Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
CAGL0A01045g6.13ON48348325910.0
KLTH0C11462g6.13ON49247821600.0
SAKL0E00946g6.13ON49349121480.0
KLLA0D00902g6.13ON49246621410.0
NCAS0D026206.13ON49346621350.0
Kwal_56.223626.13ON49347721240.0
TDEL0G045806.13ON48448221200.0
Ecym_30166.13ON48948120980.0
Kpol_1032.46.13ON46746120950.0
KNAG0E027506.13ON49846020500.0
Kpol_1045.766.13ON48548420480.0
ACR013C6.13ON48848620460.0
KAFR0B065206.13ON49547720400.0
YPL262W (FUM1)6.13ON48846020110.0
Smik_6.4706.13ON48848720100.0
Suva_16.436.13ON48848720080.0
Skud_16.166.13ON48846020070.0
NDAI0I024706.13ON47546019900.0
ZYRO0C07964g6.13ON50546319920.0
TPHA0J002706.13ON49646019820.0
TBLA0G010006.13ON46546519130.0
TBLA0A071306.13ON50046518850.0
Suva_15.2011.354ON4632861357e-08
AEL019W1.354ON4692411331e-07
NDAI0G059401.354ON4622421322e-07
NCAS0A090101.354ON4622851322e-07
TBLA0F034801.354ON4662831303e-07
KLLA0A08404g1.354ON4612281276e-07
Smik_8.831.354ON4632411267e-07
Ecym_27491.354ON4702871269e-07
TDEL0D022201.354ON4652861241e-06
KAFR0A009501.354ON4642411232e-06
YHR018C (ARG4)1.354ON4632411204e-06
KNAG0I015601.354ON4622421205e-06
SAKL0D09746g1.354ON4642881205e-06
ZYRO0G00748g1.354ON4622401196e-06
Kpol_1018.1251.354ON4602841187e-06
Skud_8.701.354ON4632411187e-06
CAGL0I08987g1.354ON4612391152e-05
TPHA0A021901.354ON4632381152e-05
NDAI0J019504.197ON4821911143e-05
Kwal_47.180664.197ON4821921143e-05
Kpol_1042.164.197ON4821891133e-05
NCAS0J012004.197ON4821911124e-05
KLLA0B13189g4.197ON4821911115e-05
KLTH0G19338g1.354ON4652761116e-05
KNAG0B058404.197ON4821891107e-05
Suva_10.4594.197ON4821841099e-05
YLR359W (ADE13)4.197ON4821841091e-04
Smik_12.4464.197ON4821841091e-04
SAKL0B04972g4.197ON4821911062e-04
CAGL0B02794g4.197ON4821901062e-04
TPHA0B010404.197ON4821911053e-04
Ecym_24524.197ON4821951053e-04
Skud_12.4434.197ON4821841036e-04
ZYRO0B07964g4.197ON4821911027e-04
KLTH0A03344g4.197ON482191990.002
TDEL0E017604.197ON482191980.002
Kwal_27.127821.354ON465262970.003
KAFR0A062304.197ON482190970.003
TBLA0A083204.197ON482189930.007
ABL006C4.197ON482200920.011
ZYRO0E09460g3.564ON100954770.85
Suva_2.2568.235ON1245116696.8
KLTH0D14080g4.237ON110239689.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= CAGL0A01045g
         (483 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAGL0A01045g Chr1 complement(104865..106316) [1452 bp, 483 aa] {...  1002   0.0  
KLTH0C11462g Chr3 complement(942263..943741) [1479 bp, 492 aa] {...   836   0.0  
SAKL0E00946g Chr5 (72220..73701) [1482 bp, 493 aa] {ON} highly s...   832   0.0  
KLLA0D00902g Chr4 (83648..85126) [1479 bp, 492 aa] {ON} highly s...   829   0.0  
NCAS0D02620 Chr4 complement(504150..505631) [1482 bp, 493 aa] {O...   827   0.0  
Kwal_56.22362 s56 (65537..67018) [1482 bp, 493 aa] {ON} YPL262W ...   822   0.0  
TDEL0G04580 Chr7 complement(836367..837821) [1455 bp, 484 aa] {O...   821   0.0  
Ecym_3016 Chr3 (30897..32366) [1470 bp, 489 aa] {ON} similar to ...   812   0.0  
Kpol_1032.4 s1032 (3761..5164) [1404 bp, 467 aa] {ON} (3761..516...   811   0.0  
KNAG0E02750 Chr5 (547746..549242) [1497 bp, 498 aa] {ON} Anc_6.1...   794   0.0  
Kpol_1045.76 s1045 complement(177447..178904) [1458 bp, 485 aa] ...   793   0.0  
ACR013C Chr3 complement(381119..382585) [1467 bp, 488 aa] {ON} S...   792   0.0  
KAFR0B06520 Chr2 (1352364..1353851) [1488 bp, 495 aa] {ON} Anc_6...   790   0.0  
YPL262W Chr16 (47336..48802) [1467 bp, 488 aa] {ON}  FUM1Fumaras...   779   0.0  
Smik_6.470 Chr6 complement(772380..773846) [1467 bp, 488 aa] {ON...   778   0.0  
Suva_16.43 Chr16 (62871..64337) [1467 bp, 488 aa] {ON} YPL262W (...   778   0.0  
Skud_16.16 Chr16 (26407..27873) [1467 bp, 488 aa] {ON} YPL262W (...   777   0.0  
NDAI0I02470 Chr9 complement(567782..569209) [1428 bp, 475 aa] {O...   771   0.0  
ZYRO0C07964g Chr3 complement(607609..609126) [1518 bp, 505 aa] {...   771   0.0  
TPHA0J00270 Chr10 (61961..63451) [1491 bp, 496 aa] {ON} Anc_6.13...   768   0.0  
TBLA0G01000 Chr7 (252070..253467) [1398 bp, 465 aa] {ON} Anc_6.1...   741   0.0  
TBLA0A07130 Chr1 (1770536..1772038) [1503 bp, 500 aa] {ON} Anc_6...   730   0.0  
Suva_15.201 Chr15 complement(348498..349889) [1392 bp, 463 aa] {...    57   7e-08
AEL019W Chr5 (600410..601819) [1410 bp, 469 aa] {ON} Syntenic ho...    56   1e-07
NDAI0G05940 Chr7 (1470741..1472129) [1389 bp, 462 aa] {ON} Anc_1...    55   2e-07
NCAS0A09010 Chr1 complement(1783858..1785246) [1389 bp, 462 aa] ...    55   2e-07
TBLA0F03480 Chr6 (857021..858421) [1401 bp, 466 aa] {ON} Anc_1.3...    55   3e-07
KLLA0A08404g Chr1 complement(743192..744577) [1386 bp, 461 aa] {...    54   6e-07
Smik_8.83 Chr8 complement(120320..121711) [1392 bp, 463 aa] {ON}...    53   7e-07
Ecym_2749 Chr2 complement(1453019..1454431) [1413 bp, 470 aa] {O...    53   9e-07
TDEL0D02220 Chr4 (428430..429827) [1398 bp, 465 aa] {ON} Anc_1.3...    52   1e-06
KAFR0A00950 Chr1 (178176..179570) [1395 bp, 464 aa] {ON} Anc_1.3...    52   2e-06
YHR018C Chr8 complement(140011..141402) [1392 bp, 463 aa] {ON}  ...    51   4e-06
KNAG0I01560 Chr9 (303704..305092) [1389 bp, 462 aa] {ON} Anc_1.3...    51   5e-06
SAKL0D09746g Chr4 complement(808721..810115) [1395 bp, 464 aa] {...    51   5e-06
ZYRO0G00748g Chr7 (57164..58552) [1389 bp, 462 aa] {ON} highly s...    50   6e-06
Kpol_1018.125 s1018 complement(330965..332347) [1383 bp, 460 aa]...    50   7e-06
Skud_8.70 Chr8 complement(121600..122991) [1392 bp, 463 aa] {ON}...    50   7e-06
CAGL0I08987g Chr9 complement(871699..873084) [1386 bp, 461 aa] {...    49   2e-05
TPHA0A02190 Chr1 (452902..454293) [1392 bp, 463 aa] {ON} Anc_1.3...    49   2e-05
NDAI0J01950 Chr10 (485753..487201) [1449 bp, 482 aa] {ON} Anc_4....    49   3e-05
Kwal_47.18066 s47 (668459..669907) [1449 bp, 482 aa] {ON} YLR359...    49   3e-05
Kpol_1042.16 s1042 (40749..42197) [1449 bp, 482 aa] {ON} (40749....    48   3e-05
NCAS0J01200 Chr10 (209722..211170) [1449 bp, 482 aa] {ON} Anc_4....    48   4e-05
KLLA0B13189g Chr2 complement(1153780..1155228) [1449 bp, 482 aa]...    47   5e-05
KLTH0G19338g Chr7 complement(1665123..1666520) [1398 bp, 465 aa]...    47   6e-05
KNAG0B05840 Chr2 (1150025..1151473) [1449 bp, 482 aa] {ON} Anc_4...    47   7e-05
Suva_10.459 Chr10 (803809..805257) [1449 bp, 482 aa] {ON} YLR359...    47   9e-05
YLR359W Chr12 (844282..845730) [1449 bp, 482 aa] {ON}  ADE13Aden...    47   1e-04
Smik_12.446 Chr12 (783341..784789) [1449 bp, 482 aa] {ON} YLR359...    47   1e-04
SAKL0B04972g Chr2 (430349..431797) [1449 bp, 482 aa] {ON} highly...    45   2e-04
CAGL0B02794g Chr2 complement(269303..270751) [1449 bp, 482 aa] {...    45   2e-04
TPHA0B01040 Chr2 complement(235467..236915) [1449 bp, 482 aa] {O...    45   3e-04
Ecym_2452 Chr2 (881643..883091) [1449 bp, 482 aa] {ON} similar t...    45   3e-04
Skud_12.443 Chr12 (784448..785896) [1449 bp, 482 aa] {ON} YLR359...    44   6e-04
ZYRO0B07964g Chr2 complement(620761..622209) [1449 bp, 482 aa] {...    44   7e-04
KLTH0A03344g Chr1 (289188..290636) [1449 bp, 482 aa] {ON} highly...    43   0.002
TDEL0E01760 Chr5 complement(337315..338763) [1449 bp, 482 aa] {O...    42   0.002
Kwal_27.12782 s27 complement(1373166..1374563) [1398 bp, 465 aa]...    42   0.003
KAFR0A06230 Chr1 complement(1257709..1259157) [1449 bp, 482 aa] ...    42   0.003
TBLA0A08320 Chr1 complement(2043721..2045169) [1449 bp, 482 aa] ...    40   0.007
ABL006C Chr2 complement(385134..386582) [1449 bp, 482 aa] {ON} S...    40   0.011
ZYRO0E09460g Chr5 complement(753030..756059) [3030 bp, 1009 aa] ...    34   0.85 
Suva_2.256 Chr2 complement(439531..443268) [3738 bp, 1245 aa] {O...    31   6.8  
KLTH0D14080g Chr4 (1149555..1152863) [3309 bp, 1102 aa] {ON} sim...    31   9.3  

