Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
CAGL0A01067g6.10ON64159327350.0
NCAS0D021906.10ON64559720020.0
Kpol_1045.776.10ON65060619990.0
ZYRO0F00484g6.10ON64359719760.0
TPHA0M002006.10ON63459419670.0
TBLA0G011106.10ON63859819620.0
SAKL0E00880g6.10ON63659619600.0
TDEL0G046106.10ON63359319180.0
Kwal_56.223506.10ON65859319150.0
ACR016W6.10ON64059818880.0
KAFR0B065006.10ON63659518810.0
KLLA0D00836g6.10ON64059718280.0
NDAI0I027506.10ON66361118100.0
KNAG0E027806.10ON65060216640.0
KLTH0C11528g6.10ON64245615560.0
Suva_16.426.10ON65460914210.0
YPL263C (KEL3)6.10ON65160614130.0
Skud_16.146.10ON65260714120.0
Smik_6.4716.10ON65160613810.0
Kpol_1050.695.88ON10842041592e-10
ZYRO0B08228g5.88ON12932041371e-07
TDEL0G011205.88ON10092041342e-07
SAKL0H02618g5.88ON10852041342e-07
Skud_8.2225.88ON11692131315e-07
Suva_15.3575.88ON11722131306e-07
KAFR0B043205.88ON9862171307e-07
Smik_8.2425.88ON11682131299e-07
NDAI0D026005.88ON11672221281e-06
NCAS0F005205.88ON10862061271e-06
YHR158C (KEL1)5.88ON11642131262e-06
CAGL0I02090g5.88ON11362091235e-06
KLLA0E15511g5.88ON9052041191e-05
KNAG0K005605.88ON11042041182e-05
KLTH0C01474g5.88ON10562041172e-05
CAGL0F07997g5.88ON9362141129e-05
Kwal_14.10195.88ON9782051101e-04
TPHA0A051705.88ON10161981083e-04
Ecym_20615.88ON13622051083e-04
ADL149W5.88ON12112041073e-04
Kpol_1010.625.88ON9732081056e-04
TBLA0C065305.88ON11721771056e-04
TPHA0H010805.88ON8281761010.002
YGR238C (KEL2)5.88ON882205990.003
Skud_7.5725.88ON883204940.013
Suva_7.5305.88ON894110930.016
Smik_16.685.88ON894205930.017
AGL293C7.413ON98483781.0
TBLA0A043207.9ON83876771.1
Smik_19.4singletonON22172751.1
Kwal_55.207568.157ON157551752.1
SAKL0B10362g7.64ON124477752.1
KAFR0C049107.9ON87881724.3
ZYRO0C00550g7.9ON84871709.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0A01067g
         (641 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0A01067g Chr1 (106866..108791) [1926 bp, 641 aa] {ON} simila...  1058   0.0  
NCAS0D02190 Chr4 complement(408069..410006) [1938 bp, 645 aa] {O...   775   0.0  
Kpol_1045.77 s1045 (180708..182660) [1953 bp, 650 aa] {ON} (1807...   774   0.0  
ZYRO0F00484g Chr6 complement(47424..49355) [1932 bp, 643 aa] {ON...   765   0.0  
TPHA0M00200 Chr13 complement(40103..42007) [1905 bp, 634 aa] {ON...   762   0.0  
TBLA0G01110 Chr7 complement(283630..285546) [1917 bp, 638 aa] {O...   760   0.0  
SAKL0E00880g Chr5 complement(66646..68556) [1911 bp, 636 aa] {ON...   759   0.0  
TDEL0G04610 Chr7 (840098..841999) [1902 bp, 633 aa] {ON} Anc_6.1...   743   0.0  
Kwal_56.22350 s56 complement(60828..62804) [1977 bp, 658 aa] {ON...   742   0.0  
ACR016W Chr3 (384967..386889) [1923 bp, 640 aa] {ON} Syntenic ho...   731   0.0  
KAFR0B06500 Chr2 (1347509..1349419) [1911 bp, 636 aa] {ON} Anc_6...   729   0.0  
KLLA0D00836g Chr4 complement(78202..80124) [1923 bp, 640 aa] {ON...   708   0.0  
NDAI0I02750 Chr9 complement(644137..646128) [1992 bp, 663 aa] {O...   701   0.0  
KNAG0E02780 Chr5 complement(559180..561132) [1953 bp, 650 aa] {O...   645   0.0  
KLTH0C11528g Chr3 (946632..948560) [1929 bp, 642 aa] {ON} simila...   603   0.0  
Suva_16.42 Chr16 complement(60142..62106) [1965 bp, 654 aa] {ON}...   551   0.0  
YPL263C Chr16 complement(44551..46506) [1956 bp, 651 aa] {ON}  K...   548   0.0  
Skud_16.14 Chr16 complement(23637..25595) [1959 bp, 652 aa] {ON}...   548   0.0  
Smik_6.471 Chr6 (774663..776618) [1956 bp, 651 aa] {ON} YPL263C ...   536   0.0  
Kpol_1050.69 s1050 complement(150301..153555) [3255 bp, 1084 aa]...    66   2e-10
ZYRO0B08228g Chr2 (641988..645869) [3882 bp, 1293 aa] {ON} simil...    57   1e-07
TDEL0G01120 Chr7 (229805..232834) [3030 bp, 1009 aa] {ON} Anc_5....    56   2e-07
SAKL0H02618g Chr8 (259684..262941) [3258 bp, 1085 aa] {ON} simil...    56   2e-07
Skud_8.222 Chr8 complement(385114..388623) [3510 bp, 1169 aa] {O...    55   5e-07
Suva_15.357 Chr15 complement(617637..618952,619001..621203) [351...    55   6e-07
KAFR0B04320 Chr2 complement(893930..896890) [2961 bp, 986 aa] {O...    55   7e-07
Smik_8.242 Chr8 complement(390631..394137) [3507 bp, 1168 aa] {O...    54   9e-07
NDAI0D02600 Chr4 complement(600880..604383) [3504 bp, 1167 aa] {...    54   1e-06
NCAS0F00520 Chr6 (100048..103308) [3261 bp, 1086 aa] {ON} Anc_5....    54   1e-06
YHR158C Chr8 complement(413685..417179) [3495 bp, 1164 aa] {ON} ...    53   2e-06
CAGL0I02090g Chr9 complement(177324..180734) [3411 bp, 1136 aa] ...    52   5e-06
KLLA0E15511g Chr5 (1388626..1391343) [2718 bp, 905 aa] {ON} simi...    50   1e-05
KNAG0K00560 Chr11 complement(96678..99992) [3315 bp, 1104 aa] {O...    50   2e-05
KLTH0C01474g Chr3 (131243..134413) [3171 bp, 1056 aa] {ON} simil...    50   2e-05
CAGL0F07997g Chr6 complement(785803..788613) [2811 bp, 936 aa] {...    48   9e-05
Kwal_14.1019 s14 (159934..162870) [2937 bp, 978 aa] {ON} YHR158C...    47   1e-04
TPHA0A05170 Chr1 complement(1161610..1164660) [3051 bp, 1016 aa]...    46   3e-04
Ecym_2061 Chr2 (99788..103876) [4089 bp, 1362 aa] {ON} similar t...    46   3e-04
ADL149W Chr4 (427096..430731) [3636 bp, 1211 aa] {ON} Syntenic h...    46   3e-04
Kpol_1010.62 s1010 complement(151895..154816) [2922 bp, 973 aa] ...    45   6e-04
TBLA0C06530 Chr3 complement(1577728..1581246) [3519 bp, 1172 aa]...    45   6e-04
TPHA0H01080 Chr8 complement(232804..235290) [2487 bp, 828 aa] {O...    44   0.002
YGR238C Chr7 complement(966039..968687) [2649 bp, 882 aa] {ON}  ...    43   0.003
Skud_7.572 Chr7 complement(940820..943471) [2652 bp, 883 aa] {ON...    41   0.013
Suva_7.530 Chr7 complement(920446..923130) [2685 bp, 894 aa] {ON...    40   0.016
Smik_16.68 Chr16 (128068..130752) [2685 bp, 894 aa] {ON} YGR238C...    40   0.017
AGL293C Chr7 complement(156902..159856) [2955 bp, 984 aa] {ON} S...    35   1.0  
TBLA0A04320 Chr1 (1068199..1070715) [2517 bp, 838 aa] {ON} Anc_7...    34   1.1  
Smik_19.4 Chr19 complement(4397..5062) [666 bp, 221 aa] {ON} YNL...    33   1.1  
Kwal_55.20756 s55 (545793..550520) [4728 bp, 1575 aa] {ON} YGL19...    33   2.1  
SAKL0B10362g Chr2 complement(891438..895172) [3735 bp, 1244 aa] ...    33   2.1  
KAFR0C04910 Chr3 (975629..978265) [2637 bp, 878 aa] {ON} Anc_7.9...    32   4.3  
ZYRO0C00550g Chr3 (39312..41858) [2547 bp, 848 aa] {ON} similar ...    32   9.0  

>CAGL0A01067g Chr1 (106866..108791) [1926 bp, 641 aa] {ON} similar
           to uniprot|Q08979 Saccharomyces cerevisiae YPL263c KEL3
          Length = 641

 Score = 1058 bits (2735), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 524/593 (88%), Positives = 524/593 (88%)

Query: 49  VLANFKKEQEQFEKVAVDSVDKVNKRLNPCMVGNPSASSSKKELIVFGGEFTNPQTSTTT 108
           VLANFKKEQEQFEKVAVDSVDKVNKRLNPCMVGNPSASSSKKELIVFGGEFTNPQTSTTT
Sbjct: 49  VLANFKKEQEQFEKVAVDSVDKVNKRLNPCMVGNPSASSSKKELIVFGGEFTNPQTSTTT 108

Query: 109 FYNDLHTFTPENNQWKRYTSQNXXXXXXXXXXXXXXXGIALLHGGEFSSPKQNTFYHYSD 168
           FYNDLHTFTPENNQWKRYTSQN               GIALLHGGEFSSPKQNTFYHYSD
Sbjct: 109 FYNDLHTFTPENNQWKRYTSQNAPMPRSSAAMAAHPSGIALLHGGEFSSPKQNTFYHYSD 168

Query: 169 TWILDCNTKEWAKVDAKVGPSARSGHRITVWKNFFILHGGFRDLGTSTTYLSDCWLFDIT 228
           TWILDCNTKEWAKVDAKVGPSARSGHRITVWKNFFILHGGFRDLGTSTTYLSDCWLFDIT
Sbjct: 169 TWILDCNTKEWAKVDAKVGPSARSGHRITVWKNFFILHGGFRDLGTSTTYLSDCWLFDIT 228

Query: 229 TYKWKQVEFPSNHQVPDARSGHSFIPTAEGAILWGGYCKVKANKKGYQKGKILSDCWYLK 288
           TYKWKQVEFPSNHQVPDARSGHSFIPTAEGAILWGGYCKVKANKKGYQKGKILSDCWYLK
Sbjct: 229 TYKWKQVEFPSNHQVPDARSGHSFIPTAEGAILWGGYCKVKANKKGYQKGKILSDCWYLK 288

Query: 289 MKSDISGIRWERRRKQGFQPSPRVGCSMAYHKGRGILFGGVYDFEETEESLESNFFNDLF 348
           MKSDISGIRWERRRKQGFQPSPRVGCSMAYHKGRGILFGGVYDFEETEESLESNFFNDLF
Sbjct: 289 MKSDISGIRWERRRKQGFQPSPRVGCSMAYHKGRGILFGGVYDFEETEESLESNFFNDLF 348

Query: 349 SYHIESNRWYSLSIRSRKSNNNAVAKKSGKNSKEQEKELKMLLDSILEKANLQDKSXXXX 408
           SYHIESNRWYSLSIRSRKSNNNAVAKKSGKNSKEQEKELKMLLDSILEKANLQDKS    
Sbjct: 349 SYHIESNRWYSLSIRSRKSNNNAVAKKSGKNSKEQEKELKMLLDSILEKANLQDKSDDDE 408

Query: 409 XXXXINTALAKVDLEDEEEEQLAVQHTILTQLPHPRFNATTTVIDDTLFIFGGIWELGDK 468
               INTALAKVDLEDEEEEQLAVQHTILTQLPHPRFNATTTVIDDTLFIFGGIWELGDK
Sbjct: 409 DDEEINTALAKVDLEDEEEEQLAVQHTILTQLPHPRFNATTTVIDDTLFIFGGIWELGDK 468

Query: 469 EFMIDSLYSIDLNKLDGVTMYWEDLKEIERAKELGVXXXXXXXXXXXXXXXXXXXXXXXX 528
           EFMIDSLYSIDLNKLDGVTMYWEDLKEIERAKELGV                        
Sbjct: 469 EFMIDSLYSIDLNKLDGVTMYWEDLKEIERAKELGVEDSDFEDDDEDDDDEDDDEEDDNE 528

Query: 529 XXXXXXXXXXXXXXXXXXXXXXYPDPRPWLPHPKPFETLRAFYIREGAAFLEWAISNNKN 588
                                 YPDPRPWLPHPKPFETLRAFYIREGAAFLEWAISNNKN
Sbjct: 529 KDEGDDEESEEEEEEEIEEELEYPDPRPWLPHPKPFETLRAFYIREGAAFLEWAISNNKN 588

Query: 589 AKGKHLKKHSFDLCQERWWERRDQLRIEEDKLEEIGGVGDIIERDKSASSKRR 641
           AKGKHLKKHSFDLCQERWWERRDQLRIEEDKLEEIGGVGDIIERDKSASSKRR
Sbjct: 589 AKGKHLKKHSFDLCQERWWERRDQLRIEEDKLEEIGGVGDIIERDKSASSKRR 641

>NCAS0D02190 Chr4 complement(408069..410006) [1938 bp, 645 aa] {ON}
           Anc_6.10
          Length = 645

 Score =  775 bits (2002), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 376/597 (62%), Positives = 446/597 (74%), Gaps = 7/597 (1%)

Query: 49  VLANFKKEQEQFEKVAVDSVDKVNKRLNPCMVGNPSASSSKKELIVFGGEFTNPQTSTTT 108
           VLANFK +QEQFE V V+S+ K  +RLN CM+  P+   SKKEL++FGGEFTNP+TS T 
Sbjct: 52  VLANFKLQQEQFEHVNVESISKPAQRLNSCMITTPN--HSKKELLIFGGEFTNPETSMTH 109

Query: 109 FYNDLHTFTPENNQWKRYTSQNXXXXXXXXXXXXXXXGIALLHGGEFSSPKQNTFYHYSD 168
           FYN+L T++P+N QW++ TSQN               GIALLHGGEFSSPKQNTFYHYSD
Sbjct: 110 FYNELITYSPDNGQWRKITSQNSPMPRSSAAMCAHPSGIALLHGGEFSSPKQNTFYHYSD 169

Query: 169 TWILDCNTKEWAKVDAKVGPSARSGHRITVWKNFFILHGGFRDLGTSTTYLSDCWLFDIT 228
           TW+LD +TKEW K+D+  GP  RSGHRIT+WKN+FIL GGF+DLG ST+Y +DCW FDIT
Sbjct: 170 TWLLDTHTKEWTKMDSAKGPPGRSGHRITIWKNYFILSGGFKDLGHSTSYFNDCWCFDIT 229

Query: 229 TYKWKQVEFPSNHQVPDARSGHSFIPTAEGAILWGGYCKVKANKKGYQKGKILSDCWYLK 288
           TYKWKQ+EFP NH +PDARSGHS+IPT EG ILWGGYCKVKA  KG QKGKIL+DCWYLK
Sbjct: 230 TYKWKQIEFPPNHPIPDARSGHSWIPTEEGCILWGGYCKVKAG-KGLQKGKILNDCWYLK 288

Query: 289 MKSDISGIRWERRRKQGFQPSPRVGCSMAYHKGRGILFGGVYDFEETEESLESNFFNDLF 348
           MKSD+S +RWERR+KQGFQPSPRVGCSMAYHKGRGILFGGVYDFEETEESLES F+NDLF
Sbjct: 289 MKSDLSQVRWERRKKQGFQPSPRVGCSMAYHKGRGILFGGVYDFEETEESLESIFYNDLF 348

Query: 349 SYHIESNRWYSLSIRSRKSNNNAVAKKSGKNSKEQEKELKMLLDSILEKANLQDKSXX-- 406
           SY++ESNRW+SLS+R  +         + K+SKE+EKEL+ LL+ ILEK NL+D      
Sbjct: 349 SYNVESNRWFSLSLRKAQKFKKVAKSSNNKSSKEKEKELQDLLNQILEKNNLKDDDDDDE 408

Query: 407 -XXXXXXINTALAKVDLEDEEEEQLAVQHTILTQLPHPRFNATTTVIDDTLFIFGGIWEL 465
                       A  D ED +E   + Q T+++QLPHPRFNA TTV+DD+LFI+GGIWE+
Sbjct: 409 ISTGTETETETAANSDDEDNKEHSKSAQVTVMSQLPHPRFNAATTVVDDSLFIYGGIWEM 468

Query: 466 GDKEFMIDSLYSIDLNKLDGVTMYWEDLKEIERAKELGVXXXXXXXXXXXXXXXXXXXXX 525
           G+K++ IDSLYSIDLNKLDGV+ YWEDL+EIE+AKE+G                      
Sbjct: 469 GEKDYAIDSLYSIDLNKLDGVSCYWEDLQEIEKAKEIGEQDSDEDEEEEDDEEDDDEEEI 528

Query: 526 XXXXXXXXXXXXXXXXXXXXXXXXXYPDPRPWLPHPKPFETLRAFYIREGAAFLEWAISN 585
                                     PD RPWLPHPKPFE+LRAFYIREGAAFLEWAISN
Sbjct: 529 EDKKLVAEEDDEEEEEEEEEFEEMEIPDLRPWLPHPKPFESLRAFYIREGAAFLEWAISN 588

Query: 586 NKNAKGKHLKKHSFDLCQERWWERRDQLRIEEDKLEEIGGVGDIIERDKSA-SSKRR 641
           NK+ +GKHLKK SFDLC++RWWERRDQ+RIEEDKLEE+G VG++IE+D S  +SKRR
Sbjct: 589 NKHVRGKHLKKKSFDLCEDRWWERRDQVRIEEDKLEELGVVGNVIEKDTSVPTSKRR 645

>Kpol_1045.77 s1045 (180708..182660) [1953 bp, 650 aa] {ON}
           (180710..182662) [1953 nt, 651 aa]
          Length = 650

 Score =  774 bits (1999), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 371/606 (61%), Positives = 454/606 (74%), Gaps = 19/606 (3%)

Query: 49  VLANFKKEQEQFEKVAVDSVDKVNKRLNPCMVGNPSASSSKKELIVFGGEFTNPQTSTTT 108
           VLANFKKEQE FE++ ++SV++ ++R+NPCM+ NP+    K ELI+FGGE TN  TSTT 
Sbjct: 51  VLANFKKEQELFEQINIESVERPSRRINPCMIENPN--HGKSELILFGGESTNKDTSTTQ 108

Query: 109 FYNDLHTFTPENNQWKRYTSQNXXXXXXXXXXXXXXXGIALLHGGEFSSPKQNTFYHYSD 168
           F+NDL+++TPEN+QW+RYTS+N               G+AL+HGGEFSSPKQNTFYHYSD
Sbjct: 109 FFNDLYSYTPENDQWRRYTSKNSPMPRSSAAMAAHPSGVALIHGGEFSSPKQNTFYHYSD 168

Query: 169 TWILDCNTKEWAKVDAKVGPSARSGHRITVWKNFFILHGGFRDLGTSTTYLSDCWLFDIT 228
           TW+LDC+TKEW KV+ K GPSARSGHRI++WKN+F+LHGGFRDLGTSTTYL+DCWLFDIT
Sbjct: 169 TWLLDCSTKEWTKVEQKNGPSARSGHRISIWKNYFMLHGGFRDLGTSTTYLNDCWLFDIT 228

Query: 229 TYKWKQVEFPSNHQVPDARSGHSFIPTAEGAILWGGYCKVKANKKGYQKGKILSDCWYLK 288
            YKWKQ+EFP NH +PDARSGHSFIPT EGA+LWGGYCKVKA  KG QKGKIL+DCWYLK
Sbjct: 229 NYKWKQIEFPPNHPIPDARSGHSFIPTQEGAVLWGGYCKVKAG-KGLQKGKILTDCWYLK 287

Query: 289 MKSDISGIRWERRRKQGFQPSPRVGCSMAYHKGRGILFGGVYDFEETEESLESNFFNDLF 348
           MK+D + IRWERR+KQGFQPSPRVGCSM +HKGRGILFGGVYDFEETEESL+S F+NDLF
Sbjct: 288 MKADPTAIRWERRKKQGFQPSPRVGCSMVHHKGRGILFGGVYDFEETEESLDSMFYNDLF 347

Query: 349 SYHIESNRWYSLSIRSRKSNNNAVAKKSGKNSKEQEKELKMLLDSILEKANLQ---DKSX 405
           SY IE NRW++L +R ++     V + + K+SK++EKEL+ LL+ ILEKANL    DK  
Sbjct: 348 SYQIEINRWFALQLRPQRKK---VVRLNNKSSKDKEKELQDLLNQILEKANLNDKDDKDQ 404

