDMKRMKFTKYDEKFAPN--TRLIKINDVSEVSFD-D 474
           +  +V+  I  ++ +W+K G+ND+D++RMK+   DE    N  T+L++INDVS++S   +
Sbjct: 398 VTKHVSSFIMAKLKSWEKNGFNDDDIRRMKYDNDDEFHIQNSKTKLVQINDVSDISLSMN 457

Query: 475 NDIRFPHIKSPGFTTSLSQNTLMSLSYTHCEEDGLNICIHYPDGYNMENFVDCFESFME 533
           ND +   I S GFT+S+++ TL+SLSYT+C+E GLNICIHYPD YN+E+FV+CFESF+E
Sbjct: 458 NDDKSFKIVSSGFTSSINRPTLLSLSYTYCQEMGLNICIHYPDSYNLESFVECFESFIE 516

>KNAG0E02770 Chr5 (557579..559105) [1527 bp, 508 aa] {ON} Anc_6.8
           YPL272C
          Length = 508

 Score =  465 bits (1196), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 256/545 (46%), Positives = 354/545 (64%), Gaps = 56/545 (10%)

Query: 3   RSLSSYERKLLSEILENNKNGTVFGASYIFDDSVTADEHIWDDDNDTLAATRVESRSTKK 62
           R+LSS+E+KLL + ++  KNGT FGA Y      +  +  W D+  TL   + +SR    
Sbjct: 5   RALSSFEKKLLLQSVDGLKNGTTFGAEY------STFKEGWSDEEATLLTVK-DSR---- 53

Query: 63  PALSLTLPLVTRALKSLIEKNPEMYTTVNDLLEFAPLKEIRTPDVISVVTFDNEKDEKVN 122
               L L L+T+AL++LI+K+ E++ T+N+  EF  LK+I+T DVIS + FD+ KDEK+N
Sbjct: 54  ----LCLGLLTKALENLIKKHIELFLTINEQFEFEVLKKIKTSDVISTIQFDSFKDEKIN 109

Query: 123 CHSGGPPPYLIRHILKNDVFQPGSNKPLWNLYLIDESQLVFHCQDILFDIFSAANFHKLF 182
           C  G PP YL+RHI  +D F PGS KPLW LYL+D+S   FH QD LFD+FS ANFH+L 
Sbjct: 110 CQLGAPP-YLLRHIFNHDRFVPGSGKPLWKLYLLDDSLAFFHGQDCLFDVFSTANFHRLL 168

Query: 183 LKEL-IAVCRPQQSYEKPLEYLFKLQ-KSFENNYSVPKSIYDNLKLHLPATRPELLNLQT 240
           LKE+ +   RPQ+   K L+Y+FK    S      +PKSIYDN KL++P   P+L NLQT
Sbjct: 169 LKEVNLLSSRPQKW--KKLDYVFKFGPDSMSEVKQLPKSIYDNPKLYIPTLNPDLFNLQT 226

Query: 241 QSFFKSIFCNAVKKPLDFIQMPXXXXXXXXXXXXXXXXXXXQEGNQLKLFRTRYTNILTS 300
           QSFFKSI+ N VKKP++F+                                 +Y +IL  
Sbjct: 227 QSFFKSIYVNTVKKPIEFLTNTDVSFLSLNS-------------------NMKYNDILDI 267

Query: 301 ATSNCGHTIFGSVSNERFNYLNSVVKNEKICLRSFIAAITMLCLKPMVKSFNGTLIFSMP 360
            +  CG+T+FG VSNERF YLN+++  E +CL+SFI  I MLCLKPMVK+ +GT+ FS+P
Sbjct: 268 NSKLCGNTVFGCVSNERFKYLNTIINQEGLCLKSFIVGIAMLCLKPMVKNLSGTVTFSIP 327

Query: 361 MNLRDSMNEKRDFGLVYKDIRVECPLSMIDD---KQCSVPGLNESDPEYNEKLLEIQFQQ 417
           ++LR  ++E RDFGL YKDIRVECPLS+IDD   K C + G + S+ +++EKL+E QF+ 
Sbjct: 328 VDLRSFVDEPRDFGLYYKDIRVECPLSLIDDDKSKDC-MKGASVSEEDFDEKLMEYQFKN 386

Query: 418 IATYVTESIEQRMSTWKKYGYNDNDMKRMKFTKYDEK-----FAPNTRLIKINDVSEVSF 472
           I  +V   +EQR++ + K G+ND+D++RMKF   D+K      + N   I+I D S ++ 
Sbjct: 387 ITGFVRNHLEQRLTRFSKTGFNDDDIRRMKF---DDKNTLGGSSNNGTFIQIYDTSLINV 443

Query: 473 DDNDIRFPH---IKSPGFTTSLSQNTLMSLSYTHCEEDGLNICIHYPDGYNMENFVDCFE 529
             N+   P+   I++   T SL+   LMSLSYT+CEE+GLNICIHYP+ Y ME+FV+CF+
Sbjct: 444 --NEFGEPNSFMIRACNLTKSLNSEELMSLSYTYCEENGLNICIHYPENYKMESFVECFQ 501

Query: 530 SFMEE 534
           SF+EE
Sbjct: 502 SFLEE 506

>YPL272C Chr16 complement(26611..28164) [1554 bp, 517 aa] {ON}
           Putative protein of unknown function; gene expression
           induced in response to ketoconazole; YPL272C is not an
           essential gene
          Length = 517

 Score =  465 bits (1196), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 252/540 (46%), Positives = 351/540 (65%), Gaps = 36/540 (6%)

Query: 3   RSLSSYERKLLSEILENNKNGTVFGASYIFDDSVTADEHIWDDDNDTLAATRVESRSTKK 62
           R LSS+E+K+L++ L + +NGT+F ++Y    S   D   W  D  TL        ++ K
Sbjct: 5   RPLSSFEKKILTQSLNDQRNGTIFSSTYSKSLSRENDAD-WHSDEVTLGT------NSSK 57

Query: 63  PALSLTLPLVTRALKSLIEKNPEMYTTVNDLLEFAPLKEIRTPDVISVVTFDNEKDEKVN 122
               LTLPL+   LK LI+  P ++ TVN+  EF PLK+++T D+++V+ F+  KD++VN
Sbjct: 58  DDSRLTLPLIATTLKRLIKSQPALFATVNEEWEFEPLKQLKTSDIVNVIEFETIKDKEVN 117

Query: 123 CHSGGPPPYLIRHILKNDVFQPGSNKPLWNLYLIDESQLVFHCQDILFDIFSAANFHKLF 182
           CH G PPPYL+RH      F PGSNKPLW LY+IDE+ LVFH  D+LFDIFSAANFHKLF
Sbjct: 118 CHWGVPPPYLLRHAFNKTRFVPGSNKPLWTLYVIDEALLVFHGHDVLFDIFSAANFHKLF 177

Query: 183 LKELIAVCRPQQSYEKPLEYLFKLQKSFENNYSVPKSIYDNLKLHLPATRPELLNLQTQS 242
           LKEL  +     S ++    LF +     +    PKSIYD+ KLHLPA  P++ + QTQS
Sbjct: 178 LKELNEISTVTHSEDR---ILFDVNDINLSELKFPKSIYDSAKLHLPAMTPQIFHKQTQS 234

Query: 243 FFKSIFCNAVKKPLDFIQMPXXXXXXXXXXXXXXXXXXXQEGNQLKLFRTRYTNILTSAT 302
           FFKSI+ N +K+P  ++                          QLK    +Y +IL + T
Sbjct: 235 FFKSIYYNTLKRPFGYL-------------TNQTSLSSSVSATQLK----KYNDILNAHT 277

Query: 303 SNCGHTIFGSVSNERFNYLNSVVKNEKICLRSFIAAITMLCLKPMVKSFNGTLIFSMPMN 362
           S CG T+FG V+N+RFNYL S+V  E ICLRSFI  I M+CLKP+VK F+GT++F++P+N
Sbjct: 278 SLCGTTVFGIVNNQRFNYLKSIVNQEHICLRSFICGIAMICLKPLVKDFSGTIVFTIPIN 337

Query: 363 LRDSMNEKRDFGLVYKDIRVECPLSMIDDKQCSVPGLNES------DPEYNEKLLEIQFQ 416
           LR+ +      GL +K++RVECPLS+IDD+  +   L  S      D E+NE+L+E QF 
Sbjct: 338 LRNHLGLGGSLGLFFKELRVECPLSLIDDELSANEFLTNSNDNEDNDDEFNERLMEYQFN 397