>CAGL0A01045g Chr1 complement(104865..106316) [1452 bp, 483 aa] {ON}
           highly similar to uniprot|P08417 Saccharomyces
           cerevisiae YPL262w FUM1 fumarate hydratase
          Length = 483

 Score = 1002 bits (2591), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 483/483 (100%), Positives = 483/483 (100%)

Query: 1   MLRASSRAKTSLIGYSARMMHYRVETDTFGEIKVPADKYWGAQTQRSFQNFKIGGARERM 60
           MLRASSRAKTSLIGYSARMMHYRVETDTFGEIKVPADKYWGAQTQRSFQNFKIGGARERM
Sbjct: 1   MLRASSRAKTSLIGYSARMMHYRVETDTFGEIKVPADKYWGAQTQRSFQNFKIGGARERM 60

Query: 61  PEPIVRAFGVLKKSAAIVNEKLGTLDSEIAGPIQQAADEVAKGKLNDHFPLVVFQTGSGT 120
           PEPIVRAFGVLKKSAAIVNEKLGTLDSEIAGPIQQAADEVAKGKLNDHFPLVVFQTGSGT
Sbjct: 61  PEPIVRAFGVLKKSAAIVNEKLGTLDSEIAGPIQQAADEVAKGKLNDHFPLVVFQTGSGT 120

Query: 121 QSNMNANEVISNRAIELIGGELGSKKIHPNNHCNQAQSSNDTFPSVMHIAAVTEITNSLL 180
           QSNMNANEVISNRAIELIGGELGSKKIHPNNHCNQAQSSNDTFPSVMHIAAVTEITNSLL
Sbjct: 121 QSNMNANEVISNRAIELIGGELGSKKIHPNNHCNQAQSSNDTFPSVMHIAAVTEITNSLL 180

Query: 181 PEITQLKDALHKKAEEFQDIVKIGRTHLQDATPLTLGQEFSGYVQQLVNGIARIENTLPH 240
           PEITQLKDALHKKAEEFQDIVKIGRTHLQDATPLTLGQEFSGYVQQLVNGIARIENTLPH
Sbjct: 181 PEITQLKDALHKKAEEFQDIVKIGRTHLQDATPLTLGQEFSGYVQQLVNGIARIENTLPH 240

Query: 241 LKYLAQGGTAVGTGLNTKEGFDKLIAEQISKETGIDFKTAPNKFEALAAHDAIVEASGAL 300
           LKYLAQGGTAVGTGLNTKEGFDKLIAEQISKETGIDFKTAPNKFEALAAHDAIVEASGAL
Sbjct: 241 LKYLAQGGTAVGTGLNTKEGFDKLIAEQISKETGIDFKTAPNKFEALAAHDAIVEASGAL 300

Query: 301 NTVACSLFKIAQDIRYLGSGPRCGYGELHLPENEPGSSIMPGKVNPTQNEAMTQVCVQVM 360
           NTVACSLFKIAQDIRYLGSGPRCGYGELHLPENEPGSSIMPGKVNPTQNEAMTQVCVQVM
Sbjct: 301 NTVACSLFKIAQDIRYLGSGPRCGYGELHLPENEPGSSIMPGKVNPTQNEAMTQVCVQVM 360

Query: 361 GNNAAVTFAGANGQFELNVFKPVMISNLLSSIRLLADACHSFRVHCVEGIEANREKINHN 420
           GNNAAVTFAGANGQFELNVFKPVMISNLLSSIRLLADACHSFRVHCVEGIEANREKINHN
Sbjct: 361 GNNAAVTFAGANGQFELNVFKPVMISNLLSSIRLLADACHSFRVHCVEGIEANREKINHN 420

Query: 421 LHNSLMLVTALNPKIGYDAASKIAKNAFKKNITLKESALELKYLTSEEFDEWVIPENMVG 480
           LHNSLMLVTALNPKIGYDAASKIAKNAFKKNITLKESALELKYLTSEEFDEWVIPENMVG
Sbjct: 421 LHNSLMLVTALNPKIGYDAASKIAKNAFKKNITLKESALELKYLTSEEFDEWVIPENMVG 480