Query: 406 XXXXXXXINTALAKV-------DLEDEEEEQLAVQHTILTQLPHPRFNATTTVIDDTLFI 458
                  I T L +        D +D E+ +   ++ +LTQLPHPRFNAT TV++DTLFI
Sbjct: 405 EDEDAKAIETELDRADHDTSDSDADDVEDAKEKKEYKVLTQLPHPRFNATMTVVNDTLFI 464

Query: 459 FGGIWELGDKEFMIDSLYSIDLNKLDGVTMYWEDLKEIERAKELGVXXXXXXXXXXXXXX 518
           +GG+WELG+K++ IDS YSIDLN+ DGVT+ WEDL EIE AKE G+              
Sbjct: 465 YGGVWELGEKDYTIDSFYSIDLNRTDGVTVLWEDLSEIEAAKEAGIVDSDEEDDEFGDSD 524

Query: 519 XXXXXX---XXXXXXXXXXXXXXXXXXXXXXXXXXYPDPRPWLPHPKPFETLRAFYIREG 575
                                               PDP PWLPHPKPFE+LR FY+R G
Sbjct: 525 DEDDGEEEIMDQKLVAEEEEEEEEEEEEEQVDEMEIPDPCPWLPHPKPFESLRVFYVRTG 584

Query: 576 AAFLEWAISNNKNAKGKHLKKHSFDLCQERWWERRDQLRIEEDKLEEIGGVGDIIERDKS 635
           A FLEWAISNN++A+GKHLKK SFDLCQ+RWW+RRDQ+RIEEDK+EE+GG+G++IE+D S
Sbjct: 585 ATFLEWAISNNRDARGKHLKKKSFDLCQDRWWQRRDQVRIEEDKMEELGGIGEVIEKDTS 644

Query: 636 ASSKRR 641
            S+KRR
Sbjct: 645 KSTKRR 650

>ZYRO0F00484g Chr6 complement(47424..49355) [1932 bp, 643 aa] {ON}
           similar to uniprot|Q08979 Saccharomyces cerevisiae
           YPL263C KEL3 Cytoplasmic protein of unknown function
          Length = 643

 Score =  765 bits (1976), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 369/597 (61%), Positives = 444/597 (74%), Gaps = 10/597 (1%)

Query: 49  VLANFKKEQEQFEKVAVDSVDKVNKRLNPCMVGNPSASSSKKELIVFGGEFTNPQTSTTT 108
           VLA+FKKEQEQFEKV V+SVDK + R+NPC+V NP+    KKELI+FGGE+TN   STT 
Sbjct: 53  VLASFKKEQEQFEKVVVESVDKPSARINPCLVSNPA--HGKKELILFGGEYTNQSNSTTH 110

Query: 109 FYNDLHTFTPENNQWKRYTSQNXXXXXXXXXXXXXXXGIALLHGGEFSSPKQNTFYHYSD 168
           FYN+L TFTP+N+QW++ +SQN               GIALLHGGEFSSPKQNTFYHYSD
Sbjct: 111 FYNELFTFTPDNDQWRKISSQNAPMPRSSAAMAAHPSGIALLHGGEFSSPKQNTFYHYSD 170

Query: 169 TWILDCNTKEWAKVDAKVGPSARSGHRITVWKNFFILHGGFRDLGTSTTYLSDCWLFDIT 228
           TW+LDC TKEW K+D K GP++RSGHR+TVWKNFFI++GGFRDLGTSTTYL+DCWLFDIT
Sbjct: 171 TWLLDCTTKEWTKLDQKNGPASRSGHRMTVWKNFFIMYGGFRDLGTSTTYLNDCWLFDIT 230

Query: 229 TYKWKQVEFPSNHQVPDARSGHSFIPTAEGAILWGGYCKVKANKKGYQKGKILSDCWYLK 288
           T+KW QVEFP NH +PDARSGHSFIP  EGAILWGGYCKVKA  KG QKGKIL+DCWYLK
Sbjct: 231 THKWTQVEFPRNHLIPDARSGHSFIPDQEGAILWGGYCKVKAG-KGLQKGKILTDCWYLK 289

Query: 289 MKSDISGIRWERRRKQGFQPSPRVGCSMAYHKGRGILFGGVYDFEETEESLESNFFNDLF 348
           M S  S IRWERR+KQGFQPSPRVGCSM  HKGRG+LFGGVYDFEETEESL+SNF+NDLF
Sbjct: 290 MNSTPSAIRWERRKKQGFQPSPRVGCSMVPHKGRGVLFGGVYDFEETEESLDSNFYNDLF 349

Query: 349 SYHIESNRWYSLSIRSRKSNNNAVAKKSGKNSKEQEKELKMLLDSILEKANLQDKSXXXX 408
           ++ I++NRWYSLS+R ++     ++K S   +K+QEKEL+  L+ IL++A L D+     
Sbjct: 350 TFQIKTNRWYSLSLRPQRKKQVKISKSS---TKDQEKELQDHLNRILQQAQLYDQDEDKE 406

Query: 409 XXXXINTALAKVDL--EDEEEEQLAVQHTILTQLPHPRFNATTTVIDDTLFIFGGIWELG 466
               I       +   +++EEE    QHTI TQLPHPRFN +  V++DTLFI+GG+WELG
Sbjct: 407 DDKAIREQFEDENQSGDEDEEESTKKQHTISTQLPHPRFNTSLAVVNDTLFIYGGLWELG 466

Query: 467 DKEFMIDSLYSIDLNKLDGVTMYWEDLKEIERAKELGVXXXXXXXXXXXXXXXXXXXXXX 526
           DK++ IDS Y IDLNK+DGVT+YWE+L EIE+AK+L                        
Sbjct: 467 DKDYNIDSFYGIDLNKVDGVTVYWENLAEIEKAKKLAEQGSDEDEDDEDEEDEDEDDDEE 526

Query: 527 XXXXXX--XXXXXXXXXXXXXXXXXXYPDPRPWLPHPKPFETLRAFYIREGAAFLEWAIS 584
                                      PDPRPWLPHPK FE+LRAFY+R G  FLEWAIS
Sbjct: 527 EVRDQVLVAEEEDAEEDEEVEEEEMEIPDPRPWLPHPKAFESLRAFYVRAGPQFLEWAIS 586

Query: 585 NNKNAKGKHLKKHSFDLCQERWWERRDQLRIEEDKLEEIGGVGDIIERDKSASSKRR 641
           NN++A+GKHLK+ SFDLCQ+RWWERRDQ+RIEEDK+EE+GGVGDI+ER+ +  +KRR
Sbjct: 587 NNRDARGKHLKQKSFDLCQDRWWERRDQVRIEEDKMEELGGVGDIVERNPAQKTKRR 643

>TPHA0M00200 Chr13 complement(40103..42007) [1905 bp, 634 aa] {ON}
           Anc_6.10 YPL263C
          Length = 634

 Score =  762 bits (1967), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 370/594 (62%), Positives = 449/594 (75%), Gaps = 12/594 (2%)

Query: 49  VLANFKKEQEQFEKVAVDSVDKVNKRLNPCMVGNPSASSSKKELIVFGGEFTNPQTSTTT 108
           VLANFKKEQEQFE++ V+SVDK  +R+N CM+ NP+    KKEL++FGGE T+ +   T 
Sbjct: 52  VLANFKKEQEQFEQINVESVDKPTRRINSCMIANPN--HGKKELLLFGGENTSQEQGVTH 109

Query: 109 FYNDLHTFTPENNQWKRYTSQNXXXXXXXXXXXXXXXGIALLHGGEFSSPKQNTFYHYSD 168
           FYNDL+TFTP+N+ WK+ TSQN               GIALLHGGEFSSPKQNTFYHYSD
Sbjct: 110 FYNDLYTFTPDNDLWKKITSQNSPMPRSSAAMAAHPSGIALLHGGEFSSPKQNTFYHYSD 169

Query: 169 TWILDCNTKEWAKVDAKVGPSARSGHRITVWKNFFILHGGFRDLGTSTTYLSDCWLFDIT 228
           TW+LDC T+EW KV+ K GPSARSGHRITVWKN+FILHGGFRDLG++T+YL+D WLFDIT
Sbjct: 170 TWLLDCTTREWTKVEQKNGPSARSGHRITVWKNYFILHGGFRDLGSTTSYLNDSWLFDIT 229

Query: 229 TYKWKQVEFPSNHQVPDARSGHSFIPTAEGAILWGGYCKVKANKKGYQKGKILSDCWYLK 288
           +YKW+Q+EFP NH VPDARSGHS IPT EGA+LWGGYCKVKA  KG QKGKIL DCWYLK
Sbjct: 230 SYKWRQIEFPPNHPVPDARSGHSLIPTQEGAVLWGGYCKVKAG-KGLQKGKILGDCWYLK 288

Query: 289 MKSDISGIRWERRRKQGFQPSPRVGCSMAYHKGRGILFGGVYDFEETEESLESNFFNDLF 348
           MK+D S +RWERR+KQGFQPSPRVGCSM +HKGRGILFGGVYDFEETEESL+S F+NDLF
Sbjct: 289 MKADPSAVRWERRKKQGFQPSPRVGCSMVHHKGRGILFGGVYDFEETEESLDSIFYNDLF 348

Query: 349 SYHIESNRWYSLSIRSRKSNNNAVAKKSGKNSKEQEKELKMLLDSILEKANLQDKSXXXX 408
           SY IESNRWY+L +RS++     V + + K+SKE+E EL+ +L+ ILEKANL+D      
Sbjct: 349 SYQIESNRWYALQLRSQRKK---VVRLNNKSSKEKELELQNILNEILEKANLKDDD---E 402

Query: 409 XXXXINTALAKVDLEDEEEEQLAVQHTIL-TQLPHPRFNATTTVIDDTLFIFGGIWELGD 467
               ++  L      D+E E+++ +  I+  QLPH RFNA+TTV+DDTLFI+GG+WELG+
Sbjct: 403 DANELSNGLGSDSDSDDESEKVSKKEYIVRNQLPHHRFNASTTVVDDTLFIYGGVWELGE 462

Query: 468 KEFMIDSLYSIDLNKLDGVTMYWEDLKEIERAKELGVXXXXXXXXXXXXXXXXXXXXXXX 527
           K++ IDS+YSIDLNKLDGVT+YWE+L +IE+AKELG                        
Sbjct: 463 KDYSIDSMYSIDLNKLDGVTVYWENLHDIEKAKELGA--INSDEEDEEDEDDEDDDEEET 520

Query: 528 XXXXXXXXXXXXXXXXXXXXXXXYPDPRPWLPHPKPFETLRAFYIREGAAFLEWAISNNK 587
                                   PDPRPWLPHPK FE+LR FY+R GA+FLEWAISNNK
Sbjct: 521 VDQKLVAEEEEEEEEIEDADDMEIPDPRPWLPHPKAFESLRNFYVRTGASFLEWAISNNK 580

Query: 588 NAKGKHLKKHSFDLCQERWWERRDQLRIEEDKLEEIGGVGDIIERDKSASSKRR 641
           + +GKHLK  SF+LCQ+RWWERRDQ+RIEEDKLEE+GGVG++IE+D + S+KRR
Sbjct: 581 HTRGKHLKTKSFELCQDRWWERRDQVRIEEDKLEELGGVGEVIEKDTTKSTKRR 634

>TBLA0G01110 Chr7 complement(283630..285546) [1917 bp, 638 aa] {ON}
           Anc_6.10 YPL263C
          Length = 638

 Score =  760 bits (1962), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 370/598 (61%), Positives = 441/598 (73%), Gaps = 16/598 (2%)

Query: 49  VLANFKKEQEQFEKVAVDSVDKVNKRLNPCMVGNPSASSSKKELIVFGGEFTNPQTSTTT 108
           +L NFKK+QEQFEK+ +++V K  KR+N CM+ NP     K ELI+FGGE T   ++TTT
Sbjct: 52  ILENFKKQQEQFEKINIETVSKPTKRINSCMISNPI--HGKNELILFGGENT---STTTT 106

Query: 109 FYNDLHTFTPENNQWKRYTSQNXXXXXXXXXXXXXXXGIALLHGGEFSSPKQNTFYHYSD 168
           FYNDL T+ PEN+QWK+YTSQN               GIALLHGGEFSSPKQNTFYHYSD
Sbjct: 107 FYNDLFTYNPENDQWKKYTSQNSPMPRSSSAMISHPTGIALLHGGEFSSPKQNTFYHYSD 166

Query: 169 TWILDCNTKEWAKVDAKVGPSARSGHRITVWKNFFILHGGFRDLGTSTTYLSDCWLFDIT 228
           TW+LDC TKEW+KV+ K GPSARSGHR+TVWKNF ILHGGFRDLGTSTTYL D WLFD+T
Sbjct: 167 TWLLDCATKEWSKVENKNGPSARSGHRMTVWKNFIILHGGFRDLGTSTTYLKDLWLFDVT 226

Query: 229 TYKWKQVEFPSNHQVPDARSGHSFIPTAEGAILWGGYCKVKANKKGYQKGKILSDCWYLK 288
            YKW QVEFP NH +PDARSGHS IPT +GA+LWGGYCKVKA  KG QKGKILSDCWYLK
Sbjct: 227 KYKWTQVEFPPNHAIPDARSGHSLIPTQDGALLWGGYCKVKAG-KGLQKGKILSDCWYLK 285

Query: 289 MKSDISGIRWERRRKQGFQPSPRVGCSMAYHKGRGILFGGVYDFEETEESLESNFFNDLF 348
           MKSD+SGIRWERR+KQGFQPSPRVGCSM +HKGRGILFGGV+DFEETEESL+S F+NDLF
Sbjct: 286 MKSDVSGIRWERRKKQGFQPSPRVGCSMVHHKGRGILFGGVFDFEETEESLDSLFYNDLF 345

Query: 349 SYHIESNRWYSLSIRSRKSNNNAVAKKSGKNSKEQEKELKMLLDSILEKANLQDKSXXXX 408
           +Y IE NRW+SLS+RS++     +  K+   +K++EKEL+ +L+SIL+K NL D      
Sbjct: 346 TYQIEINRWFSLSMRSQRKKTIKIGPKT---TKDKEKELQDILNSILKKNNLTDDD--SE 400

Query: 409 XXXXINTALAKVDLEDEEEE-----QLAVQHTILTQLPHPRFNATTTVIDDTLFIFGGIW 463
               I   L   D E   E+     Q+  Q+ ++ QLPH RFNATT V++DTL+IFGG W
Sbjct: 401 DPNAIEEELKINDDESNSEDESKDGQVTKQYEVMNQLPHVRFNATTAVVNDTLYIFGGSW 460

Query: 464 ELGDKEFMIDSLYSIDLNKLDGVTMYWEDLKEIERAKELGVXXXXXXXXXXXXXXXXXXX 523
           ELG+K++ IDS YSIDLNKLDGVT+YWED++EIE AKELG                    
Sbjct: 461 ELGEKDYSIDSFYSIDLNKLDGVTVYWEDMEEIEAAKELGEQFSDEEDEDDEEEDEDDGE 520

Query: 524 XXXXXXXXXXXXXXXXXXXXXXXXXXXYPDPRPWLPHPKPFETLRAFYIREGAAFLEWAI 583
                                       PDPRPWLPHPKPFETLRAFY+R GA FLEWAI
Sbjct: 521 EEIVDQKLVAEEDEEEEEIEADEDEMEIPDPRPWLPHPKPFETLRAFYVRTGATFLEWAI 580

Query: 584 SNNKNAKGKHLKKHSFDLCQERWWERRDQLRIEEDKLEEIGGVGDIIERDKSASSKRR 641
           SNN+++KGKHLKK SF+L ++RWWERRDQ+RIEEDK+EE+GG+ +I+ERD +  +KRR
Sbjct: 581 SNNRDSKGKHLKKKSFELTEDRWWERRDQVRIEEDKMEELGGIENIVERDTTQVNKRR 638

>SAKL0E00880g Chr5 complement(66646..68556) [1911 bp, 636 aa] {ON}
           similar to uniprot|Q08979 Saccharomyces cerevisiae
           YPL263C KEL3 Cytoplasmic protein of unknown function
          Length = 636

 Score =  759 bits (1960), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 362/596 (60%), Positives = 441/596 (73%), Gaps = 15/596 (2%)

Query: 50  LANFKKEQEQFEKVAVDSVDKVNKRLNPCMVGNPSASSSKKELIVFGGEFTNPQTSTTTF 109
           LANFK+EQE+FE+V V +VD+  +R+N  MV NP     K+EL++FGGE TN   STT F
Sbjct: 52  LANFKREQEKFEEVVVSTVDRPTRRINSSMVANPL--HGKRELLLFGGENTNSTNSTTAF 109

Query: 110 YNDLHTFTPENNQWKRYTSQNXXXXXXXXXXXXXXXGIALLHGGEFSSPKQNTFYHYSDT 169
           YNDL T++ + +QW++ +SQN               G+ L+HGGEFSSPKQNTFYHYSDT
Sbjct: 110 YNDLFTYSLDGDQWRKISSQNSPMPRSSAAIAAHPSGVVLIHGGEFSSPKQNTFYHYSDT 169

Query: 170 WILDCNTKEWAKVDAKVGPSARSGHRITVWKNFFILHGGFRDLGTSTTYLSDCWLFDITT 229
           W+LDCNTKEW K++ K GP+ARSGHR+TVWKN+FILHGGFRDLGT TTYLSDCWLFDITT
Sbjct: 170 WLLDCNTKEWTKIEQKNGPTARSGHRLTVWKNYFILHGGFRDLGTMTTYLSDCWLFDITT 229

Query: 230 YKWKQVEFPSNHQVPDARSGHSFIPTAEGAILWGGYCKVKANKKGYQKGKILSDCWYLKM 289
           YKWKQV+FP NH +PDARSGHS +PT +GA+LWGGYCKVKA  KG QKGKIL+DCWYLKM
Sbjct: 230 YKWKQVDFPPNHPIPDARSGHSLVPTPDGAVLWGGYCKVKAG-KGLQKGKILTDCWYLKM 288

Query: 290 KSDISGIRWERRRKQGFQPSPRVGCSMAYHKGRGILFGGVYDFEETEESLESNFFNDLFS 349
           KSDI  IRWERR+KQGFQPSPRVGCSM +HKGRGILFGGV+DFEETEESLES F+NDLF+
Sbjct: 289 KSDIGAIRWERRKKQGFQPSPRVGCSMVHHKGRGILFGGVFDFEETEESLESMFYNDLFT 348

Query: 350 YHIESNRWYSLSIRSRKSNNNAVAKKSGKNSKEQEKELKMLLDSILEKANLQDKSXXXXX 409
           + IE+NRWYS S+R ++      AK + KN++ ++KEL+ +L+ ILEKANL D       
Sbjct: 349 FQIETNRWYSASLRPQRK----AAKATSKNNRNKDKELEDILNQILEKANLNDDE---NE 401

Query: 410 XXXINTALAKVDLED----EEEEQLAVQHTILTQLPHPRFNATTTVIDDTLFIFGGIWEL 465
              I   L ++D ED    EE      ++ I  QLPHPRFNA+T V+DDTLFIFGG+WE+
Sbjct: 402 KETIGDVLKELDEEDSDSAEELNSEKKEYPIRIQLPHPRFNASTAVVDDTLFIFGGVWEI 461

Query: 466 GDKEFMIDSLYSIDLNKLDGVTMYWEDLKEIERAKELGVXXXXXXXXXXXXXXXXXXXXX 525
           G+K++ IDS Y+IDLN+LDG+ +YWEDL++IE AKELG                      
Sbjct: 462 GEKDYSIDSFYAIDLNRLDGIKIYWEDLRDIEMAKELGD-EEEDFEDNEEDDEEDDDDEE 520

Query: 526 XXXXXXXXXXXXXXXXXXXXXXXXXYPDPRPWLPHPKPFETLRAFYIREGAAFLEWAISN 585
                                     PDPRPWLPHPKPFETLR FY+R GA FLEWAIS+
Sbjct: 521 EITDQKLVAEDDDEEEEEEDEYEPEIPDPRPWLPHPKPFETLRGFYVRTGADFLEWAISS 580

Query: 586 NKNAKGKHLKKHSFDLCQERWWERRDQLRIEEDKLEEIGGVGDIIERDKSASSKRR 641
           N++A+GKHLKK SFDLCQ+RWWERRDQ+RIEEDKLEE+GG+G+++E+D S S KRR
Sbjct: 581 NRDARGKHLKKKSFDLCQDRWWERRDQVRIEEDKLEELGGIGEVVEKDTSKSKKRR 636

>TDEL0G04610 Chr7 (840098..841999) [1902 bp, 633 aa] {ON} Anc_6.10
           YPL263C
          Length = 633

 Score =  743 bits (1918), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 357/593 (60%), Positives = 427/593 (72%), Gaps = 11/593 (1%)