Query: 417 QIATYVTESIEQRMSTWKKYGYNDNDMKRMKFTKYDEKFAPNTR--LIKINDVSEVSFDD 474
           ++  +V+  I  ++ +W+K G+ND+D++RMK+   D+    N+R  LI+INDVS++S   
Sbjct: 398 KVTKHVSGFIMAKLRSWEKNGFNDDDIRRMKYDNDDDFHIQNSRTKLIQINDVSDISLSM 457

Query: 475 N-DIRFPHIKSPGFTTSLSQNTLMSLSYTHCEEDGLNICIHYPDGYNMENFVDCFESFME 533
           N D +   I S GFT+S+++ TLMSLSYT+CEE GLNICIHYPD YN+E+FV+CFESF+E
Sbjct: 458 NGDDKSFKIVSTGFTSSINRPTLMSLSYTYCEEMGLNICIHYPDSYNLESFVECFESFIE 517

>Kpol_1045.79 s1045 complement(184348..185874) [1527 bp, 508 aa]
           {ON} complement(184350..185876) [1527 nt, 509 aa]
          Length = 508

 Score =  439 bits (1129), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 236/550 (42%), Positives = 338/550 (61%), Gaps = 64/550 (11%)

Query: 3   RSLSSYERKLLSEILENNKNGTVFGASYIFD--DSVTADEHIWDDDNDTLAATRVESRST 60
           R L +YE+KL+ + L    NG +F A YI +  D +T D  +  +    L  +R+     
Sbjct: 5   RQLGTYEKKLVGQALAGQSNGIIFSAKYISNAQDGLTDDATLLTNSEPLLLDSRL----- 59

Query: 61  KKPALSLTLPLVTRALKSLIEKNPEMYTTVNDLLEFAPLKEIRTPDVISVVTFDNEKDEK 120
                         AL+ ++ K+PE+ TTVN+ LEF  +KEI+T D+I+ V FD+ KDE 
Sbjct: 60  ------------VNALQKMVLKHPELRTTVNEKLEFEEVKEIKTSDIITSVKFDSLKDEF 107

Query: 121 VNCHSGGPPPYLIRHILKNDVFQPGSNKPLWNLYLIDESQLVFHCQDILFDIFSAANFHK 180
           VNCH G PP YL+RHI   + F PGS KPLW L +ID+S ++FH QD+LFDIF+AANFHK
Sbjct: 108 VNCHLGAPP-YLLRHIFNRNKFTPGSGKPLWELCVIDDSLVMFHGQDVLFDIFAAANFHK 166

Query: 181 LFLKELIAVCRPQQSYEKPLEYLFKLQKSFEN-NYSVPKSIYDNLKLHLPATRPELLNLQ 239
           LFL+ L ++      +   LEY+++   +  N + S P++IY+N KL +P    +L+NLQ
Sbjct: 167 LFLETLNSM---DDEHITDLEYIYRYDATKSNRSISFPRTIYENPKLRIPGKTIDLVNLQ 223

Query: 240 TQSFFKSIFCNAVKKPLDFIQMPXXXXXXXXXXXXXXXXXXXQEGNQLKLFRTRYTNILT 299
           TQSFFKS + NA+KKPLD I                           +K  +    + + 
Sbjct: 224 TQSFFKSFYVNAIKKPLDIITF---------------------NSEPMKYIKPNEIDFMN 262

Query: 300 SATSNCGHTIFGSVSNERFNYLNSVVKNEKICLRSFIAAITMLCLKPMVKSFNGTLIFSM 359
            A++ CG T+FG ++ +RF YLNS+ ++E +C+RSFI  I +LCLK M+K F G++ FS+
Sbjct: 263 EASALCGTTVFGHITTDRFEYLNSIARHENVCIRSFICGIALLCLKSMIKDFTGSITFSI 322

Query: 360 PMNLRDSMNEKRDFGLVYKDIRVECPLSMIDDK--------------QCSVPGLNESDPE 405
           P+NLR+S+    DFGL YK I VECPLS+IDD+                 VP   E+DP 
Sbjct: 323 PVNLRESIEGPSDFGLFYKTILVECPLSLIDDQVYNNINVYNGYDNSNVKVP---ETDPT 379

Query: 406 YNEKLLEIQFQQIATYVTESIEQRMSTWKKYGYNDNDMKRMKFTKYDEKFAPNTRLIKIN 465
           + EK LE QF+QI+  V+ ++++RM  W++ G+ND+D+K+MKFT  D+  A NT++I+IN
Sbjct: 380 FEEKKLEYQFKQISDLVSTTMKERMRAWRRNGFNDDDIKKMKFTSDDK--ASNTKIIQIN 437

Query: 466 DVSEVSFDDNDIRFPHIKSPGFTTSLSQNTLMSLSYTHCEEDGLNICIHYPDGYNMENFV 525
           DVSE   + +      IK   FT S+S +  MSLSYT+C+E G NICIHYPD Y+ME FV
Sbjct: 438 DVSEFKINSSKSSKVSIKELNFTHSISNSDFMSLSYTYCKETGSNICIHYPDAYDMEKFV 497

Query: 526 DCFESFMEEQ 535
           + F+SF+ +Q
Sbjct: 498 ERFQSFVADQ 507

>SAKL0E00792g Chr5 (58155..59690) [1536 bp, 511 aa] {ON} similar to
           uniprot|Q08984 Saccharomyces cerevisiae YPL272C
           Hypothetical ORF
          Length = 511

 Score =  427 bits (1097), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 242/548 (44%), Positives = 330/548 (60%), Gaps = 64/548 (11%)

Query: 3   RSLSSYERKLLSEILENNKNGTVFGASYIFDDSVTADEHIWDDDNDTLAATRVESRSTKK 62
           RSLSS E+KL S+ L N +NG +F A Y    +    E  W D N TL   + +      
Sbjct: 8   RSLSSVEKKLFSQNLNNKRNGLMFAAVY---STCFDKEETWSD-NATLLTVKDQR----- 58

Query: 63  PALSLTLPLVTRALKSLIEKNPEMYTTVNDLLEFAPLKEIRTPDVISVVTFDNEKDEKVN 122
               L+  LV+RALK +I  N E+YTT+ND LEF P+K I   DV+  V FD+ KDE VN
Sbjct: 59  ----LSNSLVSRALKKVINNNVELYTTINDNLEFQPVKTIMFDDVVQKVEFDSYKDELVN 114

Query: 123 CHSGGPPPYLIRHILKNDVFQPGSNKPLWNLYLIDESQLVFHCQDILFDIFSAANFHKLF 182
           CH G  PPYL+RHI   + F+   +KPLW + ++DE+ ++FH  D+LFDIF+AANFHKLF
Sbjct: 115 CHDG-VPPYLLRHIFDKNKFETAKHKPLWQILIVDETMVIFHGHDVLFDIFAAANFHKLF 173

Query: 183 LKELIAVCRPQQSYEKP-LEYLFK--LQKSFENNYSVPKSIYDNLKLHLPATRPELLNLQ 239
            + L      Q   + P LE LFK   + SF      PKSIY+N KL LPA   +L  LQ
Sbjct: 174 QQAL-----NQLPKDGPTLECLFKNDSKASF-----FPKSIYENHKLRLPAIATDLFQLQ 223

Query: 240 TQSFFKSIFCNAVKKPLDFIQMPXXXXXXXXXXXXXXXXXXXQEGNQLKLFRTRYTNILT 299
           TQSFFKS++   +KKPLDFI                         + LK +++ YT+IL 
Sbjct: 224 TQSFFKSVYNWTIKKPLDFIN--------------------TNPNSGLKYYQSCYTDILL 263

Query: 300 SATSNCGHTIFGSVSNERFNYLNSVVKNEKICLRSFIAAITMLCLKPMVKSFNGTLIFSM 359
            A + CG T+FG++S ER   L  ++K E ICL SF+ AI +LCLKP+V +F  ++ FS+
Sbjct: 264 GANNLCGTTVFGNISAERVCALKKIMKQENICLSSFVCAIALLCLKPLVNNFGSSVTFSI 323

Query: 360 PMNLRDSMNEKRDFGLVYKDIRVECPLSMIDDKQCSVPGLN-------------ESDPEY 406
           P++LR ++ +   FGL YK++ VECPL++IDDK     GLN               DP Y
Sbjct: 324 PVDLRSTIPQASRFGLCYKNVLVECPLTLIDDK--VFQGLNVYNGYDIRNTKPTNKDPNY 381

Query: 407 NEKLLEIQFQQIATYVTESIEQRMSTWKKYGYNDNDMKRMKFTKYDEKFAPNTRLIKIND 466
            E LLE QF++  T+V  +++QR   W++ G+ND+D+KRMKF K ++    + R+I++N+
Sbjct: 382 EESLLEYQFREACTHVDNTLKQRWRAWERSGFNDDDIKRMKFGKTEQ--GKSKRIIEVNN 439