Query: 481 PTK 483
           PTK
Sbjct: 481 PTK 483

>KLTH0C11462g Chr3 complement(942263..943741) [1479 bp, 492 aa] {ON}
           highly similar to uniprot|P08417 Saccharomyces
           cerevisiae YPL262W FUM1 Fumarase converts fumaric acid
           to L-malic acid in the TCA cycle cytosolic and
           mitochondrial localization determined by the N-terminal
           mitochondrial targeting sequence and protein
           conformation
          Length = 492

 Score =  836 bits (2160), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 399/478 (83%), Positives = 434/478 (90%), Gaps = 1/478 (0%)

Query: 5   SSRAKTSLIGYSARMMH-YRVETDTFGEIKVPADKYWGAQTQRSFQNFKIGGARERMPEP 63
           S   KT LI  S+ +    RVETD FGEI VPADKYWGAQTQRS +NFKIGGARERMPEP
Sbjct: 14  SGSPKTRLISTSSAISQKCRVETDAFGEINVPADKYWGAQTQRSLENFKIGGARERMPEP 73

Query: 64  IVRAFGVLKKSAAIVNEKLGTLDSEIAGPIQQAADEVAKGKLNDHFPLVVFQTGSGTQSN 123
           +VRAFG+LKKSAAIVNE LGTLD +I+ PIQQAADEV  GKL DHFPLVVFQTGSGTQSN
Sbjct: 74  VVRAFGILKKSAAIVNESLGTLDPKISKPIQQAADEVISGKLVDHFPLVVFQTGSGTQSN 133

Query: 124 MNANEVISNRAIELIGGELGSKKIHPNNHCNQAQSSNDTFPSVMHIAAVTEITNSLLPEI 183
           MNANEVISNRAIE++GG++G+K IHPNNHCNQAQSSNDTFPSVMHIAAVTEIT+SLLPE+
Sbjct: 134 MNANEVISNRAIEIVGGKMGTKSIHPNNHCNQAQSSNDTFPSVMHIAAVTEITHSLLPEL 193

Query: 184 TQLKDALHKKAEEFQDIVKIGRTHLQDATPLTLGQEFSGYVQQLVNGIARIENTLPHLKY 243
           T L+D+   K++EF+ IVKIGRTHLQDATPLTLGQEFSGYVQQL NGI+R+E +L HLK+
Sbjct: 194 TALRDSFATKSKEFESIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGISRVEQSLIHLKF 253

Query: 244 LAQGGTAVGTGLNTKEGFDKLIAEQISKETGIDFKTAPNKFEALAAHDAIVEASGALNTV 303
           LAQGGTAVGTGLNTK GF + IAEQ+SKETGIDFKTAPNKFEALAAHDAIVE SGALNT+
Sbjct: 254 LAQGGTAVGTGLNTKVGFGEKIAEQVSKETGIDFKTAPNKFEALAAHDAIVECSGALNTL 313

Query: 304 ACSLFKIAQDIRYLGSGPRCGYGELHLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNN 363
           ACSLFKIA DIRYLGSGPRCGYGEL LPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNN
Sbjct: 314 ACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNN 373

Query: 364 AAVTFAGANGQFELNVFKPVMISNLLSSIRLLADACHSFRVHCVEGIEANREKINHNLHN 423
           AA+TFAGA+GQFELNVFKPVMISNLLSS+RLL DAC+SFRVHCV+GIEANR+KI   LH 
Sbjct: 374 AAITFAGASGQFELNVFKPVMISNLLSSVRLLGDACYSFRVHCVDGIEANRDKIAKLLHE 433

Query: 424 SLMLVTALNPKIGYDAASKIAKNAFKKNITLKESALELKYLTSEEFDEWVIPENMVGP 481
           SLMLVTALNPKIGYDAASK+AKNA KK ITLKESALELK LTS EFD+WV+PENMVGP
Sbjct: 434 SLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALELKVLTSAEFDQWVVPENMVGP 491

>SAKL0E00946g Chr5 (72220..73701) [1482 bp, 493 aa] {ON} highly
           similar to uniprot|P08417 Saccharomyces cerevisiae
           YPL262W FUM1 Fumarase converts fumaric acid to L-malic
           acid in the TCA cycle cytosolic and mitochondrial
           localization determined by the N-terminal mitochondrial
           targeting sequence and protein conformation
          Length = 493

 Score =  832 bits (2148), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 399/491 (81%), Positives = 440/491 (89%), Gaps = 10/491 (2%)

Query: 1   MLRASSRAKTSLIGYSA-RMM---------HYRVETDTFGEIKVPADKYWGAQTQRSFQN 50
           MLR ++ A  +L+  S+ RM+          YR+ETD FGEIKVPADKYWGAQTQRSF+N
Sbjct: 1   MLRITAAANRNLLPSSSIRMLSTSSSLAQQKYRIETDAFGEIKVPADKYWGAQTQRSFEN 60

Query: 51  FKIGGARERMPEPIVRAFGVLKKSAAIVNEKLGTLDSEIAGPIQQAADEVAKGKLNDHFP 110
           FKIGGARERMPE +VRAFGVLKKSAAIVNE LGTLD EI+ PIQ+AADEV +GKL DHFP
Sbjct: 61  FKIGGARERMPEAVVRAFGVLKKSAAIVNESLGTLDPEISKPIQKAADEVIQGKLMDHFP 120

Query: 111 LVVFQTGSGTQSNMNANEVISNRAIELIGGELGSKKIHPNNHCNQAQSSNDTFPSVMHIA 170
           LVVFQTGSGTQSNMNANEVISNRAIE+IGGE GSK++HPNNHCNQAQSSNDTFPSVMHIA
Sbjct: 121 LVVFQTGSGTQSNMNANEVISNRAIEIIGGEKGSKQVHPNNHCNQAQSSNDTFPSVMHIA 180

Query: 171 AVTEITNSLLPEITQLKDALHKKAEEFQDIVKIGRTHLQDATPLTLGQEFSGYVQQLVNG 230
           AVTEIT+SLLPE+T L+D+  KK++EF  IVKIGRTHLQDATPLTLGQEFSGYVQQL NG
Sbjct: 181 AVTEITHSLLPELTALRDSFQKKSDEFSSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNG 240

Query: 231 IARIENTLPHLKYLAQGGTAVGTGLNTKEGFDKLIAEQISKETGIDFKTAPNKFEALAAH 290
           IAR+E +L HLK+LAQGGTAVGTGLNTK GF + IAEQ+SKETGIDFKTAPNKFEALAAH
Sbjct: 241 IARVEQSLHHLKFLAQGGTAVGTGLNTKVGFAEKIAEQVSKETGIDFKTAPNKFEALAAH 300

Query: 291 DAIVEASGALNTVACSLFKIAQDIRYLGSGPRCGYGELHLPENEPGSSIMPGKVNPTQNE 350
           DA+VE SGALNT+ACSLFKIA DIRYLGSGPRCGYGEL LPENEPGSSIMPGKVNPTQNE
Sbjct: 301 DAVVECSGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNE 360

Query: 351 AMTQVCVQVMGNNAAVTFAGANGQFELNVFKPVMISNLLSSIRLLADACHSFRVHCVEGI 410
           AMTQVCVQVMGNNAA+TFAGA+GQFELNVFKPVMISNLLSS+RLLADA +SFRVHCV+GI
Sbjct: 361 AMTQVCVQVMGNNAAITFAGASGQFELNVFKPVMISNLLSSVRLLADASYSFRVHCVDGI 420