Query: 49  VLANFKKEQEQFEKVAVDSVDKVNKRLNPCMVGNPSASSSKKELIVFGGEFTNPQTSTTT 108
           VLANFKKEQEQFEKV V+++++ ++R+NP M+ NP     K ELI+FGGE T   TSTT 
Sbjct: 52  VLANFKKEQEQFEKVVVENIERPSRRINPSMIANPI--HGKSELIMFGGEHTIQSTSTTH 109

Query: 109 FYNDLHTFTPENNQWKRYTSQNXXXXXXXXXXXXXXXGIALLHGGEFSSPKQNTFYHYSD 168
           F+NDL  F+P+N QWKR +SQN               G+ALLHGGEFSSPKQNTFYHYSD
Sbjct: 110 FFNDLVVFSPDNEQWKRISSQNSPMPRSSAAMVGHPSGVALLHGGEFSSPKQNTFYHYSD 169

Query: 169 TWILDCNTKEWAKVDAKVGPSARSGHRITVWKNFFILHGGFRDLGTSTTYLSDCWLFDIT 228
           TW+LDC TKEW K++ K GPSARSGHR+ VWKNF ILHGGFRDLGTSTTYL+DCWLFDIT
Sbjct: 170 TWLLDCATKEWTKIEQKNGPSARSGHRMAVWKNFIILHGGFRDLGTSTTYLNDCWLFDIT 229

Query: 229 TYKWKQVEFPSNHQVPDARSGHSFIPTAEGAILWGGYCKVKANKKGYQKGKILSDCWYLK 288
           TYKWKQVEFP NH VPDARSGHS I   EGAILWGGYCKVKA  KG QKGKIL+DCWYLK
Sbjct: 230 TYKWKQVEFPQNHPVPDARSGHSLIADQEGAILWGGYCKVKAG-KGLQKGKILTDCWYLK 288

Query: 289 MKSDISGIRWERRRKQGFQPSPRVGCSMAYHKGRGILFGGVYDFEETEESLESNFFNDLF 348
           M S+ S IRW+R+++QGFQPSPRVGCSM  HKGRG+LFGGVYDFEETEESLESNF+ND+F
Sbjct: 289 MSSNTSAIRWDRKKRQGFQPSPRVGCSMVPHKGRGVLFGGVYDFEETEESLESNFYNDVF 348

Query: 349 SYHIESNRWYSLSIRSRKSNNNAVAKKSGKNSKEQEKELKMLLDSILEKANLQDKSXXXX 408
           +Y I  NRWYSLS+R ++       K + +++K+QEKEL+ LL+ IL  A L D+     
Sbjct: 349 TYQINMNRWYSLSLRPQRKKQ---VKLNNRSTKDQEKELEDLLNKILRNAQLDDQGEEEE 405

Query: 409 XXXXINTALAKVDLEDEEEEQLAVQHTILTQLPHPRFNATTTVIDDTLFIFGGIWELGDK 468
                 +    V+ + +E E L  +H I+ +LPHPRFNA T V+DDTLFIFGG+WE G+K
Sbjct: 406 IDAAEES--TAVEEDSDESESLDKEHVIMNELPHPRFNAATAVVDDTLFIFGGVWEFGEK 463

Query: 469 EFMIDSLYSIDLNKLDGVTMYWEDLKEIERAKELGVXXXXXXXXXXXXXXXXXXXXXXXX 528
           ++ IDS Y IDLNK DGVT+YWEDL  +E AK+                           
Sbjct: 464 DYSIDSFYGIDLNKADGVTVYWEDLTALENAKD---EDDSDEDEGEEDDDDEEDSEEEQV 520

Query: 529 XXXXXXXXXXXXXXXXXXXXXXYPDPRPWLPHPKPFETLRAFYIREGAAFLEWAISNNKN 588
                                  PDPRPWLPHPK FE+LR+FY+R GA FLEWAISNN++
Sbjct: 521 DQKLVAEDEDEEEEEFEEEEMEIPDPRPWLPHPKAFESLRSFYVRTGATFLEWAISNNRH 580

Query: 589 AKGKHLKKHSFDLCQERWWERRDQLRIEEDKLEEIGGVGDIIERDKSASSKRR 641
            KGKHLK  SF++C+ RWWERRDQ+R+EEDKLEE+GGVG+IIERD + + KRR
Sbjct: 581 VKGKHLKTKSFEICESRWWERRDQVRLEEDKLEELGGVGEIIERDTTKTKKRR 633

>Kwal_56.22350 s56 complement(60828..62804) [1977 bp, 658 aa] {ON}
           YPL263C (KEL3) - Kelch-repeat protein, similar to Kel1
           and Kel2 [contig 186] FULL
          Length = 658

 Score =  742 bits (1915), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 356/593 (60%), Positives = 438/593 (73%), Gaps = 11/593 (1%)

Query: 49  VLANFKKEQEQFEKVAVDSVDKVNKRLNPCMVGNPSASSSKKELIVFGGEFTNPQTSTTT 108
           VLANFKKEQE F++V V  V++ ++R+N CMV NP     K+EL++FGGE TN   S T 
Sbjct: 77  VLANFKKEQELFQEVLVTPVERPSQRINSCMVANPI--HGKRELLIFGGEHTNSTNSLTA 134

Query: 109 FYNDLHTFTPENNQWKRYTSQNXXXXXXXXXXXXXXXGIALLHGGEFSSPKQNTFYHYSD 168
           FYN+L T++ +++QW++ TS+N               G+AL+HGGEFSSPKQNTFYHYSD
Sbjct: 135 FYNELFTYSLDSDQWRKITSRNSPMPRSSAAAAAHSSGVALIHGGEFSSPKQNTFYHYSD 194

Query: 169 TWILDCNTKEWAKVDAKVGPSARSGHRITVWKNFFILHGGFRDLGTSTTYLSDCWLFDIT 228
           TW+LDC TKEW K++ K GPSARSGHR+T+WKNFFILHGGFRDLGTSTTYL+D W+FDIT
Sbjct: 195 TWLLDCTTKEWTKMEQKNGPSARSGHRMTIWKNFFILHGGFRDLGTSTTYLNDLWIFDIT 254

Query: 229 TYKWKQVEFPSNHQVPDARSGHSFIPTAEGAILWGGYCKVKANKKGYQKGKILSDCWYLK 288
           TYKWKQVEFP NH +PDARSGHS IPT +GA+LWGGYCKVKA  KG QKGK L+DCWYLK
Sbjct: 255 TYKWKQVEFPPNHPIPDARSGHSIIPTQDGAVLWGGYCKVKAG-KGLQKGKTLTDCWYLK 313

Query: 289 MKSDISGIRWERRRKQGFQPSPRVGCSMAYHKGRGILFGGVYDFEETEESLESNFFNDLF 348
           MKSD+S IRWERR+KQGFQPSPRVGCSM +HKGRG+LFGGVYDFEETEE L S FFNDLF
Sbjct: 314 MKSDVSAIRWERRKKQGFQPSPRVGCSMVHHKGRGMLFGGVYDFEETEEGLASEFFNDLF 373

Query: 349 SYHIESNRWYSLSIRSRKSNNNAVAKKSGKNSKEQEKELKMLLDSILEKANLQDKSXXXX 408
           SY +E+NRWYS+ +R +K    A++    +N++ +++EL+ +L+ IL++ANL D +    
Sbjct: 374 SYQVEANRWYSVKMRPQKKKTVAIS----RNNRNKDEELENILNDILQQANLADDT--DD 427

Query: 409 XXXXINTALAKVDLEDEEEEQLAVQHTILTQLPHPRFNATTTVIDDTLFIFGGIWELGDK 468
               I   L ++D E+E  E    Q+ ++ QLPHPRFNATT V+DD LFIFGG+WE G++
Sbjct: 428 DDNEIKRELQRID-EEEALENSRKQYEVVGQLPHPRFNATTAVVDDFLFIFGGVWEFGER 486

Query: 469 EFMIDSLYSIDLNKLDGVTMYWEDLKEIERAKELGVXXXXXXXXXXXXXXXXXXXXXXXX 528
           +F IDS YSIDLNKLDGV +YWE+L E+E+AK LG                         
Sbjct: 487 DFSIDSFYSIDLNKLDGVKVYWENLSELEKAKALGE-DDEEEFDDDEDDDDDDEEEETAD 545

Query: 529 XXXXXXXXXXXXXXXXXXXXXXYPDPRPWLPHPKPFETLRAFYIREGAAFLEWAISNNKN 588
                                  PD RPWLPHPKPFETLRAFYIR GA FL+WAISNN++
Sbjct: 546 QKLVAEDEEEEEEEEEEEDEPEIPDLRPWLPHPKPFETLRAFYIRTGAEFLKWAISNNRD 605

Query: 589 AKGKHLKKHSFDLCQERWWERRDQLRIEEDKLEEIGGVGDIIERDKSASSKRR 641
           AKGKHLKK SFDLCQ+RWWERR+Q+RIEEDKLEE+GGV +++ERD + + KRR
Sbjct: 606 AKGKHLKKQSFDLCQDRWWERREQIRIEEDKLEELGGVENVVERDPAQTMKRR 658

>ACR016W Chr3 (384967..386889) [1923 bp, 640 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL263C (KEL3)
          Length = 640

 Score =  731 bits (1888), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 347/598 (58%), Positives = 442/598 (73%), Gaps = 13/598 (2%)

Query: 49  VLANFKKEQEQFEKVAVDSVDKVNKRLNPCMVGNPSASSSKKELIVFGGEFTNPQTSTTT 108
           VLANFK++Q +FE V V++V++ ++R +  +V NP    +K+ELI+FGGE+TN  T  T 
Sbjct: 51  VLANFKRQQAEFEAVNVETVERPHQRSSSSLVANPL--HNKRELILFGGEYTNQSTGMTH 108

Query: 109 FYNDLHTFTPENNQWKRYTSQNXXXXXXXXXXXXXXXGIALLHGGEFSSPKQNTFYHYSD 168
           FYNDL  ++ + +QWK+YTSQN               G+ L+HGGEFSSPKQNTFYHYSD
Sbjct: 109 FYNDLFIYSLDTDQWKKYTSQNSPMPRSSAAIAAHPSGVVLIHGGEFSSPKQNTFYHYSD 168

Query: 169 TWILDCNTKEWAKVDAKVGPSARSGHRITVWKNFFILHGGFRDLGTSTTYLSDCWLFDIT 228
           TW+ DC T EW K++ K GPS+RSGHR+TVWKN+ ILHGGFRDLGTSTTYL+DCWLFDIT
Sbjct: 169 TWLFDCATHEWTKIEQKNGPSSRSGHRMTVWKNYIILHGGFRDLGTSTTYLNDCWLFDIT 228

Query: 229 TYKWKQVEFPSNHQVPDARSGHSFIPTAEGAILWGGYCKVKANKKGYQKGKILSDCWYLK 288
           TYKW+Q++FP+NH +PDARSGHS +PT EGAILWGGYCKVKA  KG QKGKIL+DCWYLK
Sbjct: 229 TYKWQQLQFPANHPIPDARSGHSLLPTPEGAILWGGYCKVKAG-KGLQKGKILTDCWYLK 287

Query: 289 MKSDISGIRWERRRKQGFQPSPRVGCSMAYHKGRGILFGGVYDFEETEESLESNFFNDLF 348
           MKSD++ IRWERR+KQGFQPS R GCSM +HKGRGILFGGVYD+EETEE L+S F+NDLF
Sbjct: 288 MKSDVTAIRWERRKKQGFQPSSRAGCSMVHHKGRGILFGGVYDYEETEEGLDSLFYNDLF 347

Query: 349 SYHIESNRWYSLSIRSRKSNNNAVAKKSGKNSKEQEKELKMLLDSILEKANLQDKSXXXX 408
           +YHIE+NRWYS+S+R+++   ++  K + K++++++KEL+ +L++IL+KANL        
Sbjct: 348 TYHIETNRWYSVSLRAQR---HSKVKSAPKSNRDKDKELEDMLNAILKKANLD-DDDGDE 403

Query: 409 XXXXINTALAKVDLED-EEEEQLAVQHTILTQLPHPRFNATTTVIDDTLFIFGGIWELGD 467
               I   L K++ +   E E+    + I+ +LPHPRFNA+T ++DDTLFIFGG+WE G+
Sbjct: 404 DGKTIEEELNKLENDGITETEETKKSYPIVMKLPHPRFNASTAIVDDTLFIFGGVWEQGE 463

Query: 468 KEFMIDSLYSIDLNKLDGVTMYWEDLKEIERAKELGVXXXXXXXXXXXXXXXXXXXXXXX 527
           K++MIDS YSID+NK+DGV +YWED+  +ERAKELG                        
Sbjct: 464 KDYMIDSFYSIDMNKVDGVKVYWEDMAAVERAKELGE-EDEDDAEDDEDDDSEDDDEEEH 522

Query: 528 XXXXXXXXXXXXXXXXXXXXXXXYPDPRPWLPHPKPFETLRAFYIREGAAFLEWAISNNK 587
                                   PDPRPWLPHPK FE+LRAFY+R GA+FLEWAI+N  
Sbjct: 523 SDRKLVAEEEEEEEEEDNEILPEIPDPRPWLPHPKAFESLRAFYVRTGASFLEWAITNKH 582

Query: 588 N----AKGKHLKKHSFDLCQERWWERRDQLRIEEDKLEEIGGVGDIIERDKSASSKRR 641
           N    AKGKHLKKHSFDLCQERWWERR+Q+RIEEDKLEE+GGVG++IE+D +  +KRR
Sbjct: 583 NTRSDAKGKHLKKHSFDLCQERWWERREQVRIEEDKLEELGGVGEVIEKDFTKPTKRR 640

>KAFR0B06500 Chr2 (1347509..1349419) [1911 bp, 636 aa] {ON} Anc_6.10
           YPL263C
          Length = 636

 Score =  729 bits (1881), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 358/595 (60%), Positives = 434/595 (72%), Gaps = 11/595 (1%)

Query: 49  VLANFKKEQEQFEKVAVDSVDKVNKRLNPCMVGNPSASSSKKELIVFGGEFTNPQTSTTT 108
           +L NFKKEQE +EK+ ++SV+K + R N  ++    +S++KKEL++FGGE T+ +  TT 
Sbjct: 51  ILENFKKEQENYEKINIESVEKPSIRNNGSII----SSTTKKELLLFGGEHTSKELQTTK 106

Query: 109 FYNDLHTFTPENNQWKRYTSQNXXXXXXXXXXXXXXXGIALLHGGEFSSPKQNTFYHYSD 168
           FYNDL+TF+P+NNQWKR TSQN               GIALL+GGEFSSPKQ+TFYHYSD
Sbjct: 107 FYNDLYTFSPDNNQWKRITSQNSPMPRSSAAMAAHPSGIALLNGGEFSSPKQSTFYHYSD 166

Query: 169 TWILDCNTKEWAKVDAKVGPSARSGHRITVWKNFFILHGGFRDLGTSTTYLSDCWLFDIT 228
           TWILD  TKEW K++ KV P  RSGHRIT WKN+FIL GGF+DLG STTY +D WLFDIT
Sbjct: 167 TWILDLTTKEWTKIEGKVKPVGRSGHRITTWKNYFILFGGFKDLGHSTTYYNDVWLFDIT 226

Query: 229 TYKWKQVEFPSNHQVPDARSGHSFIPTAEGAILWGGYCKVKANKKGYQKGKILSDCWYLK 288
           TYKWKQVEFP NH +PDARSGHS IPT+EG I++GGYCK+KA KKG QKGK+LS CW LK
Sbjct: 227 TYKWKQVEFPKNHTLPDARSGHSLIPTSEGCIVYGGYCKIKA-KKGLQKGKLLSGCWNLK 285

Query: 289 MKSDISGIRWERRRKQGFQPSPRVGCSMAYHKGRGILFGGVYDFEETEESLESNFFNDLF 348
           MK+D+  IRWERRRKQGFQPSPRVGCSMAYHKGRGILFGGVYDF+ETEESLES F+NDLF
Sbjct: 286 MKADVEAIRWERRRKQGFQPSPRVGCSMAYHKGRGILFGGVYDFDETEESLESIFYNDLF 345

Query: 349 SYHIESNRWYSLSIRSRKSNNNAVAKKSGKNSKEQEKELKMLLDSILEKANLQDKSXXXX 408
           +Y+IESNRW++++++ R +    ++    K+SKE+E+EL+ LL+ ILEK NL+       
Sbjct: 346 TYNIESNRWFNVTLKKRSNATKTISSTKNKSSKEKERELQDLLNQILEKNNLKPDDEEEE 405

Query: 409 XXXXINTALAKVDLEDEEEEQLAVQHTILTQLPHPRFNATTTVIDDTLFIFGGIWELGDK 468
               I  +    D ED+EE++  +    +TQLPHPRFNATTTVIDD L+I+GG WE G+ 
Sbjct: 406 ESSDIFGS----DDEDDEEQKNKIDIKTVTQLPHPRFNATTTVIDDMLYIYGGAWEFGEI 461

Query: 469 EFMIDSLYSIDLNKLDGVTMYWEDLKEIERAKELGVX-XXXXXXXXXXXXXXXXXXXXXX 527
           ++ IDS YSIDLNKLDGV +YWEDL EIE AKELG                         
Sbjct: 462 DYSIDSFYSIDLNKLDGVNVYWEDLNEIETAKELGEQGSEDEDEDDFEEDEEDGEEEVED 521

Query: 528 XXXXXXXXXXXXXXXXXXXXXXXYPDPRPWLPHPKPFETLRAFYIREGAAFLEWAISNNK 587
                                   PDPRPWLPHPK FE+LRAFY+REG AFLEWAISNN+
Sbjct: 522 TKLIAEDVEDEKEEEEEEYPEMEIPDPRPWLPHPKAFESLRAFYLREGPAFLEWAISNNR 581

Query: 588 NAKGKHLKKHSFDLCQERWWERRDQLRIEEDKLEEIGGVGDIIERDKS-ASSKRR 641
           + +GK LK+ SF+LCQ+RWWERRDQ+ IEEDKLEEIG VGD++ERD S A SKRR
Sbjct: 582 HTRGKLLKQKSFELCQDRWWERRDQISIEEDKLEEIGVVGDVVERDTSKAVSKRR 636

>KLLA0D00836g Chr4 complement(78202..80124) [1923 bp, 640 aa] {ON}
           similar to uniprot|Q08979 Saccharomyces cerevisiae
           YPL263C KEL3 Cytoplasmic protein of unknown function
          Length = 640

 Score =  708 bits (1828), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 344/597 (57%), Positives = 432/597 (72%), Gaps = 12/597 (2%)

Query: 50  LANFKKEQEQFEKVAVDSVDKVNKRLNPCMVGNPSASSSKKELIVFGGEFTNPQTSTTTF 109
           LANFK+EQE FEK+ V++VD+ ++R+NPCM  NP+    K+EL++FGGE T  +T TT F
Sbjct: 51  LANFKREQENFEKINVENVDRPDQRINPCMFVNPA--HGKRELMMFGGESTTQETGTTHF 108

Query: 110 YNDLHTFTPENNQWKRYTSQNXXXXXXXXXXXXXXXGIALLHGGEFSSPKQNTFYHYSDT 169
           YNDL  ++ + + WKRYTSQN               G+AL+HGGEFSSPKQNTFYHYSD+
Sbjct: 109 YNDLFVYSLDTDTWKRYTSQNSPMPRSSAAVASHPTGVALIHGGEFSSPKQNTFYHYSDS 168

Query: 170 WILDCNTKEWAKVDAKVGPSARSGHRITVWKNFFILHGGFRDLGTSTTYLSDCWLFDITT 229
           W+ DC++KEW KV+ K GPSARSGHR+ +WKNF ILHGGFRDLGTSTTYL+D W+FDIT 
Sbjct: 169 WLFDCSSKEWTKVEQKNGPSARSGHRMAIWKNFIILHGGFRDLGTSTTYLNDLWVFDITN 228

Query: 230 YKWKQVEFPSNHQVPDARSGHSFIPTAEGAILWGGYCKVKANKKGYQKGKILSDCWYLKM 289
           YKWKQVE P+NH +PDARSGHS I TAEGA+L+GGY KVKA  KG QKGKILSDCWYLKM
Sbjct: 229 YKWKQVELPANHPIPDARSGHSLISTAEGAVLYGGYTKVKAG-KGLQKGKILSDCWYLKM 287

Query: 290 KSDISGIRWERRRKQGFQPSPRVGCSMAYHKGRGILFGGVYDFEETEESLESNFFNDLFS 349
           KSD+  IRWERR+KQG QPSPRVGCSM +HKGRG+LFGGVYDFEETEESL S F+N+L++
Sbjct: 288 KSDLGSIRWERRKKQGSQPSPRVGCSMVHHKGRGVLFGGVYDFEETEESLRSIFYNELYT 347

Query: 350 YHIESNRWYSLSIRSRKSNNNAVAKKSGKNSKEQEKELKMLLDSILEKANLQDKSXXXXX 409
           Y IE+NRWY++S+R ++   N V  KS +N   ++KEL+ +L+ IL+KANL+D +     
Sbjct: 348 YQIENNRWYAMSLRPQRKKKNFVQSKSNRN---KDKELEDILNQILDKANLRD-AEDDDE 403