Query: 467 VSEVSFDDNDIRFPHIKSPGFTTSLSQNTLMSLSYTHCEEDGLNICIHYPDGYNMENFVD 526
           V+E  F  +D    +IK   FT S +  T MSLS    E  GLN+CIHYPDGYNM+ FV+
Sbjct: 440 VTEFQFHVDDNATFNIKDVCFTKSQNLETFMSLSCAFSERSGLNVCIHYPDGYNMDVFVE 499

Query: 527 CFESFMEE 534
           CF+SFMEE
Sbjct: 500 CFQSFMEE 507

>TPHA0M00180 Chr13 (36974..38485) [1512 bp, 503 aa] {ON} Anc_6.8
           YPL272C
          Length = 503

 Score =  426 bits (1094), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 240/543 (44%), Positives = 342/543 (62%), Gaps = 56/543 (10%)

Query: 3   RSLSSYERKLLSEILENNKNGTVFGASYIFDDSVTADEHIWDDDNDTLAATRVESRSTKK 62
           R+L  YE+K+L++ +E  +NG VF +   F+    +DE  + DDN TL   R  +  + K
Sbjct: 4   RALGGYEKKVLAQTIEGRRNGVVFSSQITFNKK--SDE--FADDNATLYTGRSVNEVSLK 59

Query: 63  PALSLTLPLVTRALKSLIEKNPEMYTTVNDLLEFAPLKEIRTPDVISVVTFDNEKDEKVN 122
             L         AL+++I  + E+YTT+ND L F P+ +I T DVI  +++D  KD+ + 
Sbjct: 60  SVL-------CAALQNIICNHVELYTTINDRLYFTPVLQIETNDVIKTISYDKSKDKAL- 111

Query: 123 CHSGGPPPYLIRHILKNDVFQPGSNKPLWNLYLIDESQLVFHCQDILFDIFSAANFHKLF 182
                    L+RHI     F+P + KPLW   + ++S ++FH  D+LFDIFS ANF K  
Sbjct: 112 -MKDQISDKLLRHIFNKCDFKPNNGKPLWQFSIANDSTMIFHGHDVLFDIFSTANFEKYL 170

Query: 183 LKELIAVCRPQQSYEKPLEYLFKL--QKSFENNYSVPKSIYDNLKLHLPATRPELLNLQT 240
           LKE+  V    Q   K ++ LFK   ++S  N    P+SIY+N KLHLPA   +LLNLQT
Sbjct: 171 LKEMNDVLNSNQKL-KTVKTLFKFDAERSLTN---YPRSIYENPKLHLPALTSDLLNLQT 226

Query: 241 QSFFKSIFCNAVKKPLDFIQMPXXXXXXXXXXXXXXXXXXXQEGNQLKLFRTRYTNILTS 300
           QSFFK+I+ N +KKP+D I                         NQL  +RTR T+IL+ 
Sbjct: 227 QSFFKTIYQNTLKKPIDLI-----------------TSANSNNNNQLSEYRTRNTDILSG 269

Query: 301 ATSNCGHTIFGSVSNERFNYLNSVVKNEKICLRSFIAAITMLCLKPMVKSFNGTLIFSMP 360
           A S CG T+ G +S ER+ +L  +V+ E I LRSFI+AITM+CLKP+VK+F+G++IFS+P
Sbjct: 270 ANSLCGRTVLGEISLERYQHLKMLVEQENISLRSFISAITMVCLKPIVKNFDGSIIFSIP 329

Query: 361 MNLRDSMNEKRDFGLVYKDIRVECPLSMIDDKQCSVPGLNESDPEY-----NEKLLEIQF 415
           +NLR  + +  DFGL YK+I+VECPL +I+D++        ++PE      N  LLEIQF
Sbjct: 330 VNLRSLIADSSDFGLFYKNIKVECPLELINDEKYY------TNPEVLHSMQNNSLLEIQF 383

Query: 416 QQIATYVTESIEQRMSTWKKYGYNDNDMKRMKFTKYDEK--FAPNTRLIKINDVSEVSFD 473
           ++I+ +V++ I QRM  W+K+G+ND+D+KRMKF+  DEK   AP   +I+INDV+E+SFD
Sbjct: 384 ERISRHVSDVISQRMKAWEKFGFNDDDIKRMKFSN-DEKTGIAP---IIQINDVTEISFD 439

Query: 474 --DNDIRFP-HIKSPGFTTSLSQNTLMSLSYTHCEEDGLNICIHYPDGYNMENFVDCFES 530
             +++I +   + +  FT SLS N  MSL Y+H  + GLNICIHYPDGYNME FV+CF+S
Sbjct: 440 FGNDNISYSFSVNNLNFTKSLSCNEFMSLFYSHNAQGGLNICIHYPDGYNMEAFVECFQS 499

Query: 531 FME 533
           F+E
Sbjct: 500 FIE 502

>KAFR0B06510 Chr2 complement(1349540..1351066) [1527 bp, 508 aa]
           {ON} Anc_6.8 YPL272C
          Length = 508

 Score =  424 bits (1090), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 230/541 (42%), Positives = 345/541 (63%), Gaps = 46/541 (8%)

Query: 3   RSLSSYERKLLSEILENNKNGTVFGASYIFDDSVTADEHIWDDDNDTLAATRVESRSTKK 62
           R+LSSYERK+L E +   +NG +F ASY    S +++E  W DD  T   T  +SR T  
Sbjct: 4   RTLSSYERKILDETIRRERNGVIFTASY----SASSEE--WGDD--TTLLTLKDSRPT-- 53

Query: 63  PALSLTLPLVTRALKSLIEKNPEMYTTVNDLLEFAPLKEIRTPDVISVVTFDNEKDEKVN 122
                 + ++T+A++ LI ++ E++TT+N+  EF  LK I+  D+++++ FD+ KDEK+N
Sbjct: 54  ------IAILTKAIQRLISRHVELFTTINENYEFEILKSIKKDDILNILEFDSYKDEKIN 107

Query: 123 CHSGGPPPYLIRHILKNDVFQPGSNKPLWNLYLIDESQLVFHCQDILFDIFSAANFHKLF 182
           CH+G PP YL+RHI  N+ F PGS KPLW+L++IDES ++FH QD+LFDIFSAANFHKL 
Sbjct: 108 CHNGCPP-YLLRHIFDNNRFVPGSKKPLWSLHIIDESLVIFHGQDMLFDIFSAANFHKLL 166

Query: 183 LKEL-IAVCRPQQSYEKPLEYLFKLQKSFE--NNYSVPKSIYDNLKLHLPATRPELLNLQ 239
           LKE  I    P  S E  +  +F L+ S +  NN  + KSIYDN ++HLPAT P+L NLQ
Sbjct: 167 LKETNIVANEPLDSSESDI--IFSLENSIKKINNLKLSKSIYDNPRIHLPATSPDLFNLQ 224

Query: 240 TQSFFKSIFCNAVKKPLDFIQMPXXXXXXXXXXXXXXXXXXXQEGNQLKLFRT--RYTNI 297
           TQSFFKS+F + VKKP+ ++                         N L    T  +YT+I
Sbjct: 225 TQSFFKSVFHSTVKKPIHYL-------------VANVRTKEVTSDNTLSRVTTVQKYTDI 271

Query: 298 LTSATSNCGHTIFGSVSNERFNYLNSVVKNEKICLRSFIAAITMLCLKPMVKSFNGTLIF 357
               T+    T+FG ++ +R+ YLNS++ N++IC +SF+  I MLCLKP +++F G++ F
Sbjct: 272 FDYNTTLNNTTVFGKITRQRYEYLNSLITNQRICFKSFMVGIIMLCLKPSIENFEGSMKF 331

Query: 358 SMPMNLRDSMNEKR-DFGLVYKDIRVECPLSMIDDKQCSVPG---LNESDPEYNEKLLEI 413
           S+ +NLR  + E   +FGL YKD+ ++ PLS+IDD    + G    +++DP+  EK+LE 
Sbjct: 332 SIVINLRPFLKESNIEFGLFYKDVLIDVPLSLIDDNAVMLSGYRDFSDNDPDLTEKILEF 391

Query: 414 QFQQIATYVTESIEQRMSTWKKYGYNDNDMKRMKFTKYDEKFAPNTRLIKINDVSEVSFD 473
           QF+++ + V + IE+R+S +   G+ND+D+++MK+ K     A +T++I++ D SEVS  
Sbjct: 392 QFKRVTSLVKDLIERRISKFSTMGFNDDDIRQMKYGKP----AEDTKIIRLFDTSEVSLG 447