Query: 411 EANREKINHNLHNSLMLVTALNPKIGYDAASKIAKNAFKKNITLKESALELKYLTSEEFD 470
           +AN ++I+  LH SLMLVTALNPKIGYDAASK+AKNA KK ITLKESAL+L  L  +EFD
Sbjct: 421 KANEDRISKLLHESLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALQLGVLNEKEFD 480

Query: 471 EWVIPENMVGP 481
           EWVIPE M+GP
Sbjct: 481 EWVIPEKMIGP 491

>KLLA0D00902g Chr4 (83648..85126) [1479 bp, 492 aa] {ON} highly
           similar to uniprot|P08417 Saccharomyces cerevisiae
           YPL262W FUM1 Fumarase converts fumaric acid to L-malic
           acid in the TCA cycle cytosolic and mitochondrial
           localization determined by the N-terminal mitochondrial
           targeting sequence and protein conformation
          Length = 492

 Score =  829 bits (2141), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 397/466 (85%), Positives = 432/466 (92%)

Query: 16  SARMMHYRVETDTFGEIKVPADKYWGAQTQRSFQNFKIGGARERMPEPIVRAFGVLKKSA 75
           S RM+ YRVETD FGEI+VP+DKYWGAQTQRS QNFKIGG RERMPEPIV+AFGVLKKSA
Sbjct: 25  SLRMVSYRVETDAFGEIQVPSDKYWGAQTQRSLQNFKIGGPRERMPEPIVKAFGVLKKSA 84

Query: 76  AIVNEKLGTLDSEIAGPIQQAADEVAKGKLNDHFPLVVFQTGSGTQSNMNANEVISNRAI 135
           A+VNE+LGTLD EIA PI+QAADEVA+GKL +HFPLVVFQTGSGTQSNMNANEVISNRAI
Sbjct: 85  AVVNERLGTLDPEIAKPIKQAADEVAQGKLMEHFPLVVFQTGSGTQSNMNANEVISNRAI 144

Query: 136 ELIGGELGSKKIHPNNHCNQAQSSNDTFPSVMHIAAVTEITNSLLPEITQLKDALHKKAE 195
           ELIGGELGSKKIHPNNHCNQAQSSNDTFPSVMHIAAVTEIT+ LLPE+  LK AL +K++
Sbjct: 145 ELIGGELGSKKIHPNNHCNQAQSSNDTFPSVMHIAAVTEITHHLLPELEGLKVALKQKSD 204

Query: 196 EFQDIVKIGRTHLQDATPLTLGQEFSGYVQQLVNGIARIENTLPHLKYLAQGGTAVGTGL 255
           EFQ IVKIGRTHLQDATPLTLGQEFSGYVQQ+ NGIAR++ +L HLK+LAQGGTAVGTGL
Sbjct: 205 EFQHIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIARVKQSLYHLKFLAQGGTAVGTGL 264

Query: 256 NTKEGFDKLIAEQISKETGIDFKTAPNKFEALAAHDAIVEASGALNTVACSLFKIAQDIR 315
           NTK GF + IAEQ+SKETGIDFKTAPNKFEALAAHDA+VEASGALNT+A SLFKIA DIR
Sbjct: 265 NTKVGFAEDIAEQVSKETGIDFKTAPNKFEALAAHDAVVEASGALNTLAVSLFKIANDIR 324

Query: 316 YLGSGPRCGYGELHLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAVTFAGANGQF 375
           YLGSGPRCGYGEL LPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGN+AA+TFAGA+GQF
Sbjct: 325 YLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNHAAITFAGASGQF 384

Query: 376 ELNVFKPVMISNLLSSIRLLADACHSFRVHCVEGIEANREKINHNLHNSLMLVTALNPKI 435
           ELNVFKPVMISNLLSSIRLL DA +SFR+HCVEGI+AN ++I   LH SLMLVTALNPKI
Sbjct: 385 ELNVFKPVMISNLLSSIRLLGDASNSFRIHCVEGIKANEDRIAKLLHESLMLVTALNPKI 444

Query: 436 GYDAASKIAKNAFKKNITLKESALELKYLTSEEFDEWVIPENMVGP 481
           GYDAASK+AKNA KK ITLKESALELK L+SEEFD+WVIPE M+GP
Sbjct: 445 GYDAASKVAKNAHKKGITLKESALELKVLSSEEFDQWVIPEKMIGP 490

>NCAS0D02620 Chr4 complement(504150..505631) [1482 bp, 493 aa] {ON}
           Anc_6.13 YPL262W
          Length = 493

 Score =  827 bits (2135), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 385/466 (82%), Positives = 433/466 (92%)

Query: 16  SARMMHYRVETDTFGEIKVPADKYWGAQTQRSFQNFKIGGARERMPEPIVRAFGVLKKSA 75
           +A    YR+ETD+FGEIKVPADKYWGAQTQRSFQNFKIGG+RER+P+PI+ AFG+LKKSA
Sbjct: 26  AASQQQYRIETDSFGEIKVPADKYWGAQTQRSFQNFKIGGSRERIPDPIITAFGILKKSA 85

Query: 76  AIVNEKLGTLDSEIAGPIQQAADEVAKGKLNDHFPLVVFQTGSGTQSNMNANEVISNRAI 135
           AIVNE LGTLD ++A PI++AADEV +GKL DHFPLVVFQTGSGTQ+NMN NEVISNRAI
Sbjct: 86  AIVNESLGTLDPKVADPIKKAADEVVQGKLKDHFPLVVFQTGSGTQTNMNVNEVISNRAI 145

Query: 136 ELIGGELGSKKIHPNNHCNQAQSSNDTFPSVMHIAAVTEITNSLLPEITQLKDALHKKAE 195
           EL+GG+LGSK+IHPNNHCNQ+QSSNDTFPSVMHIAAV EITNSL+PE+T+LKDAL  KA+
Sbjct: 146 ELVGGKLGSKQIHPNNHCNQSQSSNDTFPSVMHIAAVLEITNSLIPELTKLKDALDVKAK 205

Query: 196 EFQDIVKIGRTHLQDATPLTLGQEFSGYVQQLVNGIARIENTLPHLKYLAQGGTAVGTGL 255
           EF DIVKIGRTHLQDATPLTLGQEFSGYVQQL NGI RIE++L HLK+LAQGGTAVGTGL
Sbjct: 206 EFADIVKIGRTHLQDATPLTLGQEFSGYVQQLENGIYRIESSLYHLKFLAQGGTAVGTGL 265

Query: 256 NTKEGFDKLIAEQISKETGIDFKTAPNKFEALAAHDAIVEASGALNTVACSLFKIAQDIR 315
           NTK GFDKLIAE++SKETGI+FKTAPNKFEALAAHDAIV ASGALNTVA SLFKIAQDIR
Sbjct: 266 NTKIGFDKLIAEEVSKETGIEFKTAPNKFEALAAHDAIVFASGALNTVAGSLFKIAQDIR 325

Query: 316 YLGSGPRCGYGELHLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAVTFAGANGQF 375
           YLGSGPRCGYGEL LPENEPGSSIMPGKVNPTQNEAMTQVCVQ+MGNN  ++ AG+ GQF
Sbjct: 326 YLGSGPRCGYGELQLPENEPGSSIMPGKVNPTQNEAMTQVCVQIMGNNQTISIAGSQGQF 385