Query: 410 XXXINTALAK-----VDLEDEEEEQLAVQHTILTQLPHPRFNATTTVIDDTLFIFGGIWE 464
              I   L +      D +DE +++ A  +  ++ LPH RFNA T V+DDTLFIFGG  E
Sbjct: 404 SKVIEEQLNQLDLIDFDDDDESDKKSAKSYETMSTLPHARFNAATAVVDDTLFIFGGTVE 463

Query: 465 LGDKEFMIDSLYSIDLNKLDGVTMYWEDLKEIERAKELGVXXXXXXXXXXXXXXXXXXXX 524
           +G+K++ IDS YSID+NKLDGV +YWE+LKE+ERA++LG                     
Sbjct: 464 IGEKDYPIDSFYSIDMNKLDGVKVYWEELKEVERAEKLGEQDSDDEFGDEDDDDEDDGEE 523

Query: 525 XXXXXXXXXXXXXXXXXXXXXXXXXXYPDPRPWLPHPKPFETLRAFYIREGAAFLEWAIS 584
                                      PD RPWLPHPK FETLRAFY+R G  FLE AIS
Sbjct: 524 EIVDSKLEAEDEEEEEEEEEVEEEYEIPDLRPWLPHPKAFETLRAFYVRTGPTFLELAIS 583

Query: 585 NNKNAKGKHLKKHSFDLCQERWWERRDQLRIEEDKLEEIGGVGDIIERDKSASSKRR 641
           +N+++KGKHLK  SF+LCQ+RWWERR+Q+RIEEDKLEE+GGV D+IE+D S + +RR
Sbjct: 584 SNRDSKGKHLKTKSFELCQDRWWERREQVRIEEDKLEELGGVEDVIEKDTSKTQRRR 640

>NDAI0I02750 Chr9 complement(644137..646128) [1992 bp, 663 aa] {ON}
           Anc_6.10 YPL263C
          Length = 663

 Score =  701 bits (1810), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 355/611 (58%), Positives = 430/611 (70%), Gaps = 18/611 (2%)

Query: 49  VLANFKKEQEQFEKVAVDSV-----DKVNKRLNPCMVGNPSASSSK-KELIVFGGEFTNP 102
           VLANFK EQE+FEK+ V+ +     + ++ R N  M+   SA + K KEL++FGGE+T+P
Sbjct: 53  VLANFKMEQEKFEKINVELLPQGQHNHISPRSNSSMITAASAHNKKGKELLMFGGEYTSP 112

Query: 103 QTSTTTFYNDLHTFTPENNQWKRYTSQNXXXXXXXXXXXXXXXGIALLHGGEFSSPKQNT 162
           +T  T FYNDL ++TP+  QW++ TSQN               GIA+LHGGEFSSPKQNT
Sbjct: 113 ETGMTHFYNDLLSYTPDTQQWRKITSQNSPMPRSSAAMCYHPSGIAILHGGEFSSPKQNT 172

Query: 163 FYHYSDTWILDCNTKEWAKVDAKVGPSARSGHRITVWKNFFILHGGFRDLGTS-TTYLSD 221
           FYHYSDTWILD +TKEW KVD K  P ARSGHRI  WKN+F+L GGF+D+G + T Y +D
Sbjct: 173 FYHYSDTWILDTSTKEWTKVDIKKSPVARSGHRIVHWKNYFVLFGGFKDIGNNQTNYFND 232

Query: 222 CWLFDITTYKWKQVEFPSNHQVPDARSGHSFIPTAEGAILWGGYCKVKAN-KKGYQKGKI 280
            W FDI  YKW QVEFP NH +PD RSGHS+IP  EG ILWGGY KVK+  K G QKGKI
Sbjct: 233 VWCFDILNYKWTQVEFPKNHPLPDPRSGHSWIPVEEGCILWGGYTKVKSKLKSGQQKGKI 292

Query: 281 LSDCWYLKMKSDISGIRWERRRKQGFQPSPRVGCSMAYHKGRGILFGGVYDFEETEESLE 340
           L+DCWYLKMKSD+S IRWERR+K GFQPSPRVGCSMAYHKGRGILFGGVYDF+ETEESLE
Sbjct: 293 LNDCWYLKMKSDLSSIRWERRKKLGFQPSPRVGCSMAYHKGRGILFGGVYDFDETEESLE 352

Query: 341 SNFFNDLFSYHIESNRWYSLSIRSRKSNNNAVAKKSGKNSKEQEKELKMLLDSILEKANL 400
           S F+NDLFSY++E+NRW++L++R  +  N ++ + + KNSKE+EKEL+ LL+ ILEK NL
Sbjct: 353 SLFYNDLFSYNVETNRWFALNLRKNQKGNKSLKRSNNKNSKEKEKELQDLLNQILEKNNL 412

Query: 401 QDKSXXXXXX-------XXINTALAKVDLED-EEEEQLAVQHTILTQLPHPRFNATTTVI 452
           +D+                  +  A  D ED E   Q A   TI+ QLPHPR+N   TV+
Sbjct: 413 KDEDDEDDEEVNENEDGSTTASTAATSDDEDTERTTQEAEGVTIMNQLPHPRYNVAMTVV 472

Query: 453 DDTLFIFGGIWELGDKEFMIDSLYSIDLNKLDGVTMYWEDLKEIERAKELGVXXXXXXXX 512
           DD LFI+GG WELG+K++ I+S YSIDLN++DGVT YWEDLKEIE+AKELG         
Sbjct: 473 DDLLFIYGGSWELGEKDYFINSFYSIDLNRIDGVTCYWEDLKEIEKAKELGEQDSDEEDD 532

Query: 513 XXXXXXXXXXXXXXX-XXXXXXXXXXXXXXXXXXXXXXXYPDPRPWLPHPKPFETLRAFY 571
                                                   PD RPWLPHPKPFE+LRAFY
Sbjct: 533 EDDEEDDDEDDDEEEIKDQKLVADDEDEEEEEEDVQEMEIPDLRPWLPHPKPFESLRAFY 592

Query: 572 IREGAAFLEWAISNNKNAKGKHLKKHSFDLCQERWWERRDQLRIEEDKLEEIGGVGDIIE 631
           IREG AFLEWAISNNK+ +GKHLKK SF+LC++RWWERRDQ+RIEEDKLEE+G VGD+IE
Sbjct: 593 IREGPAFLEWAISNNKHVRGKHLKKKSFELCEDRWWERRDQIRIEEDKLEELGVVGDVIE 652

Query: 632 RDKS-ASSKRR 641
           +D S  +SKRR
Sbjct: 653 KDTSKGASKRR 663

>KNAG0E02780 Chr5 complement(559180..561132) [1953 bp, 650 aa] {ON}
           Anc_6.10 YPL263C
          Length = 650

 Score =  645 bits (1664), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 328/602 (54%), Positives = 404/602 (67%), Gaps = 14/602 (2%)

Query: 49  VLANFKKEQEQFEKVAVDSVDKVNKRLNPCMVGNPSASSSKKELIVFGGEFTNPQTSTTT 108
           +L NFK EQEQFEKV V+ V     R N C+V N    +SK EL++FGGE TN +T+ T 
Sbjct: 53  ILQNFKLEQEQFEKVVVELVPHPTPRNNACLVTN----ASKPELLLFGGERTNNETNMTK 108

Query: 109 FYNDLHTFTPENNQWKRYTSQNXXXXXXXXXXXXXXXGIALLHGGEFSSPKQNTFYHYSD 168
           FYNDLH + P+NNQWK++TSQN               G+ +L GGEFSSPKQNTFYHY+D
Sbjct: 109 FYNDLHVYNPQNNQWKKFTSQNSPMPRSSAAMCSHQSGVTILFGGEFSSPKQNTFYHYND 168

Query: 169 TWILDCNTKEWAKVDAKVGPSARSGHRITVWKNFFILHGGFRDLGTSTTYLSDCWLFDIT 228
           TW+LD  T+EW+K+D K GPSARSGHRIT WKN+FIL GGF+DL   T+Y +D WLF++ 
Sbjct: 169 TWLLDNTTREWSKLDFKNGPSARSGHRITTWKNYFILFGGFKDLNQGTSYFNDVWLFNVV 228

Query: 229 TYKWKQVEFPSNHQVPDARSGHSFIPTAEGAILWGGYCKVKA-NKKGYQKGKILSDCWYL 287
            +KW + E  +N   PD RSGHS+I + EG I++GGYCKVKA N K   KGK L+DCW L
Sbjct: 229 DFKWTKWE-TTNKNQPDPRSGHSWIGSNEGPIVYGGYCKVKAKNNKSLHKGKTLTDCWIL 287

Query: 288 KMKSDISGIRWERRRKQGFQPSPRVGCSMAYHK-GRGILFGGVYDFEETEESLESNFFND 346
           KM  +++ I+WERR K+G QPSPRVGCSMA H+  RGILFGGVYD EETEE L S ++ND
Sbjct: 288 KMSQNVNEIKWERRAKKGQQPSPRVGCSMALHRNNRGILFGGVYDLEETEEDLSSIYYND 347

Query: 347 LFSYHIESNRWYSLSIRSRKSNNNAVAKKSGKN--SKEQEKELKMLLDSILEKANLQDKS 404
           L+SY+IESNRWY L +R    N+NA   KS  N  SKEQEKEL+ LL+ ILE+ +L+D+ 
Sbjct: 348 LYSYNIESNRWYPLKLRKVTQNSNANRNKSSNNTVSKEQEKELQDLLNKILEQNDLKDEE 407

Query: 405 XXXXXXXXINTALAKVDLE---DEEEEQLAVQHTILTQLPHPRFNATTTVIDDTLFIFGG 461
                           D E   +EEEE++      L QLPH RFNA TTV++DT +I+GG
Sbjct: 408 TNSYSGSNTPHEETTTDREQDDNEEEEKMRTNLPKLNQLPHERFNACTTVLNDTFYIYGG 467

Query: 462 IWELGDKEFMIDSLYSIDLNKLDGVTMYWEDLKEIERAKELG-VXXXXXXXXXXXXXXXX 520
           +WE  D ++ IDS YSIDLNKLDG+T Y+E+L+EIE  K LG V                
Sbjct: 468 MWEFKDNDYTIDSFYSIDLNKLDGITQYYENLQEIEEVKRLGDVQSEDDFEYEDDDDEDD 527

Query: 521 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYPDPRPWLPHPKPFETLRAFYIREGAAFLE 580
                                          PDPRPWLPHPK FE+LR FYIREG  FLE
Sbjct: 528 GEAEPTNERLEAEDDDEEENEEDEGIDEMEIPDPRPWLPHPKAFESLREFYIREGPKFLE 587

Query: 581 WAISNNKNAKGKHLKKHSFDLCQERWWERRDQLRIEEDKLEEIGGVGDIIERD-KSASSK 639
           WAISNNK+AKGKHLK+ SF+LCQ+RWWERRDQ++IEEDKL+E+G  GDIIERD +S  + 
Sbjct: 588 WAISNNKHAKGKHLKQKSFELCQDRWWERRDQIQIEEDKLQELGVGGDIIERDAQSPPTA 647

Query: 640 RR 641
           RR
Sbjct: 648 RR 649

>KLTH0C11528g Chr3 (946632..948560) [1929 bp, 642 aa] {ON} similar
           to uniprot|Q08979 Saccharomyces cerevisiae YPL263C KEL3
           Cytoplasmic protein of unknown function
          Length = 642

 Score =  603 bits (1556), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 288/456 (63%), Positives = 355/456 (77%), Gaps = 15/456 (3%)

Query: 52  NFKKEQEQFEKVAVDSVDKVNKRLNPCMVGNPSASSSKKELIVFGGEFTNPQTSTTTFYN 111
           NF+KEQE F++V V  V + + R N CMV NPS    K+EL++FGGE+TN  +STTTFYN
Sbjct: 54  NFRKEQELFQEVVVTPVKRPSPRSNVCMVPNPS--HGKRELLIFGGEYTNQTSSTTTFYN 111

Query: 112 DLHTFTPENNQWKRYTSQNXXXXXXXXXXXXXXXGIALLHGGEFSSPKQNTFYHYSDTWI 171
           +L T++ + +QWK+ TS+N               G+ L+HGGEFSSPKQNTFYHYSD+W+
Sbjct: 112 ELFTYSLDTDQWKKITSRNAPMPRSSAAAAGHPSGVVLIHGGEFSSPKQNTFYHYSDSWL 171

Query: 172 LDCNTKEWAKVDAKVGPSARSGHRITVWKNFFILHGGFRDLGTSTTYLSDCWLFDITTYK 231
           LDC++KEW K+D K GPSARSGHR+TVWKNFF++HGGFRDLGTSTTYL+DCWLFDITTYK
Sbjct: 172 LDCSSKEWTKIDQKNGPSARSGHRMTVWKNFFVMHGGFRDLGTSTTYLNDCWLFDITTYK 231

Query: 232 WKQVEFPSNHQVPDARSGHSFIPTAEGAILWGGYCKVKANKKGYQKGKILSDCWYLKMKS 291
           WKQVEFP NH VPDARSGHS IPT EGAI+WGGYCK+KA KKG QKGKIL+DCWYL+MKS
Sbjct: 232 WKQVEFPPNHPVPDARSGHSLIPTQEGAIVWGGYCKIKA-KKGLQKGKILTDCWYLRMKS 290

Query: 292 DISGIRWERRRKQGFQPSPRVGCSMAYHKGRGILFGGVYDFEETEESLESNFFNDLFSYH 351
           DI+GIRWERR+KQGFQPSPRVGCSMA+HKGRGILFGGVYD+EETEE L S FFNDL SY 
Sbjct: 291 DITGIRWERRKKQGFQPSPRVGCSMAHHKGRGILFGGVYDYEETEEGLSSEFFNDLLSYQ 350

Query: 352 IESNRWYSLSIRSRKSNNNAVAKKSGKNSKEQEKELKMLLDSILEKANL-QDKSXXXXXX 410
           +E+NRWYS+ +R +K    A +    K++K ++ EL  +L+ IL+KANL  +++      
Sbjct: 351 VEANRWYSIKMRPQKKKIVAAS----KSAKSKDDELVGILNDILQKANLADEENEENESD 406

Query: 411 XXINTALAKVDLEDEEEEQLA---VQHTILTQLPHPRFNATTTVIDDTLFIFGGIWELGD 467
             I   L ++D    EEE L     Q+ ++ QLPH RFNA TTV+DDTLFIFGG WE G+
Sbjct: 407 SEIEKELHRLD----EEELLGHQQKQYPVVAQLPHSRFNAATTVVDDTLFIFGGSWEYGE 462

Query: 468 KEFMIDSLYSIDLNKLDGVTMYWEDLKEIERAKELG 503
           ++F IDS YSIDLN+ DGV ++WEDL+EIE+AK+ G
Sbjct: 463 RDFSIDSFYSIDLNRTDGVRVFWEDLEEIEKAKDQG 498

 Score =  161 bits (407), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 73/90 (81%), Positives = 82/90 (91%)

Query: 552 PDPRPWLPHPKPFETLRAFYIREGAAFLEWAISNNKNAKGKHLKKHSFDLCQERWWERRD 611
           PDPRPWLPHPK FETLRAFYIR GA FL+WAISNN++AKGKHLKK SFDL Q+RWWERR+
Sbjct: 553 PDPRPWLPHPKAFETLRAFYIRTGAEFLQWAISNNRSAKGKHLKKQSFDLSQDRWWERRE 612

Query: 612 QLRIEEDKLEEIGGVGDIIERDKSASSKRR 641
           Q+RIEEDKLEE+GGV +IIERD S S+KRR
Sbjct: 613 QVRIEEDKLEEMGGVENIIERDSSHSTKRR 642

>Suva_16.42 Chr16 complement(60142..62106) [1965 bp, 654 aa] {ON}
           YPL263C (REAL)
          Length = 654

 Score =  551 bits (1421), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/609 (48%), Positives = 387/609 (63%), Gaps = 24/609 (3%)

Query: 49  VLANFKKEQEQFEKVAVDSVDKVNKRLNPCMVGNPSASSSKKELIVFGGEFTNPQTSTTT 108
           +L++F K+Q + E V + +V++ + R++P M  NP    +K EL +FGGEFT+P+T  T 
Sbjct: 54  ILSSFTKKQTELEHVDITAVERPSCRVHPLMFANPQ--HNKHELFIFGGEFTDPETKLTH 111

Query: 109 FYNDLHTFTPENNQWKRYTSQNXXXXXXXXXXXXXXXGIALLHGGEFSSPKQNTFYHYSD 168
           FYNDL++++ +NN WK+Y SQN               GIALLHGGEFSSPKQ+ FYHYSD
Sbjct: 112 FYNDLYSYSIKNNSWKKYVSQNAPLPRSSGAVAVHSSGIALLHGGEFSSPKQSKFYHYSD 171

Query: 169 TWILDCNTKEWAKVD---AKVGPSARSGHRITVWKNFFILHGGFRDLGT-STTYLSDCWL 224
           TW+ DC+ K++ K++       PSARSGHRI  WKN+FIL GGFRDLG+  T+YL+D W 
Sbjct: 172 TWLFDCHEKKFTKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGSGQTSYLNDLWC 231

Query: 225 FDITTYKWKQVEFPSNHQVPDARSGHSFIPTAEGAILWGGYCKVKA-NKKGYQKGKILSD 283
           FDI+ YKW ++E    +  PDARSGH F+PT   AIL GGYCK  A N K   KGKIL+D
Sbjct: 232 FDISNYKWTKLE---TNTKPDARSGHCFVPTDNSAILMGGYCKTIAKNNKNLMKGKILND 288

Query: 284 CWYLKMKSDISGIRWERRRKQGFQPSPRVGCSM-AYHKGRGILFGGVYDFEETEESLESN 342
            W L +  D    +WE+ +    QPSPRVG S   + + + + FGGVYD +ETEESL+S 
Sbjct: 289 SWKLTLTPDPKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLDSI 348

Query: 343 FFNDLFSYHIESNRWYSLSIRSRK--SNNNAVAKKSGKNSKEQEKELKMLLDSILEKANL 400
           F+NDL+ +H+E N+W  L I+ ++  +N NA A    K++K+QEKEL+ LL+SIL K+NL
Sbjct: 349 FYNDLYMFHLELNKWSKLRIKPQRHTNNRNAPATSKRKSNKDQEKELQDLLNSILAKSNL 408

Query: 401 QDKSXXXXXXXXINTALAKVDLEDEEEEQLAVQH----TILTQLPHPRFNATTTVIDDTL 456
            D+           T     + E ++E+    ++    TI  QLPHPRFNA T V+DD+L
Sbjct: 409 NDEEDDNDDSTATTTGANSSNDEGDDEDDSDFENQENITISNQLPHPRFNAATCVVDDSL 468

Query: 457 FIFGGIWELGDKEFMIDSLYSIDLNKLDGVTMYWEDLKEIERAKELG---VXXXXXXXXX 513
           FI+ G+WELG+K++ I+S YSIDLNKLDGV +YWEDL  +E AK LG             
Sbjct: 469 FIYSGVWELGEKDYPINSFYSIDLNKLDGVKVYWEDLSTVEEAKRLGDRDSDEEEFEYED 528

Query: 514 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYPDPRPWLPHPKPFETLRAFYIR 573
                                                 PD R WLPHPKPFETLRAFY+R
Sbjct: 529 EDDDEDDDEEEPQDTRLLEDDDDEESEEEDDGQAQMEIPDERSWLPHPKPFETLRAFYLR 588

Query: 574 EGAAFLEWAISNNKNAKGKHLKKHSFDLCQERWWERRDQLRIEEDKLEEIGGVGDIIERD 633
           EGA FL W+ISNN+N KGK LK  SF+LC++RWWERRDQ+ +EE++LE+ GG   IIERD
Sbjct: 589 EGANFLTWSISNNRNLKGKQLKTKSFELCEDRWWERRDQVTLEEERLEDTGG---IIERD 645

Query: 634 KSAS-SKRR 641
            +A  SKRR
Sbjct: 646 ATAKPSKRR 654

>YPL263C Chr16 complement(44551..46506) [1956 bp, 651 aa] {ON}
           KEL3Cytoplasmic protein of unknown function
          Length = 651

 Score =  548 bits (1413), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/606 (49%), Positives = 380/606 (62%), Gaps = 21/606 (3%)

Query: 49  VLANFKKEQEQFEKVAVDSVDKVNKRLNPCMVGNPSASSSKKELIVFGGEFTNPQTSTTT 108
           +L++F K+Q + E V + SV+K + R +P M  NP    +K EL +FGGEFT+P+T  T 
Sbjct: 54  ILSSFSKKQIELEHVDITSVEKPSCRTHPLMFANPQ--HNKHELFIFGGEFTDPETKLTH 111

Query: 109 FYNDLHTFTPENNQWKRYTSQNXXXXXXXXXXXXXXXGIALLHGGEFSSPKQNTFYHYSD 168
           FYNDL++++ +NN WK+Y SQN               GIALLHGGEFSSPKQ+ FYHYSD
Sbjct: 112 FYNDLYSYSIKNNSWKKYVSQNAPLPRSSAAVAVHPSGIALLHGGEFSSPKQSKFYHYSD 171