Query: 474 DNDIRFPHI-KSPGFTTSLSQNTLMSLSYTHCEEDGLNICIHYPDGYNMENFVDCFESFM 532
                  +I  +  FT SL +N   S+SYT C+  GLN+C+ +PD  +ME FV+CF+SF+
Sbjct: 448 SGKRDGKYILHNTNFTKSLRKNDFFSVSYTLCDNSGLNLCLQFPDDCDMEAFVECFQSFI 507

Query: 533 E 533
           E
Sbjct: 508 E 508

>TPHA0J00260 Chr10 (59857..61404) [1548 bp, 515 aa] {ON} Anc_6.8
           YPL272C
          Length = 515

 Score =  406 bits (1044), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 224/547 (40%), Positives = 323/547 (59%), Gaps = 55/547 (10%)

Query: 3   RSLSSYERKLLSEILENNKNGTVFGASYIFDDSVTADEHIWDDDNDTLAATRVESRSTKK 62
           R L+SYER +L E  EN  NGT+F A Y    +        +DD  TL     E+    +
Sbjct: 4   RPLASYERNVLIESYENQTNGTIFSAKY----TDMQTNSTINDDAATLLTQNEENNMFSR 59

Query: 63  PALSLTLPLVTRALKSLIEKNPEMYTTVNDLLEFAPLKEIRTPDVISVVTFDNEKDEKVN 122
                       AL ++I +NPE+YTT+N  LEF P+ EI+T DVIS + F++ KDE VN
Sbjct: 60  ---------FINALATVITENPELYTTINTKLEFEPITEIKTDDVISSIKFNSTKDEFVN 110

Query: 123 CHSGGPPPYLIRHILKNDVFQPGSNKPLWNLYLIDESQLVFHCQDILFDIFSAANFHKLF 182
           C +G PP YL+RHI   D F PGS KPLWNLY++D+S ++FH QD+LFDI+SAA+FH+ F
Sbjct: 111 CKNGAPP-YLLRHIFNKDKFVPGSGKPLWNLYIVDDSIVIFHGQDVLFDIYSAASFHRKF 169

Query: 183 LKELIAVCRPQQSYEKPLEYLFKLQKSFENNYSVPKSIYDNLKLHLPATRPELLNLQTQS 242
              L     P       +  L  L KS    Y  PKSIYD+  L LPA   +L++LQT+ 
Sbjct: 170 FAALEGAT-PTSEKLTTIFRLSDLSKS-ALTYPFPKSIYDSPLLMLPAKTIDLVSLQTRF 227

Query: 243 FFKSIFCNAVKKPLDFIQMPXXXXXXXXXXXXXXXXXXXQEGNQLKLF-RTRYTNILTSA 301
           F KS+    + KPL+ I                           +K F  +   +IL   
Sbjct: 228 FLKSVVSKTIVKPLNIIMF---------------------NDEPMKSFTNSDPMDILEKT 266

Query: 302 TSNCGHTIFGSVSNERFNYLNSVVKNEKICLRSFIAAITMLCLKPMVKSFNGTLIFSMPM 361
           +S CG T+FG++SNERF+YL S+ + E +C +S +  ITMLCLKP++K F+  + FS+ M
Sbjct: 267 SSLCGTTVFGNISNERFDYLQSIAEEENVCTKSLVCGITMLCLKPLIKDFSSNITFSIAM 326

Query: 362 NLRDSMNEKRDFGLVYKDIRVECPLSMIDDK-----------QCSVPGLNESDPEYNEKL 410
           NLRDS+ E  +FGL YK++R+E PLS IDD              S   + E++P Y E+L
Sbjct: 327 NLRDSIEESTEFGLFYKNVRIEVPLSFIDDNVFKLKTSYNGYDASNSNIKETNPNYEEQL 386

Query: 411 LEIQFQQIATYVTESIEQRMSTWKKYGYNDNDMKRMKFTKYDEKFAPNTRLIKINDVSEV 470
           +  QF QIAT+++ +++QRM  W++ G+ND+D+K MKF   D+    + ++I+IND+S++
Sbjct: 387 IAYQFNQIATFISRNLKQRMRAWRRNGFNDDDIKMMKFGSKDKN--TSAKIIQINDISDL 444

Query: 471 SF----DDNDIRFPHIKSPGFTTSLSQNTLMSLSYTHCEEDGLNICIHYPDGYNMENFVD 526
           SF     + ++    +K   FT SL  +  MSLSYTHC+  G NICIH+P+ Y++E FV+
Sbjct: 445 SFCPMNKNGELNSVSLKDLSFTHSLVPDQFMSLSYTHCKSTGSNICIHFPEVYDLELFVE 504

Query: 527 CFESFME 533
            F++F++
Sbjct: 505 KFQNFID 511

>NCAS0D02180 Chr4 (406396..407943) [1548 bp, 515 aa] {ON} Anc_6.8
          Length = 515

 Score =  348 bits (893), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 209/549 (38%), Positives = 313/549 (57%), Gaps = 52/549 (9%)

Query: 2   SRSLSSYERKLLSEILENNKNGTVFGASYIFDDSVTADEHIWDDDNDTLAATRVESRSTK 61
           SR LS YE KLL + L+  +NG  F A Y          +     + +  +T V  +  +
Sbjct: 3   SRQLSEYEVKLLEQTLQGKRNGVAFAAKY-------GRNYDDSSLSSSDESTLVSLKDRR 55

Query: 62  KPALSLTLPLVTRALKSLIEKNPEMYTTVNDLLEFAPLKEIRTPDVISVVTFDNEKDEKV 121
                LTL ++TR L+ LI K+ E+YT +++   ++ + EIR  DVI ++TFD+EKDE++
Sbjct: 56  -----LTLSVITRVLQILIPKHIELYTAISEDHRYSLVTEIRAKDVIDIITFDSEKDERI 110

Query: 122 NCHSGGPPPYLIRHILKNDVFQPGSNKPLWNLYLIDESQLVFHCQDILFDIFSAANFHKL 181
           NCH G PPPYL+RHI     F+ G  KPLW LY+IDE+ ++FH  D+LFD FSAA FHK 
Sbjct: 111 NCHLG-PPPYLLRHIFNKSDFKLGQQKPLWKLYIIDETTIIFHGFDMLFDSFSAAYFHKC 169

Query: 182 FLKE----LIAVCRPQQSYEKPLEYLFKLQKSFE--NNY-SVPKSIYDNLKLHLPATRPE 234
           FL E    + ++   +Q  +KPL+YLF+L  S +    Y  +P+SIYD            
Sbjct: 170 FLAEVNSYMSSIVSSKQ--KKPLDYLFQLSSSADLIKIYDEIPRSIYDYDSSPFAPLTAV 227

Query: 235 LLNLQTQSFFKSIFCNAVKKPLDFIQMPXXXXXXXXXXXXXXXXXXXQEGNQLKLFRTR- 293
           + N QT+SFFKS++ NAVKKP++FI                      +   Q+K   T  
Sbjct: 228 MFNDQTKSFFKSLYLNAVKKPIEFI---------------TNTSSQVKTYQQIKEAETEG 272

Query: 294 YTNILTSATSNCGHTIFGSVSNERFNYLNSVVKNEKICLRSFIAAITMLCLKPMVKSFNG 353
           Y N +    S CG+TIFG++S+ RFN L      E+I L+S I  + M+ LKP +  F+ 
Sbjct: 273 YLNPMGIHRSLCGNTIFGTISSCRFNELTEKATREQISLKSLICGLIMMSLKPTLNDFSK 332

Query: 354 TLIFSMPMNLRDSMNEKRDFGLVYKDIRVECPLSMIDDKQCSVP------GLNESDPEYN 407
            ++FS+ +NLRD +++ + FGL Y+DI +ECPLS+IDD+           G+   + E  
Sbjct: 333 NMVFSIRVNLRDDVSKSKTFGLYYRDIIIECPLSLIDDRAIQFSGYRDHVGITAQELETY 392

Query: 408 EKLLEIQFQQIATYVTESIEQRMSTWKKYGYNDNDMKRMKFTKYDEKFAPNTRLIKINDV 467
           EK+ E QF+ + TY+   + +++  WK     DND+K MK      +      +I+IND+
Sbjct: 393 EKVYEQQFKDVTTYIQNVMNEKIGYWK----TDNDIKMMKMMDDMHQ--SKDEIIQINDL 446

Query: 468 SEVSFDDN-DIRFPH-IKSPGFTTSLSQNTLMSLSYTHCEEDGLNICIHYPDGYNMENFV 525
           +E+  ++N     P+ +KS    TSLS+  + S+SYTHCE  GL I IH P   +ME+FV
Sbjct: 447 TEIDINENLSQNDPYCVKSSSMVTSLSKKEMFSVSYTHCEASGLTISIHIPKMRSMESFV 506