Query: 376 ELNVFKPVMISNLLSSIRLLADACHSFRVHCVEGIEANREKINHNLHNSLMLVTALNPKI 435
           ELNV+KP+MI+NLL+SIRL+ DAC SFR+HC++ ++AN++KIN NL+ SLMLVTALNPKI
Sbjct: 386 ELNVYKPLMIANLLNSIRLMTDACKSFRIHCIDDLKANKDKINENLNKSLMLVTALNPKI 445

Query: 436 GYDAASKIAKNAFKKNITLKESALELKYLTSEEFDEWVIPENMVGP 481
           GYDAASKIAKNA  KNITLKESALELKYLT+EEFDEWV+PENM+GP
Sbjct: 446 GYDAASKIAKNAHLKNITLKESALELKYLTAEEFDEWVVPENMIGP 491

>Kwal_56.22362 s56 (65537..67018) [1482 bp, 493 aa] {ON} YPL262W
           (FUM1) - mitochondrial and cytoplasmic fumarase
           (fumarate hydralase) [contig 186] FULL
          Length = 493

 Score =  822 bits (2124), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 394/477 (82%), Positives = 429/477 (89%), Gaps = 1/477 (0%)

Query: 6   SRAKTSLIGYSARM-MHYRVETDTFGEIKVPADKYWGAQTQRSFQNFKIGGARERMPEPI 64
           S +K  LI  S+ +   YRVETD FGEIKVP DK WGAQTQRS +NFKIGG RERMPEPI
Sbjct: 15  SGSKARLISTSSSLGQKYRVETDAFGEIKVPTDKLWGAQTQRSLENFKIGGQRERMPEPI 74

Query: 65  VRAFGVLKKSAAIVNEKLGTLDSEIAGPIQQAADEVAKGKLNDHFPLVVFQTGSGTQSNM 124
           V+AFG+LKKSAAIVNE LGTLD +++ PIQ AADEV  GKL DHFPLVVFQTGSGTQSNM
Sbjct: 75  VKAFGILKKSAAIVNESLGTLDPKVSKPIQDAADEVISGKLIDHFPLVVFQTGSGTQSNM 134

Query: 125 NANEVISNRAIELIGGELGSKKIHPNNHCNQAQSSNDTFPSVMHIAAVTEITNSLLPEIT 184
           NANEVISNRAI+L+GGE+GSK IHPNNHCNQAQSSNDTFPSVMHIAAVTE+T+ LLPE+ 
Sbjct: 135 NANEVISNRAIQLVGGEVGSKSIHPNNHCNQAQSSNDTFPSVMHIAAVTEVTHLLLPELI 194

Query: 185 QLKDALHKKAEEFQDIVKIGRTHLQDATPLTLGQEFSGYVQQLVNGIARIENTLPHLKYL 244
            L+DA  KKA+EF  IVKIGRTHLQDATPLTLGQEFSGYVQQL NGI+R+E++L +LK+L
Sbjct: 195 ALRDAFAKKAQEFDSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGISRVEHSLHNLKFL 254

Query: 245 AQGGTAVGTGLNTKEGFDKLIAEQISKETGIDFKTAPNKFEALAAHDAIVEASGALNTVA 304
           AQGGTAVGTGLNTK GF + IAEQ+SKETGIDFKTAPNKFEALAAHDA+VE SGALNT+A
Sbjct: 255 AQGGTAVGTGLNTKVGFAEKIAEQVSKETGIDFKTAPNKFEALAAHDAVVECSGALNTLA 314

Query: 305 CSLFKIAQDIRYLGSGPRCGYGELHLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNA 364
           CSLFKIA DIRYLGSGPRCGYGEL LPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNA
Sbjct: 315 CSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNA 374

Query: 365 AVTFAGANGQFELNVFKPVMISNLLSSIRLLADACHSFRVHCVEGIEANREKINHNLHNS 424
           A+TFAGA+GQFELNVFKPVMISNLLSSIRLL DAC+SFRVHCVEGI+AN +KI   LH S
Sbjct: 375 AITFAGASGQFELNVFKPVMISNLLSSIRLLGDACYSFRVHCVEGIQANEDKIAKLLHES 434

Query: 425 LMLVTALNPKIGYDAASKIAKNAFKKNITLKESALELKYLTSEEFDEWVIPENMVGP 481
           LMLVTALNPKIGYDAASK+AKNA KK ITLKESALEL  L+S EFDEWV+PENMVGP
Sbjct: 435 LMLVTALNPKIGYDAASKVAKNAHKKGITLKESALELGVLSSAEFDEWVVPENMVGP 491

>TDEL0G04580 Chr7 complement(836367..837821) [1455 bp, 484 aa] {ON}
           Anc_6.13 YPL262W
          Length = 484

 Score =  821 bits (2120), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 392/482 (81%), Positives = 433/482 (89%), Gaps = 1/482 (0%)

Query: 1   MLRASSRAK-TSLIGYSARMMHYRVETDTFGEIKVPADKYWGAQTQRSFQNFKIGGARER 59
           MLR    ++  S++  S +   +RVETD FGEIKV AD+YWGAQTQRS +NF+IGG RER
Sbjct: 1   MLRTGLLSRPLSVVKMSTKAGQFRVETDAFGEIKVAADRYWGAQTQRSLENFRIGGPRER 60

Query: 60  MPEPIVRAFGVLKKSAAIVNEKLGTLDSEIAGPIQQAADEVAKGKLNDHFPLVVFQTGSG 119
           MPEPIVRAFGVLKKSAA+VNE LGTLD ++A PI+QAADEVA+GKL  HFPLVVFQTGSG
Sbjct: 61  MPEPIVRAFGVLKKSAAVVNESLGTLDPKVAEPIKQAADEVAQGKLTAHFPLVVFQTGSG 120

Query: 120 TQSNMNANEVISNRAIELIGGELGSKKIHPNNHCNQAQSSNDTFPSVMHIAAVTEITNSL 179
           TQSNMNANEVISNRAIELIGGELGSK+IHPNNHCNQAQSSNDTFPSVMHIAAVTEIT  L
Sbjct: 121 TQSNMNANEVISNRAIELIGGELGSKQIHPNNHCNQAQSSNDTFPSVMHIAAVTEITRHL 180

Query: 180 LPEITQLKDALHKKAEEFQDIVKIGRTHLQDATPLTLGQEFSGYVQQLVNGIARIENTLP 239
           LPE+  L+D+L  K++EF DIVKIGRTHLQDATPLTLGQEFSGYVQQ+ NGI R+E +L 
Sbjct: 181 LPELAHLRDSLDAKSKEFSDIVKIGRTHLQDATPLTLGQEFSGYVQQVSNGIDRVEGSLH 240

Query: 240 HLKYLAQGGTAVGTGLNTKEGFDKLIAEQISKETGIDFKTAPNKFEALAAHDAIVEASGA 299
            LKYLAQGGTAVGTGLNTK GF + IAEQ+SKETG+DFKTAPNKFEALAAHDA+VEASGA
Sbjct: 241 RLKYLAQGGTAVGTGLNTKIGFAEKIAEQVSKETGLDFKTAPNKFEALAAHDAVVEASGA 300

Query: 300 LNTVACSLFKIAQDIRYLGSGPRCGYGELHLPENEPGSSIMPGKVNPTQNEAMTQVCVQV 359
           LNTVACSLFKIAQDIRYLGSGPRCGYGEL LPENEPGSSIMPGKVNPTQNEA+TQVCVQV
Sbjct: 301 LNTVACSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQVCVQV 360