Query: 169 TWILDCNTKEWAKVD---AKVGPSARSGHRITVWKNFFILHGGFRDLGT-STTYLSDCWL 224
           TW+ DC  +++ K++       PSARSGHRI  WKN+FIL GGFRDLG   T+YL+D W 
Sbjct: 172 TWLFDCVERKFTKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWC 231

Query: 225 FDITTYKWKQVEFPSNHQVPDARSGHSFIPTAEGAILWGGYCKVKA-NKKGYQKGKILSD 283
           FDI+TYKW ++E  S    PDARSGH FIPT   AIL GGYCK+ A N K   KGKIL+D
Sbjct: 232 FDISTYKWTKLETNSK---PDARSGHCFIPTDNSAILMGGYCKIIAKNNKNLMKGKILND 288

Query: 284 CWYLKMKSDISGIRWERRRKQGFQPSPRVGCSM-AYHKGRGILFGGVYDFEETEESLESN 342
            W L +  D    +WE+ +    QPSPRVG S   + + + + FGGVYD +ETEESLES 
Sbjct: 289 AWKLNLTPDPKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLESV 348

Query: 343 FFNDLFSYHIESNRWYSLSIRSRKSNN--NAVAKKSGKNSKEQEKELKMLLDSILEKANL 400
           F+NDL+ +H+E N+W  L I+ ++  N  N+ A    K++K+QEKEL+ LL+SIL K+NL
Sbjct: 349 FYNDLYMFHLELNKWSKLRIKPQRQTNSKNSPATSKRKSNKDQEKELQDLLNSILAKSNL 408

Query: 401 QDKSXXXXXXXXI--NTALAKVDLEDEEEEQLAVQHTILTQLPHPRFNATTTVIDDTLFI 458
            D             N+     D ED+ +       TI  QLPHPRFNA T V+ D+LFI
Sbjct: 409 NDDDDDNDDNSTTGPNSIDDDEDNEDDSDLDNQEDITISNQLPHPRFNAATCVVGDSLFI 468

Query: 459 FGGIWELGDKEFMIDSLYSIDLNKLDGVTMYWEDLKEIERAKELG--VXXXXXXXXXXXX 516
           + G+WELG+K++ I+S YSIDLNKLDGV +YWEDL  IE AK LG               
Sbjct: 469 YSGVWELGEKDYPINSFYSIDLNKLDGVKVYWEDLSAIEEAKRLGDRDSDEDEFEYEDDE 528

Query: 517 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYPDPRPWLPHPKPFETLRAFYIREGA 576
                                              PD R WLPHPKPFETLRAFY+REGA
Sbjct: 529 EDEDDGEEEQDAGPLEGDEDEESESDDDKQAQMEIPDERSWLPHPKPFETLRAFYLREGA 588

Query: 577 AFLEWAISNNKNAKGKHLKKHSFDLCQERWWERRDQLRIEEDKLEEIGGVGDIIERDKSA 636
            FL W+ISNN+N KGK LK  SF+LC++RWWERRDQ+ +EE++LE+ GG   IIERD + 
Sbjct: 589 NFLTWSISNNRNLKGKQLKTKSFELCEDRWWERRDQVTLEEERLEDTGG---IIERDTTT 645

Query: 637 -SSKRR 641
             SKRR
Sbjct: 646 KPSKRR 651

>Skud_16.14 Chr16 complement(23637..25595) [1959 bp, 652 aa] {ON}
           YPL263C (REAL)
          Length = 652

 Score =  548 bits (1412), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 292/607 (48%), Positives = 386/607 (63%), Gaps = 22/607 (3%)

Query: 49  VLANFKKEQEQFEKVAVDSVDKVNKRLNPCMVGNPSASSSKKELIVFGGEFTNPQTSTTT 108
           +L++F K+Q + E V + +V++++ R +P M  NP    +K+EL +FGGEFT+P+T  T 
Sbjct: 54  ILSSFTKKQTELEHVDITAVERLSCRTHPLMFANPQ--HNKRELFIFGGEFTDPETKLTH 111

Query: 109 FYNDLHTFTPENNQWKRYTSQNXXXXXXXXXXXXXXXGIALLHGGEFSSPKQNTFYHYSD 168
           FYNDL++++ +NN WK+Y S+N               GIALLHGGEFSSPKQ+ FYHYSD
Sbjct: 112 FYNDLYSYSIKNNSWKKYVSKNAPLPRSSAAVAVHPSGIALLHGGEFSSPKQSKFYHYSD 171

Query: 169 TWILDCNTKEWAKVD---AKVGPSARSGHRITVWKNFFILHGGFRDLGT-STTYLSDCWL 224
           TW+ DC  +++ K++       PSARSGHRI  WKN+FIL GGFRDLG   T+YL+D W 
Sbjct: 172 TWLFDCAERKFTKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWC 231

Query: 225 FDITTYKWKQVEFPSNHQVPDARSGHSFIPTAEGAILWGGYCKVKA-NKKGYQKGKILSD 283
           FDI+ YKW ++E    +  P+ARSGH FIPT   AIL GGYCK+ A N K   KGKIL+D
Sbjct: 232 FDISNYKWTKLE---TNTKPEARSGHCFIPTDNSAILMGGYCKIIAKNNKNLMKGKILND 288

Query: 284 CWYLKMKSDISGIRWERRRKQGFQPSPRVGCSM-AYHKGRGILFGGVYDFEETEESLESN 342
            W L +  D    +WE+ +    QPSPRVG S   + + + + FGGVYD +ETEESLES 
Sbjct: 289 AWKLNLTPDPKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLESV 348

Query: 343 FFNDLFSYHIESNRWYSLSIRSRKSNNNAVAKKSG--KNSKEQEKELKMLLDSILEKANL 400
           F+NDL+ +H+E N+W  L I+ ++  NN  A  +   K++K+QEKEL+ LL+SIL K+NL
Sbjct: 349 FYNDLYMFHLELNKWSKLRIKPQRQTNNKNAPLTSKRKSNKDQEKELQDLLNSILAKSNL 408

Query: 401 QDKSXXXXXXXXINTALAKVDLEDEEEEQLAVQH-TILTQLPHPRFNATTTVIDDTLFIF 459
            D           N+     + ED++ +    ++ TI  QLPHPRFNA T V+DD+LFI+
Sbjct: 409 NDDDDDDNTTTGSNSIDGDDEGEDDDSDLDNPENITISNQLPHPRFNAATCVVDDSLFIY 468

Query: 460 GGIWELGDKEFMIDSLYSIDLNKLDGVTMYWEDLKEIERAKELG----VXXXXXXXXXXX 515
            G+WELG+K++ I+S YSIDLNKLDGV +YWEDL  IE AK LG                
Sbjct: 469 SGVWELGEKDYPINSFYSIDLNKLDGVNVYWEDLSTIEEAKRLGDRDSDEDDFEYEDDDD 528

Query: 516 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYPDPRPWLPHPKPFETLRAFYIREG 575
                                               PD R WLPHPKPFETLRAFY+REG
Sbjct: 529 DDGEDNDEEEQDVALLEGDEDEEGENEDNGQAQMEIPDERSWLPHPKPFETLRAFYLREG 588

Query: 576 AAFLEWAISNNKNAKGKHLKKHSFDLCQERWWERRDQLRIEEDKLEEIGGVGDIIERDKS 635
           A FL W+ISNNK+ KGKHLK  SF++C++RWWERRDQ+ +EE++LE+ GG   IIERD +
Sbjct: 589 ANFLTWSISNNKDLKGKHLKTKSFEICEDRWWERRDQVTLEEERLEDTGG---IIERDTT 645

Query: 636 AS-SKRR 641
              SKRR
Sbjct: 646 TKISKRR 652

>Smik_6.471 Chr6 (774663..776618) [1956 bp, 651 aa] {ON} YPL263C
           (REAL)
          Length = 651

 Score =  536 bits (1381), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 295/606 (48%), Positives = 381/606 (62%), Gaps = 21/606 (3%)

Query: 49  VLANFKKEQEQFEKVAVDSVDKVNKRLNPCMVGNPSASSSKKELIVFGGEFTNPQTSTTT 108
           +L++F K+Q + E V + +V++ + R +P M  NP    +K EL +FGGEFT+ +T  T 
Sbjct: 54  ILSSFTKKQTELEHVDITAVERPSCRTHPLMFANPQ--HNKHELFIFGGEFTDSETKLTH 111

Query: 109 FYNDLHTFTPENNQWKRYTSQNXXXXXXXXXXXXXXXGIALLHGGEFSSPKQNTFYHYSD 168
           FYNDL++++ +NN WK+Y SQN               GIALLHGGEFSSPKQ+ FYHYSD
Sbjct: 112 FYNDLYSYSIKNNSWKKYVSQNAPLPRSSAAVAVHPSGIALLHGGEFSSPKQSKFYHYSD 171

Query: 169 TWILDCNTKEWAKVD---AKVGPSARSGHRITVWKNFFILHGGFRDLGT-STTYLSDCWL 224
           TW+ DC  +++ K++       PSARSGHRI  WKN+FIL GGFRDLG   T+YL+D W 
Sbjct: 172 TWLFDCVERKFNKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWC 231

Query: 225 FDITTYKWKQVEFPSNHQVPDARSGHSFIPTAEGAILWGGYCKVKA-NKKGYQKGKILSD 283
           FDI+ YKW ++E  S    PDARSGH FIPT   AIL GGYCK  A N K   KGKIL+D
Sbjct: 232 FDISNYKWSKIETNSK---PDARSGHCFIPTDNSAILMGGYCKTIAKNNKNLMKGKILND 288

Query: 284 CWYLKMKSDISGIRWERRRKQGFQPSPRVGCSM-AYHKGRGILFGGVYDFEETEESLESN 342
            W L +  D    +WE+ +    QPSPRVG S   + + + + FGGVYD +ETEESLES 
Sbjct: 289 AWKLNLTPDPKKWQWEKLKNFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLESV 348

Query: 343 FFNDLFSYHIESNRWYSLSIRSRK--SNNNAVAKKSGKNSKEQEKELKMLLDSILEKANL 400
           F+NDL+ +H+E N+W  L I+S++  SN N+ A    K++K+QEKEL+ LL+SIL K+NL
Sbjct: 349 FYNDLYMFHLELNKWSKLRIKSQRQTSNRNSPATSKRKSNKDQEKELQDLLNSILAKSNL 408

Query: 401 QDKSXXXXXXXXINTALAKVDLEDEEEEQLAVQH--TILTQLPHPRFNATTTVIDDTLFI 458
            D            +     D ++E++  L  Q   TI  QLPHPRFNA T V+ D+LFI
Sbjct: 409 NDDDDENDDYTATGSNSIDGDEDEEDDSDLDNQEDITISNQLPHPRFNAATCVVGDSLFI 468

Query: 459 FGGIWELGDKEFMIDSLYSIDLNKLDGVTMYWEDLKEIERAKELG--VXXXXXXXXXXXX 516
           + G+WELG+K++ I+S YSIDLNKLDGV +YWE+L  IE AK LG               
Sbjct: 469 YSGVWELGEKDYPINSFYSIDLNKLDGVKVYWEELSAIEEAKRLGDRDSDEEEFEYEDEE 528

Query: 517 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYPDPRPWLPHPKPFETLRAFYIREGA 576
                                              PD R WLPHPKPFETLRAFY+REGA
Sbjct: 529 DDEDQSEEEQDAGLLESDEDEESDDEDDGQAQMEIPDERSWLPHPKPFETLRAFYLREGA 588

Query: 577 AFLEWAISNNKNAKGKHLKKHSFDLCQERWWERRDQLRIEEDKLEEIGGVGDIIERD-KS 635
            FL W+ISNN+N KGK LK  SF+LC++RWWERRDQ+ +EE++LE+ GG   IIERD  +
Sbjct: 589 NFLTWSISNNRNLKGKQLKTKSFELCEDRWWERRDQVTLEEERLEDTGG---IIERDVTT 645

Query: 636 ASSKRR 641
             SKRR
Sbjct: 646 KPSKRR 651

>Kpol_1050.69 s1050 complement(150301..153555) [3255 bp, 1084 aa]
           {ON} complement(150301..153555) [3255 nt, 1085 aa]
          Length = 1084

 Score = 65.9 bits (159), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 56/204 (27%), Positives = 85/204 (41%), Gaps = 33/204 (16%)

Query: 166 YSDTWILDCN--TKEWAKVDAKVG---PSARSGHRITVWKNFFILHGG-FRDLGTSTTYL 219
           Y DTWI+ CN    +++     +G   P  R GH  T+  N FI+ GG    +       
Sbjct: 178 YGDTWIISCNPDATQFSSKSVDIGENTPPPRVGHAATLCGNAFIVFGGDTHKVNKEGLMD 237

Query: 220 SDCWLFDITTYKWKQVEFPSNHQVPDARSGHSFIPTAEGAILWGGYCKVKANKKGYQKGK 279
            D +LF+I +YKW  +  P   + P  R GH         IL     K K     Y  G 
Sbjct: 238 DDIYLFNINSYKW-TIPNPIGPR-PLGRYGHKI------CILATSTVKTKL----YLFGG 285

Query: 280 ILSDCWYLKMKS-DISGIR-----WERRRKQGFQPSPRVGCSMAYHKGRGILFGGVYDFE 333
              D ++  +   D+S  R     WE  + +GF P P    +M  +     ++GG     
Sbjct: 286 QFDDTYFNDLAVFDLSSFRRQDSHWEFIKSKGFMPPPLTNHTMVTYGSDLWIYGG----- 340

Query: 334 ETEESLESNFFNDLFSYHIESNRW 357
           +T++ L     ND+F +   +N W
Sbjct: 341 DTQQGL----INDIFKFSPNTNTW 360

>ZYRO0B08228g Chr2 (641988..645869) [3882 bp, 1293 aa] {ON} similar
           to uniprot|Q75AR9 Ashbya gossypii ADL149W ADL149Wp and
           some similarites with YHR158C uniprot|P38853
           Saccharomyces cerevisiae YHR158C KEL1 Protein required
           for proper cell fusion and cell morphology functions in
           a complex with Kel2p to negatively regulate mitotic exit
           interacts with Tem1p and Lte1p localizes to regions of
           polarized growth potential Cdc28p substrate
          Length = 1293

 Score = 57.4 bits (137), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 53/204 (25%), Positives = 84/204 (41%), Gaps = 33/204 (16%)

Query: 166 YSDTWILDCN---TKEWAKVD--AKVGPSARSGHRITVWKNFFILHGG-FRDLGTSTTYL 219
           Y DTWI+  N   T+  +K    ++  P  R GH  T+  N F+L GG    + +     
Sbjct: 180 YGDTWIISTNDNGTQFQSKTVEISETTPPPRVGHAATLCGNAFVLFGGDTHKVNSEGLMD 239

Query: 220 SDCWLFDITTYKWKQVEFPSNHQVPDARSGHSFIPTAEGAILWGGYCKVKANKKGYQKGK 279
            D +LF++ +YKW  +  P   + P  R GH        +I+     K K     Y  G 
Sbjct: 240 DDLYLFNVNSYKWT-IPHPIGPR-PLGRYGHKI------SIMAANQMKTKL----YLFGG 287

Query: 280 ILSDCWYLKMKS-DISGIR-----WERRRKQGFQPSPRVGCSMAYHKGRGILFGGVYDFE 333
              D ++  +   D+S  R     WE  +   F P P    +M  +     +FGG     
Sbjct: 288 QFDDTYFNDLAVFDLSSFRRPDSHWEFLKPTTFSPPPLTNHTMISYDNHLWVFGG----- 342

Query: 334 ETEESLESNFFNDLFSYHIESNRW 357
              ++L+    N +F Y + +N W
Sbjct: 343 ---DTLQG-LINQVFKYDVANNDW 362

>TDEL0G01120 Chr7 (229805..232834) [3030 bp, 1009 aa] {ON} Anc_5.88
           YGR238C
          Length = 1009

 Score = 56.2 bits (134), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 57/204 (27%), Positives = 88/204 (43%), Gaps = 33/204 (16%)

Query: 166 YSDTWIL---DCNTKEWAK-VD-AKVGPSARSGHRITVWKNFFILHGG-FRDLGTSTTYL 219
           Y DTWI+   D  T+  +K VD ++  P  R GH  T+  N F++ GG    + +     
Sbjct: 133 YGDTWIINVDDSGTQFSSKTVDISEFTPPPRVGHAATLCGNAFVIFGGDTHKVNSEGLMD 192

Query: 220 SDCWLFDITTYKWKQVEFPSNHQVPDARSGHSFIPTAEGAILWGGYCKVKANKKGYQKGK 279
            D +LF+I ++KW  +  P   + P  R GH        +I+     K K     Y  G 
Sbjct: 193 DDLYLFNINSFKWT-IPHPVGPR-PLGRYGHKI------SIIATNQMKTKL----YLFGG 240

Query: 280 ILSDCWYLKMKS-DISGIR-----WERRRKQGFQPSPRVGCSMAYHKGRGILFGGVYDFE 333
              D ++  +   D+S  R     WE  + + F P P    +M  +  +  +FGG     
Sbjct: 241 QFDDTFFNDLAVYDLSSFRRSDSHWEFLKPKTFVPPPLANHTMVSYDHKLWIFGG----- 295

Query: 334 ETEESLESNFFNDLFSYHIESNRW 357
           +T + L     N +F Y I SN W
Sbjct: 296 DTMQGL----INKVFVYDIMSNDW 315

>SAKL0H02618g Chr8 (259684..262941) [3258 bp, 1085 aa] {ON} similar
           to uniprot|P38853 Saccharomyces cerevisiae YHR158C KEL1
           Protein required for proper cell fusion and cell
           morphology functions in a complex with Kel2p to
           negatively regulate mitotic exit interacts with Tem1p
           and Lte1p localizes to regions of polarized growth
           potential Cdc28p substrate
          Length = 1085

 Score = 56.2 bits (134), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 57/204 (27%), Positives = 85/204 (41%), Gaps = 33/204 (16%)

Query: 166 YSDTWILDC---NTKEWAK-VD-AKVGPSARSGHRITVWKNFFILHGG-FRDLGTSTTYL 219
           Y DTWIL     NT+  +K VD +   P  R GH  T+  N F++ GG    +       
Sbjct: 112 YGDTWILTAHANNTRFTSKTVDISDTTPPPRVGHASTLCGNAFVIFGGDTHKVNNEGLMD 171

Query: 220 SDCWLFDITTYKWKQVEFPSNHQVPDARSGHSFIPTAEGAILWGGYCKVKANKKGYQKGK 279
            D +LF+I +YKW  +  P   + P  R GH        +++     K K     Y  G 
Sbjct: 172 DDVYLFNINSYKWT-IPHPVGPR-PLGRYGHKI------SVIATSQMKTKL----YVFGG 219

Query: 280 ILSDCWYLKM-KSDISGIR-----WERRRKQGFQPSPRVGCSMAYHKGRGILFGGVYDFE 333
              D ++  +   D+S  R     WE  + Q F P P    +M  +  +  +FGG     
Sbjct: 220 QFDDTYFNDLCVYDLSSFRRPDSHWEFLKPQSFVPPPLTNHTMVSYDYKLWIFGG----- 274

Query: 334 ETEESLESNFFNDLFSYHIESNRW 357
           +T + L     N++F Y    N W
Sbjct: 275 DTAQGL----INEVFMYDPTVNDW 294

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 41/173 (23%), Positives = 71/173 (41%), Gaps = 22/173 (12%)

Query: 84  SASSSKKELIVFGGEFTNPQTSTTTFYN-----DLHTFTPENNQWKRYTSQNXXXXXXXX 138
           + S  K +L VFGG+F +      T++N     DL +F   ++ W+    Q+        
Sbjct: 206 ATSQMKTKLYVFGGQFDD------TYFNDLCVYDLSSFRRPDSHWEFLKPQSFVPPPLTN 259

Query: 139 XXXXXXXGIALLHGGEFSSPKQNTFYHYSDTWILDCNTKEWAKVDAK-VGPSARSGHRIT 197
                      + GG+ +    N  + Y      D    +W  V+     P A   H   
Sbjct: 260 HTMVSYDYKLWIFGGDTAQGLINEVFMY------DPTVNDWTVVETTGSKPPAIQEHAAV 313

Query: 198 VWKNFFILHGGFRDLGTSTTYLSDCWLFDITTYKWKQVEFPSNHQVPDARSGH 250
           V+K+   + GG  +     +Y +D +  ++ ++KW ++ F  N  VP  RSGH
Sbjct: 314 VYKDLMCVTGGKDE---QDSYSNDVYFLNLKSFKWFKLPFFKN-GVPQGRSGH 362

>Skud_8.222 Chr8 complement(385114..388623) [3510 bp, 1169 aa] {ON}
           YHR158C (REAL)
          Length = 1169

 Score = 55.1 bits (131), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 56/213 (26%), Positives = 85/213 (39%), Gaps = 33/213 (15%)