Query: 526 DCFESFMEE 534
           + F++F++E
Sbjct: 507 ENFQAFLDE 515

>TBLA0A07220 Chr1 (1800531..1802060) [1530 bp, 509 aa] {ON} Anc_6.8
           YPL272C
          Length = 509

 Score =  323 bits (827), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 205/549 (37%), Positives = 299/549 (54%), Gaps = 71/549 (12%)

Query: 3   RSLSSYERKLLSEILEN-NKNGTVFGASYIFDDSVTADEHIWDDDNDTLAATRVESRSTK 61
           R LSS E++ L   LE+  ++G+V    ++ +    +D+           AT + S+   
Sbjct: 13  RPLSSVEKRFLGNSLESETRHGSVCSGKWVSNSLDISDD-----------ATLLSSKD-- 59

Query: 62  KPALSLTLPLVTRALKSLIEKNPEMYTTVNDLLEFAPLKEIRTPDVISVVTFDNEKDEKV 121
           KP   LT+ LV+RALK LI  + EM+TT+N   EF  L +I T DV+  + F+N+KDE V
Sbjct: 60  KP---LTISLVSRALKILISNHIEMFTTINKNSEFQLLDKINTSDVLHSICFENKKDELV 116

Query: 122 NCHSGGPPPYLIRHILKNDVFQPGSNKPLWNLYLIDESQLVFHCQDILFDIFSAANFHKL 181
           NCHSG  PPYLI +I     FQP S KPLW L++++ S +VF+  D LFDIF+ ANF KL
Sbjct: 117 NCHSGA-PPYLINYIFSLPYFQPDSKKPLWQLFIVNSSLVVFYGDDTLFDIFAVANFIKL 175

Query: 182 FLKELIAVCRPQQSYEKPLEYLFKLQKSFE-NNYSVPKSIYDNLKLHLPATRPELLNLQT 240
             +  I    P ++ E   + +FKL      +  + PKSIYDN  LHLPAT+PEL NLQT
Sbjct: 176 LFE--IINSLPYENKEIQDDIIFKLPNIRNISKINFPKSIYDNPMLHLPATKPELFNLQT 233

Query: 241 QSFFKSIFCNAVKKPLDFIQMPXXXXXXXXXXXXXXXXXXXQEGNQLKLFRTRYTNILTS 300
           QSFFKSI+ N  KK  D++                                  Y  IL  
Sbjct: 234 QSFFKSIYLNTFKKSFDYLNFTQQTPIILARNHN---------------ISKNYNEILHL 278

Query: 301 ATSNCGHTIFGSVSNERFNYLNSVVKNEKICLRSFIAAITMLCLKPMVKSFNGTLIFSMP 360
            +      + G+VS ER+  L  ++  EKI L+SF  +I ++CLK M+  F+G++IF +P
Sbjct: 279 NSIVKSELVTGNVSMERYLQLLKLIDAEKIDLKSFFCSIIIMCLKFMITCFDGSIIFKIP 338

Query: 361 MNLRDSMNEKRD----------------FGLVYKDIRVECPLSMIDDKQCSVPGLNESDP 404
            NLR SM   RD                 G++YKDI VE PL +I+              
Sbjct: 339 YNLR-SMQNLRDKENHNSSSGPEDSANELGIIYKDIYVEVPLKLIEKIG----------- 386

Query: 405 EYNEKLLEIQFQQIATYVTESIEQRMSTWKKYGYNDNDMKRMKFTKYDEKFAPNTRLIKI 464
             NE ++E QF+ +  Y+ ESI++R+  W+K G+ND+D+KRMKF      +     +I++
Sbjct: 387 --NEDVVEEQFKIVCNYINESIQKRIKAWEKNGFNDDDIKRMKFG-----YEQVGNIIEV 439

Query: 465 NDVSEVSFDDNDIRFPHIKSPGFTTSLSQNTLMSLSYTHCEEDGLNICIHYPDGYNMENF 524
           ND++ +    +     HI+    T +L +N ++SLS+     +GLN+CI+Y   Y M++F
Sbjct: 440 NDLTSLDLSCSKDSLFHIEDLSLTRNLKKNQILSLSFASNNYNGLNLCINYSTEYKMKDF 499

Query: 525 VDCFESFME 533
           +DCF+SFME
Sbjct: 500 IDCFQSFME 508

>Ecym_3011 Chr3 (22943..24472) [1530 bp, 509 aa] {ON} similar to
           Ashbya gossypii ACR018C
          Length = 509

 Score =  252 bits (643), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 167/545 (30%), Positives = 289/545 (53%), Gaps = 61/545 (11%)

Query: 3   RSLSSYERKLLSEILENNKNGTVFGASYIFDDSVTADEHIWDDDNDTLAATRVESRSTKK 62
           R LSS E+    E+  + +NG VF  +Y    S   +   W DD  TL+  R +SR    
Sbjct: 9   RDLSSVEKIFHKEVYTSRRNGIVFAVNY---SSNKCESERWSDD-ITLSNLR-DSR---- 59

Query: 63  PALSLTLPLVTRALKSLIEKNPEMYTTVNDLLEFAPLKEIRTPDVISVVTFDNEKDEKVN 122
               L    ++ AL+++I++N E+  T+ D  +FAP + IR  DV+  + F   KDE + 
Sbjct: 60  ----LFDGQISNALEAMIKENVELCVTITDDRKFAPTEIIRYDDVVIHIEFKTYKDELIE 115

Query: 123 CHSGGPPPYLIRHILKNDVFQPGSNKPLWNLYLIDESQLVFHCQDILFDIFSAANFHKLF 182
           C +G  PPY++R+IL+N+ F+ G  +PLW L ++D + ++ HC +++FD+F+AANFH  F
Sbjct: 116 CQNG-IPPYILRNILENNKFEFG--RPLWELIIVDYTMVILHCHEVMFDLFAAANFHLKF 172

Query: 183 LKELIAVCRPQQSYEKPLEYLFKLQKSFENNYSVPKSIYDNLKLHLPATRPELLNLQTQS 242
            K L     P+ ++   L+ LF  +    N   + K+ +D +   +  +  + L LQ  S
Sbjct: 173 QKALSQF--PKDTH--ALDILFVYEG---NELQLSKTNFDGMS-QISVSPVQSLPLQCIS 224

Query: 243 FFKSIFCNAVKKPLDFIQMPXXXXXXXXXXXXXXXXXXXQEGNQLKLFRTRYTNILTSA- 301
             K  +   VKK L+ I+                        NQ+  + +  +++  S  
Sbjct: 225 VLKGAYRTTVKKSLNVIRRNFVA------------------NNQITTYESSKSDVFKSMF 266

Query: 302 --TSNCGHTIFGSVSNERFNYLNSVVKNEKICLRSFIAAITMLCLKPMVKSFNGTLIFSM 359
              + CG T+ GS++ ER   L  +  +E +C+ S + AIT+L LKP+++ FNG++ F +
Sbjct: 267 NPNTLCGTTVSGSLNAERLASLLELTSSENVCMTSVLCAITLLSLKPLIRKFNGSITFVV 326

Query: 360 PMNLRDSMNEKRDFGLVYKDIRVECPLSMIDDKQC----------SVPGLNESDPEYNEK 409
           P+++R+ + E  D G+ Y ++ VECPLS I+DK            S+  ++ + P+Y E 
Sbjct: 327 PIDIREKL-EIFDLGVSYTNLMVECPLSFINDKDFQHTVSDGNIKSLHKIDPNSPDYPEM 385

Query: 410 LLEIQFQQIATYVTESIEQRMSTWKKYGYNDNDMKRMKFTKYDEKFAPNTRLIKINDVSE 469
           LLE QF+Q+ ++V  S++++   W+K  ++ + +K  K  + ++      + I+IN V  
Sbjct: 386 LLEYQFKQLTSHVMNSLKEKKQAWQKRRFDMSSLKGKKLRRSNKII--RGKFIEINLVDM 443

Query: 470 VSFDDNDIRFPHIKSPGFTTSLSQNTLMSLSYTHCEEDGLNICIHYPDGYNMENFVDCFE 529
               D      H K+  FT+SL    L+S+S       G+NI +HYP+  +M+ FV+CF+
Sbjct: 444 GEAQDGQF---HTKNVNFTSSLGSKCLISVSCAILRGVGMNIFMHYPESNDMDAFVECFQ 500

Query: 530 SFMEE 534
             +E+
Sbjct: 501 ILLED 505

>Kwal_56.22341 s56 (56939..58498) [1560 bp, 519 aa] {ON} YPL272C -
           Hypothetical ORF [contig 186] FULL
          Length = 519

 Score =  241 bits (615), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 178/564 (31%), Positives = 285/564 (50%), Gaps = 93/564 (16%)