Query: 360 MGNNAAVTFAGANGQFELNVFKPVMISNLLSSIRLLADACHSFRVHCVEGIEANREKINH 419
           MGNNAA+TFAGA+GQFELNVFKPVMISNLLSS+RLLADA +SFRVHCV+GI ANR++I  
Sbjct: 361 MGNNAAITFAGASGQFELNVFKPVMISNLLSSVRLLADASYSFRVHCVDGIIANRDRIGK 420

Query: 420 NLHNSLMLVTALNPKIGYDAASKIAKNAFKKNITLKESALELKYLTSEEFDEWVIPENMV 479
            +H SLMLVTALNPKIGYDAASK+AKNA KK ITLK+SAL+L  LT  EFDEWV+PENM+
Sbjct: 421 LMHESLMLVTALNPKIGYDAASKVAKNAHKKGITLKQSALDLGVLTESEFDEWVVPENMI 480

Query: 480 GP 481
           GP
Sbjct: 481 GP 482

>Ecym_3016 Chr3 (30897..32366) [1470 bp, 489 aa] {ON} similar to
           Ashbya gossypii ACR013C
          Length = 489

 Score =  812 bits (2098), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 386/481 (80%), Positives = 428/481 (88%), Gaps = 3/481 (0%)

Query: 3   RASSRAKTSLIGYSARMMHYRVETDTFGEIKVPADKYWGAQTQRSFQNFKIGGARERMPE 62
           R + R  ++  G + +   +R+ETD FGEIKVPA+KYWGAQTQRS +NFKIGG RERMPE
Sbjct: 12  RIADRMMSTTAGLNQK---FRIETDAFGEIKVPANKYWGAQTQRSLENFKIGGPRERMPE 68

Query: 63  PIVRAFGVLKKSAAIVNEKLGTLDSEIAGPIQQAADEVAKGKLNDHFPLVVFQTGSGTQS 122
           PI++AFG+LKKSAAIVNE LGTLD +I+ PIQQAADEV +GKL DHFPLVVFQTGSGTQS
Sbjct: 69  PIIKAFGILKKSAAIVNESLGTLDPKISKPIQQAADEVIEGKLLDHFPLVVFQTGSGTQS 128

Query: 123 NMNANEVISNRAIELIGGELGSKKIHPNNHCNQAQSSNDTFPSVMHIAAVTEITNSLLPE 182
           NMNANEVISNRAIELIGGELG+K+IHPNNHCNQAQSSNDTFPSVMHIAAVTEITN+LLPE
Sbjct: 129 NMNANEVISNRAIELIGGELGTKQIHPNNHCNQAQSSNDTFPSVMHIAAVTEITNTLLPE 188

Query: 183 ITQLKDALHKKAEEFQDIVKIGRTHLQDATPLTLGQEFSGYVQQLVNGIARIENTLPHLK 242
           +T L+D+  KK EEF  IVKIGRTHLQDATPLTLGQEF GY QQ+ NGI R+E +L HLK
Sbjct: 189 LTALRDSFQKKTEEFSHIVKIGRTHLQDATPLTLGQEFGGYTQQITNGITRVEQSLHHLK 248

Query: 243 YLAQGGTAVGTGLNTKEGFDKLIAEQISKETGIDFKTAPNKFEALAAHDAIVEASGALNT 302
           +LAQGGTAVGTGLNTK GF + IAEQ+SKET I+FKTAPNKFEALAAHDA+VE SGALNT
Sbjct: 249 FLAQGGTAVGTGLNTKVGFAEKIAEQVSKETNIEFKTAPNKFEALAAHDAVVECSGALNT 308

Query: 303 VACSLFKIAQDIRYLGSGPRCGYGELHLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGN 362
           VACSLFKIA DIRYLGSGPRCGYGEL LPENEPGSSIMPGKVNPTQNEAMTQ CVQVMGN
Sbjct: 309 VACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQACVQVMGN 368

Query: 363 NAAVTFAGANGQFELNVFKPVMISNLLSSIRLLADACHSFRVHCVEGIEANREKINHNLH 422
           N+ +TFAGA+GQFELNVFKPVMISNLL+SIRLLADA +SFRVHCV+GI+AN +KI   LH
Sbjct: 369 NSTITFAGASGQFELNVFKPVMISNLLNSIRLLADASYSFRVHCVDGIKANEDKIAKILH 428

Query: 423 NSLMLVTALNPKIGYDAASKIAKNAFKKNITLKESALELKYLTSEEFDEWVIPENMVGPT 482
            SLMLVTALNPKIGYD+A K+AKNA KKNITLKESALEL  L+ EEF EWV+PE M+GPT
Sbjct: 429 ESLMLVTALNPKIGYDSACKVAKNAHKKNITLKESALELGVLSEEEFSEWVVPEKMIGPT 488

Query: 483 K 483
           K
Sbjct: 489 K 489

>Kpol_1032.4 s1032 (3761..5164) [1404 bp, 467 aa] {ON} (3761..5164)
           [1404 nt, 468 aa]
          Length = 467

 Score =  811 bits (2095), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 386/461 (83%), Positives = 429/461 (93%)

Query: 22  YRVETDTFGEIKVPADKYWGAQTQRSFQNFKIGGARERMPEPIVRAFGVLKKSAAIVNEK 81
           +R+ETD FGEIKVPADKYWGAQTQRS++NFKIGG RERMPEP+V+AFGVLKKSAAIVNE+
Sbjct: 7   FRLETDGFGEIKVPADKYWGAQTQRSYENFKIGGPRERMPEPVVKAFGVLKKSAAIVNEE 66

Query: 82  LGTLDSEIAGPIQQAADEVAKGKLNDHFPLVVFQTGSGTQSNMNANEVISNRAIELIGGE 141
            G LD+ I+  IQQAADEV +GKLN+HFPLVVFQTGSGTQSNMNANEVISNRAIEL GG 
Sbjct: 67  FGILDAGISKLIQQAADEVIEGKLNEHFPLVVFQTGSGTQSNMNANEVISNRAIELKGGI 126

Query: 142 LGSKKIHPNNHCNQAQSSNDTFPSVMHIAAVTEITNSLLPEITQLKDALHKKAEEFQDIV 201
           +GSK+IHPNNHCN AQSSNDTFP+VMHIAAVTEIT+ L+P++T+LKDAL  K++EF+ IV
Sbjct: 127 MGSKEIHPNNHCNMAQSSNDTFPTVMHIAAVTEITHHLIPKMTELKDALANKSKEFEHIV 186

Query: 202 KIGRTHLQDATPLTLGQEFSGYVQQLVNGIARIENTLPHLKYLAQGGTAVGTGLNTKEGF 261
           KIGRTHLQDATPLTLGQEFSGYVQQL+NGIARIE++L +LK+LAQGGTAVGTGLNTK GF
Sbjct: 187 KIGRTHLQDATPLTLGQEFSGYVQQLINGIARIEHSLINLKFLAQGGTAVGTGLNTKIGF 246

Query: 262 DKLIAEQISKETGIDFKTAPNKFEALAAHDAIVEASGALNTVACSLFKIAQDIRYLGSGP 321
            + IAEQ+SKETGI+FKTAPNKFEALAAHDAIVE+SGALNTVACSLFKIAQDIRYLGSGP
Sbjct: 247 AERIAEQVSKETGIEFKTAPNKFEALAAHDAIVESSGALNTVACSLFKIAQDIRYLGSGP 306

Query: 322 RCGYGELHLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAVTFAGANGQFELNVFK 381
           RCGYGEL LPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAA+TFAGA+GQFELNVFK
Sbjct: 307 RCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAITFAGASGQFELNVFK 366

Query: 382 PVMISNLLSSIRLLADACHSFRVHCVEGIEANREKINHNLHNSLMLVTALNPKIGYDAAS 441
           PVMISNLLSSIRLL DACHSF +HCVEGI+AN +KIN  LH SLMLVTALNPKIGYD+A+
Sbjct: 367 PVMISNLLSSIRLLGDACHSFTIHCVEGIQANEDKINKLLHESLMLVTALNPKIGYDSAT 426

Query: 442 KIAKNAFKKNITLKESALELKYLTSEEFDEWVIPENMVGPT 482
           K+AKNA KK ITLKESALEL  LT +EFDEWV+PE M+GP+
Sbjct: 427 KVAKNAHKKGITLKESALELGVLTEDEFDEWVVPEKMLGPS 467

>KNAG0E02750 Chr5 (547746..549242) [1497 bp, 498 aa] {ON} Anc_6.13
           YPL262W
          Length = 498

 Score =  794 bits (2050), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 371/460 (80%), Positives = 417/460 (90%)

Query: 22  YRVETDTFGEIKVPADKYWGAQTQRSFQNFKIGGARERMPEPIVRAFGVLKKSAAIVNEK 81
           +RVETD+FGEI VPAD+YWGAQTQRSFQNFKIGG RE++PEP+VRAFG+LKKSAA VNE 
Sbjct: 37  FRVETDSFGEINVPADRYWGAQTQRSFQNFKIGGDREKIPEPVVRAFGILKKSAATVNEN 96

Query: 82  LGTLDSEIAGPIQQAADEVAKGKLNDHFPLVVFQTGSGTQSNMNANEVISNRAIELIGGE 141
           LGTLD  IA  I+ AADEVA+GKL+DHFPLVVFQTGSGTQSNMNANEVISNRAIEL+GGE
Sbjct: 97  LGTLDKSIAAKIKLAADEVAEGKLSDHFPLVVFQTGSGTQSNMNANEVISNRAIELLGGE 156

Query: 142 LGSKKIHPNNHCNQAQSSNDTFPSVMHIAAVTEITNSLLPEITQLKDALHKKAEEFQDIV 201
           LGSK++HPNNH NQ+QSSNDTFP+VMHIAA TEI N L+PE+  LKDAL  K EEF  IV
Sbjct: 157 LGSKQVHPNNHVNQSQSSNDTFPTVMHIAATTEIANKLIPELQNLKDALQHKVEEFSSIV 216

Query: 202 KIGRTHLQDATPLTLGQEFSGYVQQLVNGIARIENTLPHLKYLAQGGTAVGTGLNTKEGF 261
           KIGRTHLQDATPLTLGQEFSGYVQQ+ NGI R++++L HL +LAQGGTAVGTGLNTK GF
Sbjct: 217 KIGRTHLQDATPLTLGQEFSGYVQQVENGIQRVQSSLYHLHFLAQGGTAVGTGLNTKVGF 276

Query: 262 DKLIAEQISKETGIDFKTAPNKFEALAAHDAIVEASGALNTVACSLFKIAQDIRYLGSGP 321
           DKL+AE++SKETG+ F+TAPNKFEALAAHDAIVEASGALNT+ACSLFKIAQDIRYLGSGP
Sbjct: 277 DKLVAEEVSKETGLHFETAPNKFEALAAHDAIVEASGALNTLACSLFKIAQDIRYLGSGP 336

Query: 322 RCGYGELHLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAVTFAGANGQFELNVFK 381
           RCGYGEL LP NEPGSSIMPGKVNPTQNEAMTQVCVQVMGNN+ +TFAG+ GQFELNV+K
Sbjct: 337 RCGYGELILPANEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNSTITFAGSQGQFELNVYK 396

Query: 382 PVMISNLLSSIRLLADACHSFRVHCVEGIEANREKINHNLHNSLMLVTALNPKIGYDAAS 441
           P+MISNLLSSIRLL DA  SFR+HC+  ++AN++KI+ NL+ SLMLVTALNPKIGYDAA+
Sbjct: 397 PLMISNLLSSIRLLTDASKSFRIHCLNDLKANKDKIDENLNKSLMLVTALNPKIGYDAAA 456

Query: 442 KIAKNAFKKNITLKESALELKYLTSEEFDEWVIPENMVGP 481
           K+AKNA  KNITLKESALEL  LT +EFDEWVIPENM+ P
Sbjct: 457 KVAKNAHHKNITLKESALELGVLTEKEFDEWVIPENMISP 496

>Kpol_1045.76 s1045 complement(177447..178904) [1458 bp, 485 aa]
           {ON} complement(177449..178906) [1458 nt, 486 aa]
          Length = 485

 Score =  793 bits (2048), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 385/484 (79%), Positives = 425/484 (87%), Gaps = 2/484 (0%)

Query: 1   MLRASSRAKTSLIG--YSARMMHYRVETDTFGEIKVPADKYWGAQTQRSFQNFKIGGARE 58
           MLR++ R  T  +   Y + +  +RVETD FGEIKVPA+KYWGAQT+RSF+NFKIGG+RE
Sbjct: 1   MLRSAIRPNTVRVQTRYISNLKGFRVETDGFGEIKVPANKYWGAQTERSFENFKIGGSRE 60

Query: 59  RMPEPIVRAFGVLKKSAAIVNEKLGTLDSEIAGPIQQAADEVAKGKLNDHFPLVVFQTGS 118
           RMPE +VRAFGVLKK AAIVN +LG LD   +  IQQAADEVA GKLNDHFPLVVFQTGS
Sbjct: 61  RMPEAVVRAFGVLKKCAAIVNTELGGLDPATSKLIQQAADEVATGKLNDHFPLVVFQTGS 120

Query: 119 GTQSNMNANEVISNRAIELIGGELGSKKIHPNNHCNQAQSSNDTFPSVMHIAAVTEITNS 178
           GTQSNMNANEVISNRAIEL GG LGSK+IHPNNHCN AQSSNDTFP+VMHIAAVT+I+  
Sbjct: 121 GTQSNMNANEVISNRAIELKGGVLGSKEIHPNNHCNMAQSSNDTFPTVMHIAAVTQISQH 180

Query: 179 LLPEITQLKDALHKKAEEFQDIVKIGRTHLQDATPLTLGQEFSGYVQQLVNGIARIENTL 238
           LLPE+T L+DAL  K+ EF+ IVKIGRTHLQDATPLTLGQEFSGYVQQL NGI RIE   
Sbjct: 181 LLPELTHLRDALAAKSAEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIERIERAQ 240

Query: 239 PHLKYLAQGGTAVGTGLNTKEGFDKLIAEQISKETGIDFKTAPNKFEALAAHDAIVEASG 298
            +L++LAQGGTAVGTGLNTK G+ + IA +ISKETG+ FKTAPNKFEALAAHDAIVEASG
Sbjct: 241 QNLRFLAQGGTAVGTGLNTKNGWAERIAAEISKETGLAFKTAPNKFEALAAHDAIVEASG 300

Query: 299 ALNTVACSLFKIAQDIRYLGSGPRCGYGELHLPENEPGSSIMPGKVNPTQNEAMTQVCVQ 358
           ALNTVACSLFKIAQDIRYLGSGPRCGYGEL LPENEPGSSIMPGKVNPTQNEAMTQVCVQ
Sbjct: 301 ALNTVACSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQ 360

Query: 359 VMGNNAAVTFAGANGQFELNVFKPVMISNLLSSIRLLADACHSFRVHCVEGIEANREKIN 418
           VMGNNAAVTFAGA+GQFELNVFKPV+ISNLLSS++LL DA  SFRVHCVEGI+AN  KI+
Sbjct: 361 VMGNNAAVTFAGASGQFELNVFKPVLISNLLSSVQLLGDASRSFRVHCVEGIKANEAKIS 420