Query: 166 YSDTWIL---DCNTK-EWAKVD-AKVGPSARSGHRITVWKNFFILHGG-FRDLGTSTTYL 219
           Y DTWIL   D  TK     +D ++  P  R GH   +  N F++ GG    +       
Sbjct: 152 YGDTWILTALDNATKFSTTTIDISEATPPPRVGHAAVLCGNAFVVFGGDTHKVNKEGLMD 211

Query: 220 SDCWLFDITTYKWKQVEFPSNHQVPDARSGHSFIPTAEGAILWGGYCKVKANKKGYQKGK 279
            D +L +I +YKW  V  P   + P  R GH        +I+     K K     Y  G 
Sbjct: 212 DDIYLLNINSYKWT-VPAPVGPR-PLGRYGHKI------SIIATTQMKTKL----YVFGG 259

Query: 280 ILSDCWYLKMKS-DISGIR-----WERRRKQGFQPSPRVGCSMAYHKGRGILFGGVYDFE 333
              D ++  +   D+S  R     WE  + + F P P    +M  +  +  +FGG     
Sbjct: 260 QFDDTYFNDLAVYDLSSFRRPDSHWEFLKPKAFTPPPITNFTMISYDSKLWVFGG----- 314

Query: 334 ETEESLESNFFNDLFSYHIESNRWYSLSIRSRK 366
              ++L+    ND+F Y    N W+ +     K
Sbjct: 315 ---DTLQG-LINDVFMYDPAINDWFIIETTGEK 343

 Score = 32.3 bits (72), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 46/220 (20%), Positives = 82/220 (37%), Gaps = 24/220 (10%)

Query: 89  KKELIVFGGEFTNPQTSTTTFYNDLHTFTPENNQWKRYTSQNXXXXXXXXXXXXXXXGIA 148
           K +L VFGG+F +   +    Y DL +F   ++ W+    +                   
Sbjct: 251 KTKLYVFGGQFDDTYFNDLAVY-DLSSFRRPDSHWEFLKPKAFTPPPITNFTMISYDSKL 309

Query: 149 LLHGGEFSSPKQNTFYHYSDTWILDCNTKEWAKVDAK-VGPSARSGHRITVWKNFFILHG 207
            + GG+      N      D ++ D    +W  ++     P     H   V+ +   + G
Sbjct: 310 WVFGGDTLQGLIN------DVFMYDPAINDWFIIETTGEKPPPVQEHASVVYNDLMCVVG 363

Query: 208 GFRDLGTSTTYLSDCWLFDITTYKW-KQVEFPSNHQVPDARSGHSFIPTAEGAILWGG-- 264
           G  +      YL+  +  ++ ++KW K   F +   +P  RSGHS     +  IL  G  
Sbjct: 364 GKDE---HDAYLNSVYFLNLKSHKWFKLPVFTAG--IPQGRSGHSLTLLKDDKILIMGGD 418

Query: 265 ---YCKVK-----ANKKGYQKGKILSDCWYLKMKSDISGI 296
              Y +V+      +    Q+G I+      ++K    GI
Sbjct: 419 KFDYARVEEFDLHTSDIDLQRGTIVYTLDLARIKDLCPGI 458

>Suva_15.357 Chr15 complement(617637..618952,619001..621203) [3519
           bp, 1172 aa] {ON} YHR158C (REAL)
          Length = 1172

 Score = 54.7 bits (130), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 52/213 (24%), Positives = 83/213 (38%), Gaps = 33/213 (15%)

Query: 166 YSDTWIL----DCNTKEWAKVD-AKVGPSARSGHRITVWKNFFILHGG-FRDLGTSTTYL 219
           Y DTWIL    D        +D ++  P  R GH   +  N F++ GG    +       
Sbjct: 152 YGDTWILSAFDDATKFSTTTIDISEATPPPRVGHAAVLCGNAFVVFGGDTHKVNREGLMD 211

Query: 220 SDCWLFDITTYKWKQVEFPSNHQVPDARSGHSFIPTAEGAILWGGYCKVKANKKGYQKGK 279
            D +L ++ +YKW  V  P   + P  R GH        +I+     K K     Y  G 
Sbjct: 212 DDIYLLNVNSYKWT-VPAPVGPR-PLGRYGHKI------SIIATTQMKTKL----YVFGG 259

Query: 280 ILSDCWYLKMKS-DISGIR-----WERRRKQGFQPSPRVGCSMAYHKGRGILFGGVYDFE 333
              D ++  +   D+S  R     W+  +   F P P    +M  +  +  +FGG     
Sbjct: 260 QFDDTYFNDLAVYDLSSFRRPDSHWDFLKPMTFTPPPMTNFTMISYDSKLWVFGG----- 314

Query: 334 ETEESLESNFFNDLFSYHIESNRWYSLSIRSRK 366
              ++L+    ND+F Y    N W+++     K
Sbjct: 315 ---DTLQG-LINDVFMYDPAKNDWFTIETSGEK 343

 Score = 32.0 bits (71), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 36/177 (20%), Positives = 64/177 (36%), Gaps = 12/177 (6%)

Query: 89  KKELIVFGGEFTNPQTSTTTFYNDLHTFTPENNQWKRYTSQNXXXXXXXXXXXXXXXGIA 148
           K +L VFGG+F +   +    Y DL +F   ++ W                         
Sbjct: 251 KTKLYVFGGQFDDTYFNDLAVY-DLSSFRRPDSHWDFLKPMTFTPPPMTNFTMISYDSKL 309

Query: 149 LLHGGEFSSPKQNTFYHYSDTWILDCNTKEWAKVDAK-VGPSARSGHRITVWKNFFILHG 207
            + GG+      N      D ++ D    +W  ++     P     H   V+ +   + G
Sbjct: 310 WVFGGDTLQGLIN------DVFMYDPAKNDWFTIETSGEKPPPVQEHATVVYNDLMCVVG 363

Query: 208 GFRDLGTSTTYLSDCWLFDITTYKWKQVEFPSNHQVPDARSGHSFIPTAEGAILWGG 264
           G  +      YL+  +  ++ T+KW ++   +   +P  RSGHS        +L  G
Sbjct: 364 GKDE---HDAYLNTVYFLNLKTHKWFKLPIFA-AGIPQGRSGHSLTLLKNDKVLIMG 416

>KAFR0B04320 Chr2 complement(893930..896890) [2961 bp, 986 aa] {ON}
           Anc_5.88 YGR238C
          Length = 986

 Score = 54.7 bits (130), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 57/217 (26%), Positives = 83/217 (38%), Gaps = 31/217 (14%)

Query: 166 YSDTWILDCNTKEWAKVDAKVG-----PSARSGHRITVWKNFFILHGG-FRDLGTSTTYL 219
           Y DTWIL         +   V      P  R GH  T+  N FI+ GG    +       
Sbjct: 173 YGDTWILTSENNASRFISQTVDISDNTPPPRVGHAATLCGNAFIIFGGDTHKVNKDGLMD 232

Query: 220 SDCWLFDITTYKWKQVEFPSNHQVPDARSGH--SFIPTAEGAI---LWGGYCKVKANKKG 274
            D +LF+I ++KW  +  P   + P  R GH  S I TA       L+GG          
Sbjct: 233 DDLYLFNINSHKWT-IPNPVGPR-PLGRYGHKISIIATANSKTRLYLFGGQF-----DDA 285

Query: 275 YQKGKILSDCWYLKMKSDISGIRWERRRKQGFQPSPRVGCSMAYHKGRGILFGGVYDFEE 334
           Y    ++ D    +        RWE  + + F P P    +M  +  +  +FGG      
Sbjct: 286 YFNDLVVFDLSSFRRPDS----RWEFVKPKSFVPPPLTNHTMVSYDNKLWVFGG------ 335

Query: 335 TEESLESNFFNDLFSYHIESNRWYSLSIRSRKSNNNA 371
             ++L+    N +F Y    N W ++   S   NN A
Sbjct: 336 --DTLQG-LTNRVFMYDPMINDWTTIETSSDNPNNIA 369

 Score = 39.3 bits (90), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 40/183 (21%), Positives = 72/183 (39%), Gaps = 10/183 (5%)

Query: 84  SASSSKKELIVFGGEFTNPQTSTTTFYNDLHTFTPENNQWKRYTSQNXXXXXXXXXXXXX 143
           + ++SK  L +FGG+F +   +    + DL +F   +++W+    ++             
Sbjct: 267 ATANSKTRLYLFGGQFDDAYFNDLVVF-DLSSFRRPDSRWEFVKPKSFVPPPLTNHTMVS 325

Query: 144 XXGIALLHGGEFSSPKQNTFYHYSDTWILDCNTKEWAKVDAKVGPSARSGHRITVWKNFF 203
                 + GG+      N  + Y D  I D  T E +  +          H   V+K+  
Sbjct: 326 YDNKLWVFGGDTLQGLTNRVFMY-DPMINDWTTIETSSDNPNNIAPPMQEHAAIVYKDLM 384

Query: 204 ILHGGFRDLGTSTTYLSDCWLFDITTYKWKQVEF--PSNHQVPDARSGHSFIPTAEGAIL 261
            + GG  +     TYL+  +  ++ T KW ++    P    +P  RSGHS        +L
Sbjct: 385 CIFGGKDE---QDTYLNGVYFLNLRTLKWYKLPIFAPG---IPQGRSGHSITLLKNDKLL 438

Query: 262 WGG 264
             G
Sbjct: 439 IMG 441

>Smik_8.242 Chr8 complement(390631..394137) [3507 bp, 1168 aa] {ON}
           YHR158C (REAL)
          Length = 1168

 Score = 54.3 bits (129), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 56/213 (26%), Positives = 85/213 (39%), Gaps = 33/213 (15%)

Query: 166 YSDTWIL---DCNTK-EWAKVD-AKVGPSARSGHRITVWKNFFILHGG-FRDLGTSTTYL 219
           Y DTWIL   D  TK     +D ++  P  R GH   +  N F++ GG    +       
Sbjct: 152 YGDTWILTAFDNATKFSTTTIDISEATPPPRVGHAAVLCGNAFVVFGGDTHKVNKEGLMD 211

Query: 220 SDCWLFDITTYKWKQVEFPSNHQVPDARSGHSFIPTAEGAILWGGYCKVKANKKGYQKGK 279
            D +L +I +YKW  V  P   + P  R GH        +I+     K K     Y  G 
Sbjct: 212 DDIYLLNINSYKWT-VPAPVGPR-PLGRYGHKI------SIIATNQMKTKL----YVFGG 259

Query: 280 ILSDCWYLKMKS-DISGIR-----WERRRKQGFQPSPRVGCSMAYHKGRGILFGGVYDFE 333
              D ++  +   D+S  R     WE  + + F P P    +M  +  +  +FGG     
Sbjct: 260 QFDDTYFNDLAVYDLSSFRRPDSHWEFLKPKTFSPPPITNFTMISYDSKLWVFGG----- 314

Query: 334 ETEESLESNFFNDLFSYHIESNRWYSLSIRSRK 366
              ++L+    ND+F Y    N W+ +     K
Sbjct: 315 ---DTLQG-LVNDVFMYDPALNDWFIIETTGEK 343

>NDAI0D02600 Chr4 complement(600880..604383) [3504 bp, 1167 aa] {ON}
           Anc_5.88 YGR238C
          Length = 1167

 Score = 53.9 bits (128), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 60/222 (27%), Positives = 89/222 (40%), Gaps = 38/222 (17%)

Query: 166 YSDTWILD------CNTKEWAKVD-AKVGPSARSGHRITVWKNFFILHGG-FRDLGTSTT 217
           Y DTWIL         T     VD ++  P  R GH  T+  N F++ GG    +    +
Sbjct: 199 YGDTWILSYENNGLSTTITSKTVDISENTPPPRVGHAATLCGNAFVIFGGDTHKVNKDGS 258

Query: 218 YLSDCWLFDITTYKWKQVEFPSNHQVPDARSGHSFIPTAEGAILWGGYCKVKANKKGYQK 277
              D +LF+I +YKW  +  P   Q P  R GH        +I+     K K     Y  
Sbjct: 259 MDDDIYLFNINSYKW-TIPKPVG-QRPLGRYGHKI------SIIATSQMKTKL----YLF 306

Query: 278 GKILSDCWYLKMKS-DISGIR-----WERRRKQGFQPSPRVGCSMAYHKGRGILFGGVYD 331
           G    D ++  +   D+S  R     WE  R + F P P    +M  +  +  +FGG   
Sbjct: 307 GGQFDDTYFNDLVVFDLSSFRRPDSHWEFIRPKSFIPPPLTNHTMCSYDHKLWVFGG--- 363

Query: 332 FEETEESLESNFFNDLFSYHIESNRWYSLSIRSRKSNNNAVA 373
                ++L+    N +F Y    N W    +    +NNN V+
Sbjct: 364 -----DTLQG-LTNQVFMYDPVDNDW---CVVETFANNNDVS 396

 Score = 38.5 bits (88), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 44/190 (23%), Positives = 74/190 (38%), Gaps = 22/190 (11%)

Query: 84  SASSSKKELIVFGGEFTNPQTSTTTFYNDL-----HTFTPENNQWKRYTSQNXXXXXXXX 138
           + S  K +L +FGG+F +      T++NDL      +F   ++ W+    ++        
Sbjct: 295 ATSQMKTKLYLFGGQFDD------TYFNDLVVFDLSSFRRPDSHWEFIRPKSFIPPPLTN 348

Query: 139 XXXXXXXGIALLHGGEFSSPKQNTFYHYS---DTWILDCNTKEWAKV-DAKVGPSARSGH 194
                      + GG+      N  + Y    + W   C  + +A   D    P     H
Sbjct: 349 HTMCSYDHKLWVFGGDTLQGLTNQVFMYDPVDNDW---CVVETFANNNDVSNIPPPIQEH 405

Query: 195 RITVWKNFFILHGGFRDLGTSTTYLSDCWLFDITTYKWKQVEFPSNHQVPDARSGHSFIP 254
              ++K+   + GG  +   S  YL+D +  ++ T KW ++ F     VP  RSGHS   
Sbjct: 406 AAVLYKDLMCVIGGKDE---SDNYLNDVYFLNLKTLKWFKLPF-YKEGVPQGRSGHSVTL 461

Query: 255 TAEGAILWGG 264
                IL  G
Sbjct: 462 LKNDKILIMG 471

>NCAS0F00520 Chr6 (100048..103308) [3261 bp, 1086 aa] {ON} Anc_5.88
           YGR238C
          Length = 1086

 Score = 53.5 bits (127), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 53/206 (25%), Positives = 83/206 (40%), Gaps = 35/206 (16%)

Query: 166 YSDTWILDCNTKEWAK------VD-AKVGPSARSGHRITVWKNFFILHGGFRDLGTSTTY 218
           Y DTW+L C   + +       VD  +  P  R GH  T+  N F++ GG          
Sbjct: 170 YGDTWVLTCEDPQTSTMFSSRTVDITETTPPPRVGHASTLCGNAFVIFGGDTHKKNEMGE 229

Query: 219 L-SDCWLFDITTYKWKQVEFPSNHQVPDARSGHSFIPTAEGAILWGGYCKVKANKKGYQK 277
           +  D +LF+I +YKW  +  P   + P  R GH        +I+     + +   K Y  
Sbjct: 230 MDDDIYLFNINSYKWT-IPHPIGPR-PKGRYGHKI------SII----ARKQMQTKLYLF 277

Query: 278 GKILSDCWYLKMKS-DISGIR-----WERRRKQGFQPSPRVGCSMAYHKGRGILFGGVYD 331
           G    D ++  +   D+S  R     WE  + + F P P    +M  +  +  +FGG   
Sbjct: 278 GGQFDDNYFNDLVVFDLSSFRRDDSHWEFIKPRSFIPPPITNHTMVSYDFKLWVFGG--- 334

Query: 332 FEETEESLESNFFNDLFSYHIESNRW 357
                ++LE    N +F Y    N W
Sbjct: 335 -----DTLEG-LLNQVFMYDPAVNDW 354

>YHR158C Chr8 complement(413685..417179) [3495 bp, 1164 aa] {ON}
           KEL1Protein required for proper cell fusion and cell
           morphology; functions in a complex with Kel2p to
           negatively regulate mitotic exit, interacts with Tem1p
           and Lte1p; localizes to regions of polarized growth;
           potential Cdc28p substrate
          Length = 1164

 Score = 53.1 bits (126), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 53/213 (24%), Positives = 82/213 (38%), Gaps = 33/213 (15%)

Query: 166 YSDTWILDC--NTKEWAKVDAKVG---PSARSGHRITVWKNFFILHGG-FRDLGTSTTYL 219
           Y DTWIL    N   ++     +    P  R GH   +  N F++ GG    +       
Sbjct: 152 YGDTWILTAFDNATRFSTTTIDISEATPPPRVGHAAVLCGNAFVVFGGDTHKVNKEGLMD 211

Query: 220 SDCWLFDITTYKWKQVEFPSNHQVPDARSGHSFIPTAEGAILWGGYCKVKANKKGYQKGK 279
            D +L +I +YKW  V  P   + P  R GH        +I+     K K     Y  G 
Sbjct: 212 DDIYLLNINSYKWT-VPAPVGPR-PLGRYGHKI------SIIATTQMKTKL----YVFGG 259

Query: 280 ILSDCWYLKMKS-DISGIR-----WERRRKQGFQPSPRVGCSMAYHKGRGILFGGVYDFE 333
              D ++  +   D+S  R     WE  + + F P P    +M  +  +  +FGG     
Sbjct: 260 QFDDTYFNDLAVYDLSSFRRPDSHWEFLKPRTFTPPPITNFTMISYDSKLWVFGG----- 314

Query: 334 ETEESLESNFFNDLFSYHIESNRWYSLSIRSRK 366
              ++L+    ND+F Y    N W+ +     K
Sbjct: 315 ---DTLQG-LVNDVFMYDPAINDWFIIDTTGEK 343

 Score = 33.1 bits (74), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 46/225 (20%), Positives = 82/225 (36%), Gaps = 24/225 (10%)

Query: 84  SASSSKKELIVFGGEFTNPQTSTTTFYNDLHTFTPENNQWKRYTSQNXXXXXXXXXXXXX 143
           + +  K +L VFGG+F +   +    Y DL +F   ++ W+    +              
Sbjct: 246 ATTQMKTKLYVFGGQFDDTYFNDLAVY-DLSSFRRPDSHWEFLKPRTFTPPPITNFTMIS 304

Query: 144 XXGIALLHGGEFSSPKQNTFYHYSDTWILDCNTKEWAKVDAK-VGPSARSGHRITVWKNF 202
                 + GG+      N      D ++ D    +W  +D     P     H   V+ + 
Sbjct: 305 YDSKLWVFGGDTLQGLVN------DVFMYDPAINDWFIIDTTGEKPPPVQEHATVVYNDL 358

Query: 203 FILHGGFRDLGTSTTYLSDCWLFDITTYKW-KQVEFPSNHQVPDARSGHSFIPTAEGAIL 261
             + GG  +      YL+  +  ++ + KW K   F +   +P  RSGHS        IL
Sbjct: 359 MCVVGGKDE---HDAYLNSVYFLNLKSRKWFKLPVFTAG--IPQGRSGHSLTLLKNDKIL 413

Query: 262 WGG-----YCKVK-----ANKKGYQKGKILSDCWYLKMKSDISGI 296
             G     Y +V+      +    Q+G I+      ++K    G+
Sbjct: 414 IMGGDKFDYARVEEYDLHTSDIDMQRGTIVYTLDLARIKDLCPGV 458

>CAGL0I02090g Chr9 complement(177324..180734) [3411 bp, 1136 aa]
           {ON} some similarities with uniprot|P38853 Saccharomyces
           cerevisiae YHR158c KEL1 involved in cell fusion and
           morphology
          Length = 1136

 Score = 52.0 bits (123), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 50/209 (23%), Positives = 81/209 (38%), Gaps = 39/209 (18%)

Query: 166 YSDTWILDC---------NTKEWAKVD-AKVGPSARSGHRITVWKNFFILHGG-FRDLGT 214
           Y DTWIL           N+ +   ++  +  P  R GH  T+  N F++ GG    + +
Sbjct: 186 YGDTWILTASDIDKTGAINSFKSTTIEITESTPPPRVGHASTLCGNAFVVFGGDTHKVNS 245

Query: 215 STTYLSDCWLFDITTYKWKQVEFPSNHQVPDARSGHSFIPTAEGAILWGGYCKVKANKKG 274
                 D +L +I +YKW  +  P   Q P  R GH  +  +                K 
Sbjct: 246 DGLMDDDLYLLNINSYKWT-IPKPVG-QRPLGRYGHKIVTIS------------AEQTKL 291

Query: 275 YQKGKILSDCWYLKMKS-DISGIR-----WERRRKQGFQPSPRVGCSMAYHKGRGILFGG 328
           Y  G    D ++  +   D+S  R     W   +  GF P P    +M  ++ +  +FGG
Sbjct: 292 YLFGGQFDDTYFGDLAVFDLSSFRRPDSHWVFLKPSGFNPPPLTNHTMVTYQDKIWVFGG 351