Query: 3   RSLSSYERKLLSEILENNKNGTVFGASYIFDDSVTADEHIWDDDNDTLAATRVESRSTKK 62
           R+L++ E+ ++ E     KNG +F ++Y         E   + DN +       S S  K
Sbjct: 9   RNLTATEKTIICETAAGIKNGVLFSSTYF--------EGPDNVDNTS------PSVSCMK 54

Query: 63  PALSLTLPLVTRALKSLIEKNPEMYTTVNDLLEFAPLKEIRTPDVISVVTFDNEKDEKVN 122
               L   ++ +AL  +I++N E+ +++N  ++F  +  I   DV+  + FDN  DEKV+
Sbjct: 55  MGKGLPDAIMWQALSQIIKENAELRSSINKFMQFEAIDTIAFDDVVRKIEFDNLTDEKVS 114

Query: 123 CHSGGPPPYLIRHILKNDVFQPGSNKPLWNLYLIDESQLVFHCQDILFDIFSAANFHKLF 182
           C++G  PPYL+RHI     F  G  KPLW +++ID+S +VFH  D+LFD F+AA FHKLF
Sbjct: 115 CYNG-VPPYLLRHIFDKCHFSIGQQKPLWQVFVIDQSMVVFHGHDVLFDGFAAATFHKLF 173

Query: 183 LKELIAV--CRPQQS--YEKPLEYLFKLQKSF--ENNYSVPKSIYDNLKLHLPATRPELL 236
           L+ L +    + Q+S    K  E L  L +S   E+N S+  S+ D +  +         
Sbjct: 174 LEALNSFRNVKGQKSDLIFKTREDLIPLCQSLAAEHNVSLISSVKDQVLTY--------- 224

Query: 237 NLQTQSFFKSIFCNAVKKPLDFIQMPXXXXXXXXXXXXXXXXXXXQEGNQLKLFRTRYTN 296
              +Q+  K+++  A+KKPL FI                       E  +L+      +N
Sbjct: 225 ---SQTALKNLYSLAIKKPLRFI-----------------------ESGRLEHSGIPASN 258

Query: 297 ---ILTSATSNCGHTIFGSVSNERFNYLNSVVKNEKICLRSFIAAITMLCLKPMVKSFNG 353
              + + A   CG  +FG+V+ ER   L +++   KI  RSFI ++TM CL P+++    
Sbjct: 259 PYDLASYAGDLCGTVVFGNVNPERVRGLRALMNESKISFRSFIISVTMFCLLPVLEPSEE 318

Query: 354 TLIFSMPMNLRDSMNEKRDFGLVYKDIRVECPLSMI--DDKQCS---------------- 395
            +IFS+P+NLR+S+    D G+   ++  ECPL +I  D + CS                
Sbjct: 319 KIIFSVPINLRESIPWASDLGVFQNNVLFECPLDLIKHDIEPCSGISTFNQEFLEGSTLT 378

Query: 396 -VPGLNE--SDPEYNEKLLEIQFQQIATYVTESIE-QRMSTWKKYGYNDNDMKRMKFTKY 451
            V G+NE  +DP       +  F++I T+VT  +E   M   K +   ++ +K  +  +Y
Sbjct: 379 DVGGVNEDQNDP-------QTVFRRILTHVTTELELAAMRLEKSHSSGEDLIKAEREARY 431

Query: 452 DEKFAPNTR--LIKINDVSEVSFDDNDIRFPHIKSPGFTTSLSQNTLMSLSYTHCEEDGL 509
              FA ++R  +++IND+ EV           I     T+S   +T MS+SY   E  GL
Sbjct: 432 ---FAASSRSKIVEINDLLEVDLSSKIHSRYKIGDVCSTSSRKSDTFMSISYCSSEISGL 488

Query: 510 NICIHYPDGYNMENFVDCFESFME 533
           N+ IHY +G+NME FV+ FE F++
Sbjct: 489 NLGIHYSEGFNMEYFVESFEGFLD 512

>KLTH0C11572g Chr3 complement(950297..951853) [1557 bp, 518 aa] {ON}
           similar to uniprot|Q08984 Saccharomyces cerevisiae
           YPL272C Hypothetical ORF
          Length = 518

 Score =  240 bits (613), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 164/545 (30%), Positives = 275/545 (50%), Gaps = 56/545 (10%)

Query: 3   RSLSSYERKLLSEILENNKNGTVFGASYIFDDSVTADEHIWDDDNDTLAATRVESRSTKK 62
           R+L+  E+ +L E     KNG +F A+Y + +    D      DN+TL       RS   
Sbjct: 9   RNLTPTEKTILCETATGVKNGVLFSATY-YKNFPNKDL----SDNETL-------RSDMN 56

Query: 63  PALSLTLPLVTRALKSLIEKNPEMYTTVNDLLEFAPLKEIRTPDVISVVTFDNEKDEKVN 122
             LS ++  + +AL  +I+++ E+   V+  LEF P+ +I   DV+  + FD   DE+VN
Sbjct: 57  QRLSDSM--IWKALLKVIKEHAELRCAVSRNLEFEPVDKIDFEDVVRKIEFDCYADEQVN 114

Query: 123 CHSGGPPPYLIRHILKNDVFQPGSNKPLWNLYLIDESQLVFHCQDILFDIFSAANFHKLF 182
           C++G  PPYL+RHI     F  G  +PLW L++ID + +VFH  D+LFD F+AANFHKLF
Sbjct: 115 CYNG-VPPYLLRHIFDKCHFTLGQKQPLWQLFVIDGTMVVFHGHDVLFDTFAAANFHKLF 173

Query: 183 LKELIAVCRPQQSYEKPLEYLFKLQKSFENNYSVPKSIYDNLKLHLPATRPELLNLQTQS 242
           L+ L ++     S  +P   +FK  K      ++P++++   +    ++  +    Q+Q+
Sbjct: 174 LQALNSLSESCTS-PRP---VFKGGKILP---TLPRALFQKQEPQAASSITDAFYSQSQA 226

Query: 243 FFKSIFCNAVKKPLDFIQMPXXXXXXXXXXXXXXXXXXXQEGNQLKLFRTRYTNILTSAT 302
             +S++  A+KKPL FI+                       G    L    Y N L    
Sbjct: 227 ILRSLYNLAIKKPLRFIE-----------SGRIEHSTEQHSGTPEPL---NYPNHL---- 268

Query: 303 SNCGHTIFGSVSNERFNYLNSVVKNEKICLRSFIAAITMLCLKPMVKSFNGTLIFSMPMN 362
             CG  +FG++S  RF  L  ++ + KI +++FI + T+ CL+P++ S    + FS+P+N
Sbjct: 269 --CGTVVFGTISTPRFKILKGILNDHKISMKTFIISATLFCLQPVLDSSEDKITFSLPIN 326

Query: 363 LRDSMNEKRDFGLVYKDIRVECPLSMIDDKQCSVPGLNESDPEYNEKLL----------- 411
           LRD +      G+ ++++ +ECPL           G   S+PE  E +            
Sbjct: 327 LRDLIPWSSPLGIYHRNVLIECPLGTAGRNSNCSAGSYVSNPELLEGMTLSDANQTNADQ 386

Query: 412 ---EIQFQQIATYVTESIEQRMSTWKKYGYNDNDMKRMKFTKYDEKFAPNTRLIKINDVS 468
              E  F++  T+V+  +++ +   +   + D DM +M+        A  +++I+IND+S
Sbjct: 387 ADPESLFERTVTHVSNELKKALQDLETGKFKDMDMMKMEQEAKFYAAASGSKIIEINDLS 446

Query: 469 EVSFDDNDIRFPHIKSPGFTTSLSQNTLMSLSYTHCEEDGLNICIHYPDGYNMENFVDCF 528
           E+   + +     ++    T S   NT MS+SY+     GLN+ IHY +   M  FV+ F
Sbjct: 447 EIDLSNVNPSQYVVEDICATKSRCNNTFMSISYSFSSTCGLNLGIHYSEDCEMNYFVESF 506

Query: 529 ESFME 533
           E+F+E
Sbjct: 507 EAFLE 511

>ACR018C Chr3 complement(388482..389918) [1437 bp, 478 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL272C
          Length = 478

 Score =  228 bits (580), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 153/477 (32%), Positives = 255/477 (53%), Gaps = 61/477 (12%)

Query: 72  VTRALKSLIEKNPEMYTTVNDLLEFAPLKEIRTPDVISVVTFDNEKDEKVNCHSGGPPPY 131
           ++ AL+S+I +N EM  TV D  +FAP+  I   DV+ V+ F   KDE + CH G  PPY
Sbjct: 47  ISSALRSMIRENVEMCVTVTDGPKFAPVSRIEYDDVVRVIEFQTYKDEAIACHDG-IPPY 105