Query: 329 VYDFEETEESLESNFFNDLFSYHIESNRW 357
                   ++LE    N ++ Y   +N W
Sbjct: 352 --------DTLEEGLINRVYLYSPTNNSW 372

>KLLA0E15511g Chr5 (1388626..1391343) [2718 bp, 905 aa] {ON} similar
           to uniprot|P50090 Saccharomyces cerevisiae YGR238C KEL2
           Protein that functions in a complex with Kel1p to
           negatively regulate mitotic exit interacts with Tem1p
           and Lte1p localizes to regions of polarized growth
           potential Cdc28p substrate AND similar to YHR158C
           uniprot|P38853 Saccharomyces cerevisiae YHR158C KEL1
           Protein required for proper cell fusion and cell
           morphology functions in a complex with Kel2p to
           negatively regulate mitotic exit interacts with Tem1p
           and Lte1p localizes to regions of polarized growth
           potential Cdc28p substrate
          Length = 905

 Score = 50.4 bits (119), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 50/204 (24%), Positives = 81/204 (39%), Gaps = 33/204 (16%)

Query: 166 YSDTWILDC--NTKEWAKVDAKVG---PSARSGHRITVWKNFFILHGG-FRDLGTSTTYL 219
           Y DTWI+    N   +  +   +    P  R GH  T+  N F++ GG    +  +    
Sbjct: 132 YGDTWIIKSLDNATSFKSITVPIADATPPPRVGHASTLCGNAFVIFGGDTHKVNDAGLMD 191

Query: 220 SDCWLFDITTYKWKQVEFPSNHQVPDARSGHSFIPTAEGAILWGGYCKVKANKKGYQKGK 279
            D +LF+I ++KW  +  P   + P  R GH        +I+     K K     Y  G 
Sbjct: 192 DDIYLFNINSHKWT-IPTPQGPR-PLGRYGHKI------SIIAANQMKTKL----YVFGG 239

Query: 280 ILSDCWYLKMKS-DISGIR-----WERRRKQGFQPSPRVGCSMAYHKGRGILFGGVYDFE 333
              D ++  +   D+S  R     WE  +   F P P    +M     +  +FGG     
Sbjct: 240 QFDDTYFNDLAEFDLSSFRRSDSHWEFIKPATFMPPPLANHTMISFDHKLWVFGG----- 294

Query: 334 ETEESLESNFFNDLFSYHIESNRW 357
           +T + L     N++F +   +N W
Sbjct: 295 DTPQGLT----NEVFMFDPAANDW 314

 Score = 35.8 bits (81), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 40/188 (21%), Positives = 76/188 (40%), Gaps = 24/188 (12%)

Query: 84  SASSSKKELIVFGGEFTNPQTSTTTFYNDL-----HTFTPENNQWKRYTSQNXXXXXXXX 138
           +A+  K +L VFGG+F +      T++NDL      +F   ++ W+              
Sbjct: 226 AANQMKTKLYVFGGQFDD------TYFNDLAEFDLSSFRRSDSHWEFIKPATFMPPPLAN 279

Query: 139 XXXXXXXGIALLHGGEFSSPKQNTFYHYSDTWILDCNTKEWAKVDAKVG-PSARSGHRIT 197
                      + GG+  +P+  T    ++ ++ D    +W  V      P     H   
Sbjct: 280 HTMISFDHKLWVFGGD--TPQGLT----NEVFMFDPAANDWCVVQTTGNIPPPLQEHAAI 333

Query: 198 VWKNFFILHGGFRDLGTSTTYLSDCWLFDITTYKWKQVEFPS-NHQVPDARSGHSFIPTA 256
           ++++   + GG +D      Y +  +  +  + KW   + P+ N+ +P ARSGHS    +
Sbjct: 334 IYRDLMCVFGG-KD--AQDNYSNAVYFLNFRSLKW--FKLPTFNNMIPRARSGHSLTLLS 388

Query: 257 EGAILWGG 264
              +L  G
Sbjct: 389 NNKLLIMG 396

>KNAG0K00560 Chr11 complement(96678..99992) [3315 bp, 1104 aa] {ON}
           Anc_5.88 YGR238C
          Length = 1104

 Score = 50.1 bits (118), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 50/204 (24%), Positives = 81/204 (39%), Gaps = 33/204 (16%)

Query: 166 YSDTWILDC--NTKEWAKVDAKVG---PSARSGHRITVWKNFFILHGG-FRDLGTSTTYL 219
           + D WI+    N  ++      +    P  R GH  T+  N F++ GG    +       
Sbjct: 236 FGDVWIIKSLENGTKFTSTTIDITENTPPPRVGHAATLCGNAFVVFGGDTHKVNKDGLMD 295

Query: 220 SDCWLFDITTYKWKQVEFPSNHQVPDARSGHSFIPTAEGAILWGGYCKVKANKKGYQKGK 279
            D +LF+I +YKW  +  P   + P  R GH        +I+     K K     Y  G 
Sbjct: 296 DDLYLFNINSYKWT-IPNPIGPR-PLGRYGHKV------SIIATTPMKTKL----YLFGG 343

Query: 280 ILSDCWYLKMKS-DISGIR-----WERRRKQGFQPSPRVGCSMAYHKGRGILFGGVYDFE 333
              D ++  +   D+S  R     WE  + + F P P    +M  ++ +  +FGG     
Sbjct: 344 QFDDTYFNNLAVFDLSQFRRPDSHWEFLKPKSFMPPPLTNHTMVSYQNKLWIFGG----- 398

Query: 334 ETEESLESNFFNDLFSYHIESNRW 357
              ++L+    N +F Y  E N W
Sbjct: 399 ---DTLQG-LINKIFMYDPEVNDW 418

 Score = 32.3 bits (72), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 36/145 (24%), Positives = 56/145 (38%), Gaps = 20/145 (13%)

Query: 73  KRLNPCMVGNPSASSSKKELIVFGGEFTNPQTSTTTFYNDLHTFTPENNQWKRYTS---- 128
           K   P  + N +  S + +L +FGG+      +     N +  + PE N W    +    
Sbjct: 374 KSFMPPPLTNHTMVSYQNKLWIFGGD------TLQGLINKIFMYDPEVNDWTVVETFPAN 427

Query: 129 --QNXXXXXXXXXXXXXXXGIALLHGGEFSSPKQNTFYHYSDTWILDCNTKEWAKVD-AK 185
             Q                 + ++ GG     K     + +  + L  NT EW K+    
Sbjct: 428 NDQENFPPPMQEHASVMYGDLMVVMGG-----KDEQDNYLNTVYFLKINTLEWYKLPFLS 482

Query: 186 VG-PSARSGHRITVWK-NFFILHGG 208
           VG P  RSGH IT+ K N  ++ GG
Sbjct: 483 VGIPQGRSGHSITLLKGNKLLIMGG 507

>KLTH0C01474g Chr3 (131243..134413) [3171 bp, 1056 aa] {ON} similar
           to uniprot|P38853 Saccharomyces cerevisiae YHR158C KEL1
           Protein required for proper cell fusion and cell
           morphology functions in a complex with Kel2p to
           negatively regulate mitotic exit interacts with Tem1p
           and Lte1p localizes to regions of polarized growth
           potential Cdc28p substrate
          Length = 1056

 Score = 49.7 bits (117), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 54/204 (26%), Positives = 85/204 (41%), Gaps = 33/204 (16%)

Query: 166 YSDTWIL---DCNTKEWAK-VD-AKVGPSARSGHRITVWKNFFILHGG-FRDLGTSTTYL 219
           Y DTWI+   D  +K  +K VD     P  R GH  T+  N F++ GG    + +     
Sbjct: 117 YGDTWIISAHDNGSKFSSKTVDITDTTPPPRVGHASTLCGNAFVIFGGDTHKVNSDGLMD 176

Query: 220 SDCWLFDITTYKWKQVEFPSNHQVPDARSGHSFIPTAEGAILWGGYCKVKANKKGYQKGK 279
            D +LF+I +YKW  +  P   + P  R GH        +I+     + K     Y  G 
Sbjct: 177 DDVYLFNINSYKWT-IPRPVGPR-PLGRYGHKI------SIIATSQMRTKL----YVFGG 224

Query: 280 ILSDCWYLKMKS-DISGIR-----WERRRKQGFQPSPRVGCSMAYHKGRGILFGGVYDFE 333
              D ++  +   D+S  R     W+  +   F P P    +M  +  +  +FGG     
Sbjct: 225 QFDDTYFNDLTVFDLSSFRRPDSHWQFIKPNTFTPPPLTNHTMISYDYKLWVFGG----- 279

Query: 334 ETEESLESNFFNDLFSYHIESNRW 357
           +T + L     ND+F +  + N W
Sbjct: 280 DTPQGL----INDVFMFDPQINDW 299

 Score = 32.0 bits (71), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 41/186 (22%), Positives = 73/186 (39%), Gaps = 20/186 (10%)

Query: 84  SASSSKKELIVFGGEFTNPQTSTTTFYNDLHTFTPENNQWKRYTSQNXXXXXXXXXXXXX 143
           + S  + +L VFGG+F +   +  T + DL +F   ++ W+ +   N             
Sbjct: 211 ATSQMRTKLYVFGGQFDDTYFNDLTVF-DLSSFRRPDSHWQ-FIKPNTFTPPPLTNHTMI 268

Query: 144 XXGIAL-LHGGEFSSPKQNTFYHYSDTWILDCNTKEWAKVDAKVG--PSARSGHRITVWK 200
                L + GG+      N      D ++ D    +W KV    G  P     H   ++ 
Sbjct: 269 SYDYKLWVFGGDTPQGLIN------DVFMFDPQINDW-KVMQTTGDKPPPLQEHAAVLYG 321

Query: 201 NFFILHGGFRDLGTSTTYLSDCWLFDITTYKWKQVEFPSNHQ-VPDARSGHS--FIPTAE 257
           +   + GG  +      Y +  +  ++ + KW   + PS    +P  RSGHS   +P  +
Sbjct: 322 DLMCVVGGKDE---QDVYSNSVFFLNLISLKW--FKLPSYRSGIPQGRSGHSLTLLPNHK 376

Query: 258 GAILWG 263
             I+ G
Sbjct: 377 LLIMGG 382

>CAGL0F07997g Chr6 complement(785803..788613) [2811 bp, 936 aa] {ON}
           weakly similar to uniprot|P50090 Saccharomyces
           cerevisiae YGR238c KEL2 or uniprot|P38853 Saccharomyces
           cerevisiae YHR158c KEL1
          Length = 936

 Score = 47.8 bits (112), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 50/214 (23%), Positives = 76/214 (35%), Gaps = 47/214 (21%)

Query: 166 YSDTWILDCNTKEW----AKVDAKVG-PSARSGHRITVWKNFFILHGG-FRDLGTSTTYL 219
           Y DTW+L  N+         +D  V  P  R GH  T+  N  ++ GG    L +     
Sbjct: 201 YGDTWMLTANSDSTNFTTQVIDLTVNTPPPRVGHAATLCGNALVIFGGDTHKLNSEGLLD 260

Query: 220 SDCWLFDITTYKWKQVEFPSNHQVPDARSGHSFIPTAEGAILWGGY-------CKVKANK 272
            D +LF++ +++W                    IPT  G    G Y              
Sbjct: 261 DDLYLFNVDSHRWT-------------------IPTPIGTRPLGRYGHQVSVIATTPKKA 301

Query: 273 KGYQKGKILSDCWYLKMKS-DISGIR-----WERRRKQGFQPSPRVGCSMAYHKGRGILF 326
           K Y  G  L D ++  +   D+S  R     W+  + + F P P    +M  +  +  +F
Sbjct: 302 KLYLFGGQLDDNYFNDLAMYDLSDFRNPHSRWQFLKSKAFTPPPLTNHTMVAYDYKLWVF 361

Query: 327 GGVYDFEETEESLESNFFNDLFSYHIESNRWYSL 360
           GG         S      N L+ Y  + N W  L
Sbjct: 362 GG---------SSRGELQNQLYVYIPDLNEWRCL 386

>Kwal_14.1019 s14 (159934..162870) [2937 bp, 978 aa] {ON} YHR158C
           (KEL1) - involved in cell fusion and morphology;
           contains six Kelch repeats [contig 244] FULL
          Length = 978

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 51/205 (24%), Positives = 83/205 (40%), Gaps = 35/205 (17%)

Query: 166 YSDTWILDCNTKEWAKVDAK------VGPSARSGHRITVWKNFFILHGG-FRDLGTSTTY 218
           Y DTWI+  + +  A+  +K        P  R GH  T+  N F++ GG    + +    
Sbjct: 115 YGDTWIVTSH-ENGARFTSKTVEISDATPPPRVGHASTLCGNAFVIFGGDTHKVNSDGLM 173

Query: 219 LSDCWLFDITTYKWKQVEFPSNHQVPDARSGHSFIPTAEGAILWGGYCKVKANKKGYQKG 278
             D +LF+I +YKW  +  P   + P  R GH        +I+     K K     Y  G
Sbjct: 174 DDDVYLFNINSYKWT-IPNPVGPR-PLGRYGHKI------SIIAMSPMKTKL----YVFG 221

Query: 279 KILSDCWYLKMKS-DISGIR-----WERRRKQGFQPSPRVGCSMAYHKGRGILFGGVYDF 332
               D ++  +   D+S  R     W+      F P P    +M  +  +  +FGG    
Sbjct: 222 GQFDDTYFNDLAVFDLSSFRRPDSSWQFITPNSFTPPPLTNHAMISYDYKLWVFGG---- 277

Query: 333 EETEESLESNFFNDLFSYHIESNRW 357
            +T + L     +D+F +  + N W
Sbjct: 278 -DTPQGL----IDDVFVFDPQVNDW 297

>TPHA0A05170 Chr1 complement(1161610..1164660) [3051 bp, 1016 aa]
           {ON} Anc_5.88 YGR238C
          Length = 1016

 Score = 46.2 bits (108), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 48/198 (24%), Positives = 82/198 (41%), Gaps = 35/198 (17%)

Query: 166 YSDTWILDCNTKEWAKVDAK------VGPSARSGHRITVWKNFFILHGG-FRDLGTSTTY 218
           Y DTW +  +T    +  +K      + P  R GH  T+  N F++ GG    +      
Sbjct: 181 YGDTWSI-TSTNNGTQFISKALEILDLSPPPRVGHASTLCGNAFVVFGGDTHKVNKDGLM 239

Query: 219 LSDCWLFDITTYKWKQVEFPSNHQVPDARSGHSFIPTAEGAILWGGYCKVKANKKGYQKG 278
             D +LF+I ++KW  +  P   + P  R GH        +I+     K K     Y  G
Sbjct: 240 DDDIYLFNINSHKWT-IPSPVGPR-PLGRYGHKI------SIIATSSSKTKL----YLFG 287

Query: 279 KILSDCWYLKMKS-DISGIR-----WERRRKQGFQPSPRVGCSMAYHKGRGILFGGVYDF 332
               D ++  +   D+S  R     WE  + +G  P P    +M  +  +  +FGG    
Sbjct: 288 GQFDDTYFNDIAVFDLSSFRRADSHWEFIKPKGLIPPPMTNHTMVTYDNKLWVFGG---- 343

Query: 333 EETEESLESNFFNDLFSY 350
            +T++ L     ND++++
Sbjct: 344 -DTKDGL----INDIYAF 356

 Score = 33.5 bits (75), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 42/188 (22%), Positives = 69/188 (36%), Gaps = 22/188 (11%)

Query: 84  SASSSKKELIVFGGEFTNPQTSTTTFYN-----DLHTFTPENNQWKRYTSQNXXXXXXXX 138
           + SSSK +L +FGG+F +      T++N     DL +F   ++ W+    +         
Sbjct: 275 ATSSSKTKLYLFGGQFDD------TYFNDIAVFDLSSFRRADSHWEFIKPKGLIPPPMTN 328

Query: 139 XXXXXXXGIALLHGGEFSSPKQNTFYHYSDTWILDCNTKEWAKVDAKVG-PSARSGHRIT 197
                      + GG+      N  Y +     ++     W K+D     P     H   
Sbjct: 329 HTMVTYDNKLWVFGGDTKDGLINDIYAFDPADSINT----WTKIDVTGDIPCPVQEHSAL 384

Query: 198 VWKNFFILHGGFRDLGTSTTYLSDCWLFDITTYKWKQVEFPS-NHQVPDARSGHSFIPTA 256
           ++ N   + GG  +   +  YL+    F+    KW   +FP     +   RSGHS     
Sbjct: 385 IYDNLMCVIGGKDE---NDMYLNSVHFFNFDKLKW--FKFPIFKSGIMQGRSGHSISLLN 439

Query: 257 EGAILWGG 264
              IL  G
Sbjct: 440 NNKILIMG 447

>Ecym_2061 Chr2 (99788..103876) [4089 bp, 1362 aa] {ON} similar to
           Ashbya gossypii ADL149W
          Length = 1362

 Score = 46.2 bits (108), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 50/205 (24%), Positives = 83/205 (40%), Gaps = 35/205 (17%)

Query: 166 YSDTWILDCN------TKEWAKVDAKVGPSARSGHRITVWKNFFILHGGFRDLGTSTTYL 219
           Y DTWI+  +      T +  ++  +  P  R GH  T+  N F++ GG      +   +
Sbjct: 197 YGDTWIIKSHENGNKFTSKTVEI-TETTPPPRVGHASTLCGNAFVIFGGDTHKTNAEGLM 255

Query: 220 -SDCWLFDITTYKWKQVEFPSNHQVPDARSGHSFIPTAEGAILWGGYCKVKANKKGYQKG 278
             D +L +I ++KW  +  P   + P  R GH        +I+     K K     Y  G
Sbjct: 256 DDDVYLLNINSHKWT-IPRPVGPR-PLGRYGHKI------SIIATSQMKTKL----YVFG 303

Query: 279 KILSDCWYLKMKS-DISGIR-----WERRRKQGFQPSPRVGCSMAYHKGRGILFGGVYDF 332
               D ++  +   D+S  R     W+  +   F P P    +M  +  +  +FGG    
Sbjct: 304 GQFDDTYFNDLAVYDLSSFRRPDSHWQFLKPVSFVPPPLTNHTMVSYDYKLWVFGG---- 359

Query: 333 EETEESLESNFFNDLFSYHIESNRW 357
            +T + L     N+LF Y   +N W
Sbjct: 360 -DTPQGL----INELFMYDPTTNDW 379

 Score = 38.9 bits (89), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 43/183 (23%), Positives = 71/183 (38%), Gaps = 14/183 (7%)

Query: 84  SASSSKKELIVFGGEFTNPQTSTTTFYNDLHTFTPENNQWKRYTSQNXXXXXXXXXXXXX 143
           + S  K +L VFGG+F +   +    Y DL +F   ++ W+     +             
Sbjct: 291 ATSQMKTKLYVFGGQFDDTYFNDLAVY-DLSSFRRPDSHWQFLKPVSFVPPPLTNHTMVS 349

Query: 144 XXGIALLHGGEFSSPKQNTFYHYSDTWILDCNTKEWAKVDAK-VGPSARSGHRITVWKNF 202
                 + GG+      N  + Y      D  T +W+ VD   V P     H   ++K+ 
Sbjct: 350 YDYKLWVFGGDTPQGLINELFMY------DPTTNDWSVVDTTGVKPPPLQEHAALLYKDL 403

Query: 203 FILHGGFRDLGTSTTYLSDCWLFDITTYKW-KQVEFPSNHQVPDARSGHSFIPTAEGAIL 261
             + GG  D      Y  + +  ++ +++W K   F S   VP  RSGHS    +   +L
Sbjct: 404 MCIVGGKDD---QDNYSQEVYFLNLKSFRWFKLPHFRS--LVPSPRSGHSVTLLSNKKLL 458

Query: 262 WGG 264
             G
Sbjct: 459 IMG 461

>ADL149W Chr4 (427096..430731) [3636 bp, 1211 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YHR158C (KEL1) and
           YGR238C (KEL2)
          Length = 1211

 Score = 45.8 bits (107), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 51/204 (25%), Positives = 82/204 (40%), Gaps = 33/204 (16%)

Query: 166 YSDTWILDC--NTKEWAKVDAKVG---PSARSGHRITVWKNFFILHGGFRDLGTSTTYL- 219
           Y DTWIL    N K+++    ++    P  R GH  T+  N F++ GG      +   + 
Sbjct: 91  YGDTWILRAQDNGKQFSARTIEITETTPPPRVGHAATLCGNAFVIFGGDTHKTNNEGLMD 150

Query: 220 SDCWLFDITTYKWKQVEFPSNHQVPDARSGHSFIPTAEGAILWGGYCKVKANKKGYQKGK 279
            D +L ++ ++KW  +  P   + P  R GH        +I+     K K     Y  G 
Sbjct: 151 DDVYLLNVNSHKWT-IPHPVGPR-PLGRYGHKI------SIIATSQMKTKL----YVFGG 198