Query: 132 LIRHILKNDVFQPGSNKPLWNLYLIDESQLVFHCQDILFDIFSAANFHKLFLKELIAVCR 191
           + RHIL    F+ G  KPLW +Y+ D S ++FHC ++LFD+F+A NFH  F ++ +  C 
Sbjct: 106 VARHILNKSKFEAG--KPLWEVYIADGSMVIFHCHNVLFDLFAAGNFHVRF-QQALQRCE 162

Query: 192 PQQSYEKPLEYLFK---LQKSFE-NNYSVPKSIYDNLKLHLPATRPELLNLQTQSFFKSI 247
             + + + L ++++   LQ   + +  S+P      + +  PA+ P +      SF K++
Sbjct: 163 KNEPHNETL-FVYEGGPLQLPIDPDACSLP-----GVDVPYPASSPFV------SFVKNV 210

Query: 248 FCNAVKKPLDFIQMPXXXXXXXXXXXXXXXXXXXQEGNQLKLFRTRYTNILTSATSNCGH 307
            C    KP   +                         N+  L R  +   L    S  G 
Sbjct: 211 -CRYALKPFGALASAVTPSLRL---------------NRSSLGRKPFLLTL-DKESLYGT 253

Query: 308 TIFGSVSNERFNYLNSVVKNEKICLRSFIAAITMLCLKPMVKSFNGTLIFSMPMNLRDSM 367
           T+ G +++++ + L  ++  E++C+RSF+ AIT+L LKP++++F+G++ FS+P++LR   
Sbjct: 254 TVSGYLNSKKLDSLLKLISKEEVCVRSFLCAITLLSLKPLIRNFDGSIAFSIPLDLRTES 313

Query: 368 NEKRDFGLVYKDIRVECPLSMIDDK----------QCSVPGLNESDPEYNEKLLEIQFQQ 417
           ++   FG   K I V+CPL++IDD+          +     L+++ P+++E LLE QF++
Sbjct: 314 HKTTPFGFQSKRILVDCPLALIDDRVFESLFNRPSKQRKTKLDKNSPKFSEGLLEYQFKR 373

Query: 418 IATYVTESIEQRMSTWKKYGYNDNDMKRMKFTKYDEKFAPNTRLIKINDVSEVSFDDNDI 477
           + T+V +S+  + S        D   KR    KY +      ++I+IN V   +      
Sbjct: 374 VTTHVMKSLTAQTS-------GDWTGKR----KYSKCQLRKKKIIEINVVDMGT--SPSA 420

Query: 478 RFPHIKSPGFTTSLSQNTLMSLSYTHCEEDGLNICIHYPDGYNMENFVDCFESFMEE 534
           RF  IK+  FT SL   T MSLS       G+N+C+HY +  +M+ FVDCF++F++E
Sbjct: 421 RF-QIKNMNFTDSLGSETFMSLSCALMRGVGMNMCMHYLERDSMDMFVDCFQTFLDE 476

>Kpol_1032.1 s1032 (25..765) [741 bp, 246 aa] {ON} (25..765) [741
           nt, 247 aa]
          Length = 246

 Score =  138 bits (348), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 77/234 (32%), Positives = 140/234 (59%), Gaps = 18/234 (7%)

Query: 307 HTIFGSVSNERFNYLNSVVKNEKICLRSFIAAITMLCLKPMVKSFNGTLIFSMPMNLRDS 366
             +FG+++ ERFN L ++++  +ICLRS I  I MLC KP +++F+G + FS+ ++++  
Sbjct: 23  RVLFGTIAAERFNRLKALIRKGRICLRSVICGIVMLCTKPNIQNFDGNIRFSIGVDMKPI 82

Query: 367 MNEKRDFGLVYKDIRVECPLSMIDDKQCSVPGLNESDPEY--NEKLLEIQFQQIATYVTE 424
           +++   FG++ K+I V+CPL +IDDK        ++D E   N  +LEIQF+++  +VTE
Sbjct: 83  VDDSSQFGILKKNIIVDCPLKLIDDKH-----YKDTDSESIKNGDILEIQFRKVTDFVTE 137

Query: 425 SIEQRMSTWKKYGYNDNDMKRMKFTKYDEKFAPNTRLIKINDVSEVSF-----DDNDIRF 479
            +  ++ +  K+   +N      F+  + + + ++++I+IND++++ F     + N   F
Sbjct: 138 ELSNKLQSMAKHFKRNN--CPFNFSSINSQIS-DSKVIQINDLTDIPFTTTEQNPNGYSF 194

Query: 480 PHIKSPGFTTSLSQNTLMSLSYTHCEEDGLNICIHYPDGYNMENFVDCFESFME 533
             +K    T  LS N  MSLSY       ++I IHY +   M++FV+CF +F+E
Sbjct: 195 HDLK---VTEGLSPNESMSLSYITNSNSAMSISIHYTETKYMDSFVECFRTFIE 245

>Kpol_191.1 s191 complement(429..848) [420 bp, 139 aa] {ON}
           complement(429..848) [420 nt, 140 aa]
          Length = 139

 Score = 48.9 bits (115), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 46/153 (30%), Positives = 70/153 (45%), Gaps = 16/153 (10%)

Query: 1   MSRSLSSYERKLLSEILENNKNGTVFGASYIFDDSVTADEHIWDDDNDTLAATRVESRST 60
           M R L+  E+  L +  E + NG +F        S   ++++ DD   TL  T       
Sbjct: 1   MLRILNESEKSALKQTSEGSMNGIIFSVKI----SKKCEDNLSDDA--TLHTTGESGNLQ 54

Query: 61  KKPALSLTLPLVTRALKSLIEKNPEMYTTVNDLLEFAPLKEIRTPDVISVVTFDNEKDEK 120
                      + ++LK LI K  E+ TTV++ L F  L E++T DV+ ++ +   K + 
Sbjct: 55  LL---------LLKSLKLLIPKYKELCTTVDENLHFVHLDEVKTTDVVKIINYSRRKFD- 104

Query: 121 VNCHSGGPPPYLIRHILKNDVFQPGSNKPLWNL 153
           +N    GP   LI  I  +  FQPGS KP   L
Sbjct: 105 INEGLSGPSSSLINSIYYHSNFQPGSGKPYGKL 137

>Ecym_2483 Chr2 (946645..948030) [1386 bp, 461 aa] {ON} similar to
           Ashbya gossypii ACL138C
          Length = 461

 Score = 40.0 bits (92), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 37/118 (31%), Positives = 47/118 (39%), Gaps = 18/118 (15%)

Query: 75  ALKSLIEKNPEMYTTV----NDLLEFAPLK-EIRTPDVISVVTFDNEKDEKVNCHSGGPP 129
            LK LI K+P +Y  +           PL  EIR  DV+    FD+  +   N       
Sbjct: 41  VLKELIPKHPHLYRNIFTKDGSKKLVRPLNVEIRLDDVLEETGFDSLDESAANS------ 94

Query: 130 PYLIRHILKNDVFQPGSNKPLWNLY-LIDESQLVFHCQDILFDIFSAANFHKLFLKEL 186
                 ILKN  FQ    +PLW L  L   +Q +F      FD  SA  F   F+  L
Sbjct: 95  ------ILKNSTFQYDQQRPLWKLISLKAGTQFLFCFDHAFFDGMSAVIFWNDFISAL 146

>KLTH0C02178g Chr3 complement(196605..197999) [1395 bp, 464 aa] {ON}
           weakly similar to uniprot|P53304 Saccharomyces
           cerevisiae YGR212W SLI1 N-acetyltransferase confers
           resistance to the sphingolipid biosynthesis inhibitor
           myriocin (ISP-1) by inactivating it co-operates with
           Ypk1p in mediating resistance to myriocin converts
           myriocin into N-acetyl-myriocin
          Length = 464

 Score = 39.7 bits (91), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 29/122 (23%), Positives = 56/122 (45%), Gaps = 17/122 (13%)

Query: 72  VTRALKSLIEKNPEMYTTV---NDLLEFAPLKE-IRTPDVISVVTFDNEKDEKVNCHSGG 127
           + +A+++++ + P++Y+ V   N  L   PL+  +   DV+     ++  +E  N     
Sbjct: 38  IVQAVRAVVPEYPQLYSDVVTRNGSLVLEPLQSTLVLSDVVEFTEMESLDEEHSN----- 92

Query: 128 PPPYLIRHILKNDVFQPGSNKPLWNLYLIDESQLVFHCQD-ILFDIFSAANFHKLFLKEL 186
                   I K   F  G+ KPLW + ++ + +    C D ++ D  SA  F   F++ L
Sbjct: 93  -------KIFKEVTFVYGAEKPLWKVLILKDQRTFVLCSDHLILDGLSATVFWGSFMRSL 145