Query: 280 ILSDCWYLKMKS-DISGIR-----WERRRKQGFQPSPRVGCSMAYHKGRGILFGGVYDFE 333
              D ++  +   D+S  R     W   +   F P P    +M  +  +  +FGG     
Sbjct: 199 QFDDTYFNDLAVYDLSSFRRPDSHWVFVKPASFVPPPLTNHTMVSYDYKLWVFGG----- 253

Query: 334 ETEESLESNFFNDLFSYHIESNRW 357
           +T + L     N+LF Y    N W
Sbjct: 254 DTPQGL----INELFVYDPVVNDW 273

 Score = 35.8 bits (81), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 43/193 (22%), Positives = 70/193 (36%), Gaps = 14/193 (7%)

Query: 84  SASSSKKELIVFGGEFTNPQTSTTTFYNDLHTFTPENNQWKRYTSQNXXXXXXXXXXXXX 143
           + S  K +L VFGG+F +   +    Y DL +F   ++ W      +             
Sbjct: 185 ATSQMKTKLYVFGGQFDDTYFNDLAVY-DLSSFRRPDSHWVFVKPASFVPPPLTNHTMVS 243

Query: 144 XXGIALLHGGEFSSPKQNTFYHYSDTWILDCNTKEWAKVDAK-VGPSARSGHRITVWKNF 202
                 + GG+      N  + Y      D    +W+ V+     P     H   ++++ 
Sbjct: 244 YDYKLWVFGGDTPQGLINELFVY------DPVVNDWSVVETTGAKPPPLQEHAAVLYRDL 297

Query: 203 FILHGGFRDLGTSTTYLSDCWLFDITTYKW-KQVEFPSNHQVPDARSGHSFIPTAEGAIL 261
             + GG  D      Y  D +  ++ T++W K   F     VP  RSGHS    A   +L
Sbjct: 298 MCVVGGKDD---QDNYSQDVYFMNMKTFRWFKLPHF--QDMVPSPRSGHSVTLLANRKLL 352

Query: 262 WGGYCKVKANKKG 274
             G  K    + G
Sbjct: 353 IMGGDKFDYARPG 365

>Kpol_1010.62 s1010 complement(151895..154816) [2922 bp, 973 aa]
           {ON} complement(151895..154816) [2922 nt, 974 aa]
          Length = 973

 Score = 45.1 bits (105), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 53/208 (25%), Positives = 83/208 (39%), Gaps = 42/208 (20%)

Query: 166 YSDTWILDC-NTKEWAKVDAKVGPSA---RSGHRITVWKNFFILHGG-FRDLGTSTTYLS 220
           Y D W ++  + K ++    ++ P+    R GH  T+  N  IL GG    +        
Sbjct: 76  YGDVWSINHKDDKSFSASSIEITPTTPPPRVGHASTICGNALILFGGDTHKVNEDGLMDD 135

Query: 221 DCWLFDITTYKWKQVEFPSNHQVPDARSGH--SFI---PTAEGAILWGGYCKVKANKKGY 275
           D +LF++ +YKW   E P   + P  R GH  S I   PT     L+GG           
Sbjct: 136 DLYLFNLNSYKWTIPE-PIGLR-PLGRYGHKISIIATQPTKTKLFLFGGQ---------- 183

Query: 276 QKGKILSDCWYLKMKS-DISGIR-----WERRRKQGFQPSPRVGCSMAYHKGRGILFGGV 329
                  D ++  +   D+S  R     WE  + + F P P    +M  +  +  +FGG 
Sbjct: 184 -----FDDTYFNDLSMFDLSTFRKPDAQWEFIKPKSFFPPPVSNHTMISYDNKLWVFGG- 237

Query: 330 YDFEETEESLESNFFNDLFSYHIESNRW 357
                  E+L+    N++F Y    N W
Sbjct: 238 -------ETLQG-LINEVFVYDPIVNDW 257

>TBLA0C06530 Chr3 complement(1577728..1581246) [3519 bp, 1172 aa]
           {ON} Anc_5.88 YGR238C
          Length = 1172

 Score = 45.1 bits (105), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 46/177 (25%), Positives = 71/177 (40%), Gaps = 28/177 (15%)

Query: 188 PSARSGHRITVWKNFFILHGGFRDLGTSTTYL-SDCWLFDITTYKWKQVEFPSNHQVPDA 246
           P  R GH  T+  N F++ GG          +  D +LF+I +YKW  +  P   + P  
Sbjct: 140 PPPRVGHASTLCGNAFVIFGGDTHKTNKDGLMDDDIYLFNINSYKW-TIPQPVGPR-PLG 197

Query: 247 RSGHSFIPTAEGAILWGGYCKVKANKKGYQKGKILSDCWYLKM-KSDISGIR-----WER 300
           R GH        +I+     K K     Y  G    D ++  +   D+S  R     WE 
Sbjct: 198 RYGHKI------SIIATSQMKTKL----YVFGGQFDDSYFNDLCVYDLSSFRKPESHWEF 247

Query: 301 RRKQGFQPSPRVGCSMAYHKGRGILFGGVYDFEETEESLESNFFNDLFSYHIESNRW 357
            + + F P P    +M  +  +  +FGG     +T++ L     N LF +    N W
Sbjct: 248 LKPKSFIPPPLTNHTMVSYDYKLWVFGG-----DTQQGL----INQLFMFDPVINDW 295

>TPHA0H01080 Chr8 complement(232804..235290) [2487 bp, 828 aa] {ON}
           Anc_5.88 YGR238C
          Length = 828

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 46/176 (26%), Positives = 67/176 (38%), Gaps = 24/176 (13%)

Query: 188 PSARSGHRITVWKNFFILHGG-FRDLGTSTTYLSD-CWLFDITTYKWKQVEFPSNHQV-P 244
           P  R GH  T+  N  I+ GG    +  S   + D  +  ++ T KW     PS   + P
Sbjct: 95  PPPRVGHAATLCGNALIVFGGDTHKVNVSNGLMDDDLYFLNLDTTKWT---IPSPKGIRP 151

Query: 245 DARSGHSFIPTAEGAILWGGYCKVKANKKGYQKGKILSDCWYLKMKSDISGIRWERRRKQ 304
             R GH          L+GG        + Y    +  D    K  +     +WE  + +
Sbjct: 152 LGRYGHKISVINSNLYLFGGQFD-----ETYFNDLVKFDLLNFKDANS----QWEFIKPK 202

Query: 305 GFQPSPRVGCSMAYHKGRGILFGGVYDFEETEESLESNFFNDLFSYHIESNRWYSL 360
           GF P P    SM   + +  +FGG     +T + L     N+ F Y  E N W  L
Sbjct: 203 GFIPPPLSNFSMCTFENKLYVFGG-----DTYQVLT----NETFVYDPELNEWSIL 249

>YGR238C Chr7 complement(966039..968687) [2649 bp, 882 aa] {ON}
           KEL2Protein that functions in a complex with Kel1p to
           negatively regulate mitotic exit, interacts with Tem1p
           and Lte1p; localizes to regions of polarized growth;
           potential Cdc28p substrate
          Length = 882

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 49/205 (23%), Positives = 78/205 (38%), Gaps = 35/205 (17%)

Query: 166 YSDTWILDCN------TKEWAKVDAKVGPSARSGHRITVWKNFFILHGG-FRDLGTSTTY 218
           Y D W +  N      T +   +D    P  R GH  T+  N +++ GG    L  +   
Sbjct: 112 YGDVWQIAANADGTSFTSKRIDIDQNT-PPPRVGHASTICGNAYVVFGGDTHKLNKNGLL 170

Query: 219 LSDCWLFDITTYKWKQVEFPSNHQVPDARSGHSFIPTAEGAILWGGYCKVKANKKGYQKG 278
             D +LF+I +YKW  +  P   + P  R GH     A   +            K Y  G
Sbjct: 171 DDDLYLFNINSYKW-TIPQPIGRR-PLGRYGHKISIIASNPM----------QTKLYLFG 218

Query: 279 KILSDCWYLKMKS-DISGIR-----WERRRKQGFQPSPRVGCSMAYHKGRGILFGGVYDF 332
             + + ++  +   D+S  R     WE     G  P P    +M  +  +  +FGG    
Sbjct: 219 GQVDETYFNDLVVFDLSSFRRPNSHWEFLEPVGDLPPPLTNHTMVAYDNKLWVFGG---- 274

Query: 333 EETEESLESNFFNDLFSYHIESNRW 357
            ET +++     ND + Y    + W
Sbjct: 275 -ETPKTIS----NDTYRYDPAQSEW 294

 Score = 37.0 bits (84), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 34/134 (25%), Positives = 53/134 (39%), Gaps = 26/134 (19%)

Query: 230 YKWKQVEFPSNHQVPDARSGHSFIPTAEGAILWGGYCKVKANKKGYQKGKILSDCWYLKM 289
           Y W +V+   N   P  R   SFI T +  I   G         G     +  D W +  
Sbjct: 71  YIWNRVKL-KNSPFPRYRHSSSFIVTNDNRIFVTG---------GLHDQSVYGDVWQIAA 120

Query: 290 KSDISGIRWERRRKQGFQPSPRVG-----CSMAYHKGRGILFGGVYDFEETEESLESNFF 344
            +D +    +R       P PRVG     C  AY     ++FGG     +T +  ++   
Sbjct: 121 NADGTSFTSKRIDIDQNTPPPRVGHASTICGNAY-----VVFGG-----DTHKLNKNGLL 170

Query: 345 -NDLFSYHIESNRW 357
            +DL+ ++I S +W
Sbjct: 171 DDDLYLFNINSYKW 184

>Skud_7.572 Chr7 complement(940820..943471) [2652 bp, 883 aa] {ON}
           YGR238C (REAL)
          Length = 883

 Score = 40.8 bits (94), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 47/204 (23%), Positives = 77/204 (37%), Gaps = 33/204 (16%)

Query: 166 YSDTWILDCN------TKEWAKVDAKVGPSARSGHRITVWKNFFILHGG-FRDLGTSTTY 218
           Y D W +  N      T +  ++D    P  R GH  T+  N +++ GG    L      
Sbjct: 110 YGDVWQITANADGTSFTPKAIQIDRNT-PPPRVGHASTLCGNAYVVFGGDTHKLNEDKLL 168

Query: 219 LSDCWLFDITTYKWKQVEFPSNHQVPDARSGH-----SFIPTAEGAILWGGYCKVKANKK 273
             D +LF++ +YKW  +  P   + P  R GH     ++ P      L+GG        K
Sbjct: 169 DDDIYLFNVNSYKWT-IPQPIGSR-PLGRYGHKISIIAYNPMQTKLYLFGGQL-----DK 221

Query: 274 GYQKGKILSDCWYLKMKSDISGIRWERRRKQGFQPSPRVGCSMAYHKGRGILFGGVYDFE 333
            Y     + D    + ++      WE        P P    +M  +  +  +FGG     
Sbjct: 222 TYFNDLAMFDLSSFRRRNS----HWEFLEPATTVPPPLANHTMVTYGNKLWVFGG----- 272

Query: 334 ETEESLESNFFNDLFSYHIESNRW 357
           ET +++     N+ + Y    N W
Sbjct: 273 ETPKTVS----NETYCYDPIQNDW 292

>Suva_7.530 Chr7 complement(920446..923130) [2685 bp, 894 aa] {ON}
           YGR238C (REAL)
          Length = 894

 Score = 40.4 bits (93), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 33/110 (30%), Positives = 47/110 (42%), Gaps = 13/110 (11%)

Query: 166 YSDTWILDCNTKEWAKVDAKV-----GPSARSGHRITVWKNFFILHGG-FRDLGTSTTYL 219
           Y DTW +  N    + V   +      P  R GH  T+  N +++ GG    L  +    
Sbjct: 112 YGDTWQITGNLDGTSFVSKTIQIGQNTPPPRVGHASTICGNAYVVFGGDTHKLNMNRLLD 171

Query: 220 SDCWLFDITTYKWKQVEFPSNHQVPDARSGH--SFI---PTAEGAILWGG 264
            D +LF+I +YKW  +  P   + P  R GH  S I   P      L+GG
Sbjct: 172 DDLYLFNINSYKWT-IPQPVGTR-PLGRYGHKISIIANNPMQTKLFLFGG 219

>Smik_16.68 Chr16 (128068..130752) [2685 bp, 894 aa] {ON} YGR238C
           (REAL)
          Length = 894

 Score = 40.4 bits (93), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 48/205 (23%), Positives = 78/205 (38%), Gaps = 35/205 (17%)

Query: 166 YSDTWILDCN------TKEWAKVDAKVGPSARSGHRITVWKNFFILHGG-FRDLGTSTTY 218
           Y D W +  N      T +  ++D    P  R GH  T+  N +++ GG    L  +   
Sbjct: 112 YGDVWEITANANGTSFTSKRIQIDHNT-PPPRVGHASTMCGNAYVVFGGDTHKLNKNRLL 170

Query: 219 LSDCWLFDITTYKWKQVEFPSNHQVPDARSGHSFIPTAEGAILWGGYCKVKANKKGYQKG 278
             D +LF+I +YKW  +  P   + P  R GH     A   +          + + Y  G
Sbjct: 171 DDDLYLFNINSYKW-TIPHPIGSR-PLGRYGHKISIIASKQM----------HTELYLFG 218

Query: 279 KILSDCWYLKMKS-DISGIR-----WERRRKQGFQPSPRVGCSMAYHKGRGILFGGVYDF 332
             + + ++  +   D+S  R     WE        P P    +M     +  +FGG    
Sbjct: 219 GQIDETYFNDLAVFDLSSFRRPNSHWEFLEPISALPPPLTNHTMVTFDNKLWVFGG---- 274

Query: 333 EETEESLESNFFNDLFSYHIESNRW 357
            ET +++     ND + Y    N W
Sbjct: 275 -ETPKTIS----NDTYCYDPIQNAW 294

 Score = 33.9 bits (76), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 32/146 (21%), Positives = 57/146 (39%), Gaps = 16/146 (10%)

Query: 213 GTSTTYLSDCWLFDITTYKWKQVEFPSNHQVPDARSGHSFIPTAEGAILWGGYCKVKANK 272
           G ST   S     +   Y W +++   +   P  R   SFI T +  I   G        
Sbjct: 54  GASTNLPSPLERKNSRRYIWNRIKL-KDSPFPRYRHSSSFITTNDNRIFVTG-------- 104

Query: 273 KGYQKGKILSDCWYLKMKSDISGIRWERRRKQGFQPSPRVGCSMAYHKGRGILFGGVYDF 332
            G     +  D W +   ++ +    +R +     P PRVG +        ++FGG    
Sbjct: 105 -GLYDQSVYGDVWEITANANGTSFTSKRIQIDHNTPPPRVGHASTMCGNAYVVFGG---- 159

Query: 333 EETEESLESNFF-NDLFSYHIESNRW 357
            +T +  ++    +DL+ ++I S +W
Sbjct: 160 -DTHKLNKNRLLDDDLYLFNINSYKW 184

>AGL293C Chr7 complement(156902..159856) [2955 bp, 984 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YER114C
           (BOI2) and YBL085W (BOI1)
          Length = 984

 Score = 34.7 bits (78), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 27/83 (32%), Positives = 37/83 (44%), Gaps = 13/83 (15%)

Query: 198 VWKN-FFILHGGFRDLGTSTTYLSDCWLFDITTYKWKQVEFPSNHQVPDARSGHSFIPTA 256
           VWKN FF+LHG       +TT   +  L DIT+           H+V  A+    F+   
Sbjct: 749 VWKNRFFVLHGTRLSYFANTTDNRERGLIDITS-----------HRVLPAKEDDKFVALY 797

Query: 257 EGAILWGGYC-KVKANKKGYQKG 278
             +I  G YC K+     G +KG
Sbjct: 798 AASIGRGRYCFKLVPPAPGSKKG 820

>TBLA0A04320 Chr1 (1068199..1070715) [2517 bp, 838 aa] {ON} Anc_7.9
           YAL056W
          Length = 838

 Score = 34.3 bits (77), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 33/76 (43%), Gaps = 10/76 (13%)

Query: 203 FILHGGFRDLGTSTTYLSDCWLFDITTYKWKQVEFPSNHQ----VPD--ARSGHSFIPTA 256
            ++HGG      +T   SD W FD  T  W Q+E  +  +    VP   A +GHS     
Sbjct: 659 LVMHGG----SNATHIYSDMWWFDFETESWVQIETQAQTEDKGLVPIEMALAGHSMATVG 714

Query: 257 EGAILWGGYCKVKANK 272
             +I  GG  +   +K
Sbjct: 715 SASIFVGGMMQSDVDK 730

>Smik_19.4 Chr19 complement(4397..5062) [666 bp, 221 aa] {ON}
           YNL334C (REAL)
          Length = 221

 Score = 33.5 bits (75), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 33/72 (45%), Gaps = 2/72 (2%)

Query: 53  FKKEQEQFEKVAVDSVDKVNKRLNPCMVGNPSASSSKKELIVFGGEFTNPQ--TSTTTFY 110
           F +     EK   ++ D+ N  L+   V + +  S    LI+ GGE T        T FY
Sbjct: 14  FIEHIRHVEKCIDENKDQYNAELSVIAVRDNNQLSKCDALIIPGGESTAMSLIAQRTGFY 73

Query: 111 NDLHTFTPENNQ 122
           NDLHTF    N+
Sbjct: 74  NDLHTFVHNPNK 85

>Kwal_55.20756 s55 (545793..550520) [4728 bp, 1575 aa] {ON} YGL197W
           (MDS3) - 1:1 [contig 139] FULL
          Length = 1575

 Score = 33.5 bits (75), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 30/51 (58%), Gaps = 2/51 (3%)

Query: 311 RVGCSMAYHKGRGILFGGVYDFEETEESLESNFFNDLFSYHIESNRWYSLS 361
           RV  SM +H GR  LFGG+    +++  L ++  N+L+S  +E+  W  LS
Sbjct: 138 RVFHSMCFHDGRLYLFGGLVVSPQSDYELIAS--NELWSLDLETKTWLQLS 186

>SAKL0B10362g Chr2 complement(891438..895172) [3735 bp, 1244 aa]
           {ON} similar to uniprot|P15801 Saccharomyces cerevisiae
           YOR330C MIP1 Catalytic subunit of the mitochondrial DNA
           polymerase
          Length = 1244

 Score = 33.5 bits (75), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 35/77 (45%), Gaps = 9/77 (11%)

Query: 422 LEDEEEEQLAVQHTILTQLPH---PRFNATTTVIDDTLFIFGGIWELGDKEFMIDSLYSI 478
           + DEEE+ LA +  +L ++PH   P FN TT +    +  F         EF  D+L   
Sbjct: 514 VADEEEQSLADEEHVLLKVPHPNGPEFNCTTLLSKPYINFFEKGILTSHSEFAHDAL--- 570

Query: 479 DLNKLDGVTMYWEDLKE 495
              K++    YW   +E
Sbjct: 571 ---KINSSGSYWMSARE 584

>KAFR0C04910 Chr3 (975629..978265) [2637 bp, 878 aa] {ON} Anc_7.9
           YAL056W
          Length = 878

 Score = 32.3 bits (72), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 21/81 (25%), Positives = 34/81 (41%), Gaps = 20/81 (24%)

Query: 203 FILHGGFRDLGTSTTYLSDCWLFDITTYKWKQVE------------FPSNHQVPDARSGH 250
            +LHGG  D    T    D W FD+ T++W +V              P N ++     GH
Sbjct: 696 IVLHGGSDD----TNVYGDMWWFDLETFQWTKVATYIKPKDQDSSLVPINIKI----VGH 747

Query: 251 SFIPTAEGAILWGGYCKVKAN 271
           + + +   A+  GG  + + N
Sbjct: 748 TMMTSGCMAVCVGGITQAEVN 768

>ZYRO0C00550g Chr3 (39312..41858) [2547 bp, 848 aa] {ON} similar to
           uniprot|Q08886 Saccharomyces cerevisiae YOR371C GPB1
           Proposed beta subunit of the heterotrimeric G protein
           that interacts with the receptor Grp1p has signaling
           role in response to nutrients involved in regulation of
           pseudohyphal growth through cAMP levels homolog of Gpb2p
          Length = 848

 Score = 31.6 bits (70), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 20/71 (28%), Positives = 28/71 (39%), Gaps = 10/71 (14%)

Query: 203 FILHGGFRDLGTSTTYLSDCWLFDITTYKWKQVEFPSNHQ----VPDARS--GHSFIPTA 256
            I+HGG       T    D W +DI T  W Q+     H+    +P      GHS +   
Sbjct: 671 LIMHGG----SNKTDVCRDMWWYDIETETWSQITTHGKHEASKMIPIGVGLVGHSLVCVG 726

Query: 257 EGAILWGGYCK 267
             A+  GG  +
Sbjct: 727 GMAVFVGGLLQ 737

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.134    0.413 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 62,010,071
Number of extensions: 2705714
Number of successful extensions: 8942
Number of sequences better than 10.0: 65
Number of HSP's gapped: 8873
Number of HSP's successfully gapped: 104
Length of query: 641
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 525
Effective length of database: 40,180,143
Effective search space: 21094575075
Effective search space used: 21094575075
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 69 (31.2 bits)