Query: 187 IA 188
            A
Sbjct: 146 NA 147

>Kwal_27.9898 s27 (112396..113778) [1383 bp, 460 aa] {ON} YGR212W -
           Hypothetical ORF [contig 43] FULL
          Length = 460

 Score = 36.2 bits (82), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 30/122 (24%), Positives = 53/122 (43%), Gaps = 17/122 (13%)

Query: 72  VTRALKSLIEKNPEMYTTV---NDLLEFAPLKE-IRTPDVISVVTFDNEKDEKVNCHSGG 127
           +  A+K+ +E+ P +Y+ V    +L    P+ E I    V+    +    ++  N     
Sbjct: 38  ICGAIKATVEECPHLYSDVVTKGELPSLEPINEQILLEQVLEYTDYGLLDEDICN----- 92

Query: 128 PPPYLIRHILKNDVFQPGSNKPLWNLYLIDESQLVFHCQD-ILFDIFSAANFHKLFLKEL 186
                   I +   F  GS KPLW + ++++ + +  C D ++ D  S   F K FL  L
Sbjct: 93  -------KIFREVEFTYGSGKPLWKVLVLNDRRTLVLCTDHVILDGLSTVAFWKKFLGSL 145

Query: 187 IA 188
            A
Sbjct: 146 NA 147

>ACL138C Chr3 complement(109749..111116) [1368 bp, 455 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGR212W
          Length = 455

 Score = 33.9 bits (76), Expect = 0.96,   Method: Compositional matrix adjust.
 Identities = 35/134 (26%), Positives = 59/134 (44%), Gaps = 23/134 (17%)

Query: 64  ALSLTLPL----VTRALKSLIEKNPEMYTTV--NDL---LEFAPLKE-IRTPDVISVVTF 113
            ++L +PL    +  AL+ ++   P++Y+ V  +D+   L   PL E I   DV+ +   
Sbjct: 26  GVTLNVPLDRAKLEIALRKVVNNYPQLYSNVFYDDMSGDLCLRPLSEKIYIGDVLGLAES 85

Query: 114 DNEKDEKVNCHSGGPPPYLIRHILKNDVFQPGSNKPLWNLYLIDESQLVFHCQD-ILFDI 172
           D   ++  N             I KN  F+     PLW +  +   Q +  C D ++ D 
Sbjct: 86  DKLDEDASN------------WIFKNINFKYHCQCPLWKIVSMQAGQQLLFCFDHLILDG 133

Query: 173 FSAANFHKLFLKEL 186
            S A F +  L+EL
Sbjct: 134 MSGALFWEDVLREL 147

>CAGL0K00737g Chr11 complement(81263..82636) [1374 bp, 457 aa] {ON}
           similar to uniprot|P53304 Saccharomyces cerevisiae
           YGR212w
          Length = 457

 Score = 33.9 bits (76), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 25/117 (21%), Positives = 55/117 (47%), Gaps = 17/117 (14%)

Query: 75  ALKSLIEKNPEMYTTV---NDLLEFAPLKE-IRTPDVISVVTFDNEKDEKVNCHSGGPPP 130
           AL+ ++  + ++Y      N+ +   P+ E I+  DV+  + +D   +E++N        
Sbjct: 42  ALRRVVNSHFQLYCNAYKSNNEVVVNPIGEPIKFDDVVDYMDWDTYGEEEINS------- 94

Query: 131 YLIRHILKNDVFQPGSNKPLWNLYLIDES-QLVFHCQDILFDIFSAANFHKLFLKEL 186
                + +   F+ G +KPLW + ++ ++ +++F    + FD  +   F    LK L
Sbjct: 95  -----VFRKYNFEYGVDKPLWKVIVVPKANKMIFATDHLFFDGIATVLFWTELLKSL 146

>KAFR0D01420 Chr4 (284515..285993) [1479 bp, 492 aa] {ON} Anc_3.511
           YGL202W
          Length = 492

 Score = 31.6 bits (70), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 33/114 (28%), Positives = 49/114 (42%), Gaps = 14/114 (12%)

Query: 410 LLEIQFQQIATYVTESIEQRMSTWKKYGYNDNDMK-RMKFT-KYDE------KFAPNTRL 461
           L E+  Q  A +    +   +S W ++GY D  +  R ++T K D       K+ P T  
Sbjct: 323 LYEMSMQAAAGFTQSIVSATLSKWGQHGYLDWLLGLRHEYTLKRDNAIDACYKYIPQTDA 382

Query: 462 IKIN-DVSEVSFDDNDIRFPHIKSPGFTTSLSQNTLMSLSYTH--CEEDGLNIC 512
             IN  V+ + F    I F   K P FTT    + L+  SY +    E G+ I 
Sbjct: 383 FHINPPVAGMFF---TITFDGAKHPEFTTKFKSDPLLLESYLYEKAVESGVIIA 433

>Kpol_1010.49 s1010 (113037..114482) [1446 bp, 481 aa] {ON}
           (113037..114482) [1446 nt, 482 aa]
          Length = 481

 Score = 31.6 bits (70), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 16/58 (27%), Positives = 32/58 (55%), Gaps = 1/58 (1%)

Query: 133 IRHILKNDVFQPGSNKPLWNLYLID-ESQLVFHCQDILFDIFSAANFHKLFLKELIAV 189
           I  I +   F+  ++KP+W + +++ ++QL+     +LFD  S  NF   F+  L ++
Sbjct: 97  INSIFQEYSFEYFTDKPVWKILVLENQNQLLMLLDHVLFDGMSGINFWNSFISSLPSI 154

>NCAS0E02510 Chr5 (498000..499367) [1368 bp, 455 aa] {ON} Anc_7.407
           YBL082C
          Length = 455

 Score = 31.6 bits (70), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 20/39 (51%)

Query: 214 YSVPKSIYDNLKLHLPATRPELLNLQTQSFFKSIFCNAV 252
           YSV  S+  N  L+ PA    L  L     FK++FC A+
Sbjct: 218 YSVAVSVKMNALLYFPAVMISLYLLNEGQLFKTVFCGAI 256

>Skud_7.548 Chr7 (891732..893159) [1428 bp, 475 aa] {ON} YGR212W
           (REAL)
          Length = 475

 Score = 31.2 bits (69), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 16/55 (29%), Positives = 29/55 (52%), Gaps = 1/55 (1%)

Query: 133 IRHILKNDVFQPGSNKPLWNLYLI-DESQLVFHCQDILFDIFSAANFHKLFLKEL 186
           I HI +   F    +KPLW + +I  ++Q++     +L D  SA +  + F++ L
Sbjct: 103 INHIFQEHNFPYSEHKPLWKILIIPSQNQMLLMTDHVLMDGMSAVHVWETFMEGL 157

>Smik_16.94 Chr16 complement(178129..179529) [1401 bp, 466 aa] {ON}
           YGR212W (REAL)
          Length = 466

 Score = 31.2 bits (69), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 17/55 (30%), Positives = 31/55 (56%), Gaps = 1/55 (1%)

Query: 133 IRHILKNDVFQPGSNKPLWNLYLI-DESQLVFHCQDILFDIFSAANFHKLFLKEL 186
           I +I +N  F    +KPLW L +I +++Q++     +L D  SA +  + F++ L
Sbjct: 95  INYIFQNYNFSYSEHKPLWKLLIIPNQNQMLLLTDHVLMDGISAVHVWETFMEGL 149

>YGR212W Chr7 (917040..918446) [1407 bp, 468 aa] {ON}
           SLI1N-acetyltransferase, confers resistance to the
           sphingolipid biosynthesis inhibitor myriocin (ISP-1) by
           converting it into N-acetyl-myriocin, co-operates with
           Ypk1p in mediating resistance to myriocin
          Length = 468

 Score = 30.8 bits (68), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 16/55 (29%), Positives = 30/55 (54%), Gaps = 1/55 (1%)

Query: 133 IRHILKNDVFQPGSNKPLWNLYLI-DESQLVFHCQDILFDIFSAANFHKLFLKEL 186
           I HI +   F    NKPLW + ++ +++Q++     +L D  SA +  + F++ L
Sbjct: 95  INHIFQRYNFSYNENKPLWKILILPNQNQMLLLTDHVLMDGMSAIHVWETFMEGL 149

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.135    0.398 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 61,317,264
Number of extensions: 2882690
Number of successful extensions: 9043
Number of sequences better than 10.0: 55
Number of HSP's gapped: 9234
Number of HSP's successfully gapped: 60
Length of query: 535
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 421
Effective length of database: 40,409,475
Effective search space: 17012388975
Effective search space used: 17012388975
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 68 (30.8 bits)