Query: 419 HNLHNSLMLVTALNPKIGYDAASKIAKNAFKKNITLKESALELKYLTSEEFDEWVIPENM 478
             LH SLMLVTALNPKIGYDAA+K+AKNA KK ITLKESALEL  LT +EFDEWV+PE M
Sbjct: 421 ELLHRSLMLVTALNPKIGYDAATKVAKNAHKKGITLKESALELGVLTEKEFDEWVVPEKM 480

Query: 479 VGPT 482
           +GP+
Sbjct: 481 LGPS 484

>ACR013C Chr3 complement(381119..382585) [1467 bp, 488 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL262W
           (FUM1)
          Length = 488

 Score =  792 bits (2046), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 375/486 (77%), Positives = 423/486 (87%), Gaps = 5/486 (1%)

Query: 1   MLRAS-----SRAKTSLIGYSARMMHYRVETDTFGEIKVPADKYWGAQTQRSFQNFKIGG 55
           MLR S     S A   L+  +     +RVETD FGEI+VPADKYWGAQTQRS +NF+IGG
Sbjct: 1   MLRLSRGCVGSSAARRLMSTAGAPQQFRVETDAFGEIRVPADKYWGAQTQRSLENFRIGG 60

Query: 56  ARERMPEPIVRAFGVLKKSAAIVNEKLGTLDSEIAGPIQQAADEVAKGKLNDHFPLVVFQ 115
           ARERMPEP+VRAFGVLKKSAA+VNE+LGTL+  IA  IQQAADEVA+G+L +HFPLVVFQ
Sbjct: 61  ARERMPEPVVRAFGVLKKSAAVVNEQLGTLEPGIAKAIQQAADEVAQGQLMEHFPLVVFQ 120

Query: 116 TGSGTQSNMNANEVISNRAIELIGGELGSKKIHPNNHCNQAQSSNDTFPSVMHIAAVTEI 175
           TGSGTQSNMNANEVISNRAIEL+GGELGSK++HPNNHCNQAQSSNDTFPSVMHIAAVTEI
Sbjct: 121 TGSGTQSNMNANEVISNRAIELLGGELGSKQVHPNNHCNQAQSSNDTFPSVMHIAAVTEI 180

Query: 176 TNSLLPEITQLKDALHKKAEEFQDIVKIGRTHLQDATPLTLGQEFSGYVQQLVNGIARIE 235
           T SLLPE+  L+ +  +K +EF  IVKIGRTHLQDATPLTLGQEFSGY QQ+ NGIAR+E
Sbjct: 181 TRSLLPELEALRVSFQRKTDEFAHIVKIGRTHLQDATPLTLGQEFSGYTQQIANGIARVE 240

Query: 236 NTLPHLKYLAQGGTAVGTGLNTKEGFDKLIAEQISKETGIDFKTAPNKFEALAAHDAIVE 295
           +    L++LAQGGTAVGTGLNT+ GF + IA Q+S+ETG++F+TAPNKFEALAAHDA+VE
Sbjct: 241 HAQESLRFLAQGGTAVGTGLNTRRGFAEQIAAQVSRETGLEFRTAPNKFEALAAHDAVVE 300

Query: 296 ASGALNTVACSLFKIAQDIRYLGSGPRCGYGELHLPENEPGSSIMPGKVNPTQNEAMTQV 355
           ASGALNT+ACSLFKIA DIRYLGSGPRCGYGEL LPENEPGSSIMPGKVNPTQNEA+TQ 
Sbjct: 301 ASGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQA 360

Query: 356 CVQVMGNNAAVTFAGANGQFELNVFKPVMISNLLSSIRLLADACHSFRVHCVEGIEANRE 415
           CVQVMGNNAA+TFAGA+GQFELNVFKPVMI+NLLSS+RLLADA  SFRVHCV+GI+ N +
Sbjct: 361 CVQVMGNNAAITFAGASGQFELNVFKPVMIANLLSSVRLLADAARSFRVHCVDGIQDNED 420

Query: 416 KINHNLHNSLMLVTALNPKIGYDAASKIAKNAFKKNITLKESALELKYLTSEEFDEWVIP 475
           +I   LH SLMLVTALNPKIGYDAAS +AKNA KK ITL+ SALEL  LT  EFDEWV+P
Sbjct: 421 RIAKLLHESLMLVTALNPKIGYDAASAVAKNAHKKGITLRASALELGVLTDAEFDEWVVP 480

Query: 476 ENMVGP 481
           E M+GP
Sbjct: 481 EKMIGP 486

>KAFR0B06520 Chr2 (1352364..1353851) [1488 bp, 495 aa] {ON} Anc_6.13
           YPL262W
          Length = 495

 Score =  790 bits (2040), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 375/477 (78%), Positives = 419/477 (87%), Gaps = 7/477 (1%)

Query: 12  LIGYSARMM-------HYRVETDTFGEIKVPADKYWGAQTQRSFQNFKIGGARERMPEPI 64
           L  Y++R          +R ETD+FGEI VP DKYWGAQTQRS QNFKIGG RE++P PI
Sbjct: 17  LTSYTSRFYTMSSIKSSFRAETDSFGEINVPNDKYWGAQTQRSLQNFKIGGEREKIPIPI 76

Query: 65  VRAFGVLKKSAAIVNEKLGTLDSEIAGPIQQAADEVAKGKLNDHFPLVVFQTGSGTQSNM 124
           + AFG+LKKSAAIVNE+LGTLDSE+A  I  AADEV++GKLNDHFPLVVFQTGSGTQSNM
Sbjct: 77  IEAFGILKKSAAIVNERLGTLDSELAKNIIIAADEVSQGKLNDHFPLVVFQTGSGTQSNM 136

Query: 125 NANEVISNRAIELIGGELGSKKIHPNNHCNQAQSSNDTFPSVMHIAAVTEITNSLLPEIT 184
           NANEVISNRAIEL+GG+LGSK +HPNNH NQ+QSSNDTFP+VMHIAA+ EIT  LLPE+ 
Sbjct: 137 NANEVISNRAIELMGGKLGSKTVHPNNHVNQSQSSNDTFPTVMHIAAMLEITRKLLPELN 196

Query: 185 QLKDALHKKAEEFQDIVKIGRTHLQDATPLTLGQEFSGYVQQLVNGIARIENTLPHLKYL 244
            LK++L KK+ EF DIVKIGRTHLQDATPLTLGQEFSGYVQQ+ NGI RIE  L HLK+L
Sbjct: 197 SLKNSLDKKSNEFNDIVKIGRTHLQDATPLTLGQEFSGYVQQMTNGIRRIETALYHLKFL 256

Query: 245 AQGGTAVGTGLNTKEGFDKLIAEQISKETGIDFKTAPNKFEALAAHDAIVEASGALNTVA 304
           AQGGTAVGTGLNTK GFDKLIAEQIS+ETGI+F+TAPNKFEALAAHDAIVE SGALNT+A
Sbjct: 257 AQGGTAVGTGLNTKAGFDKLIAEQISEETGINFETAPNKFEALAAHDAIVEVSGALNTLA 316

Query: 305 CSLFKIAQDIRYLGSGPRCGYGELHLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNA 364
           CSLFKIAQDIRYLGSGPRCGYGEL LPENEPGSSIMPGKVNPTQNEAMTQVC+QVMGN++
Sbjct: 317 CSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCIQVMGNHS 376

Query: 365 AVTFAGANGQFELNVFKPVMISNLLSSIRLLADACHSFRVHCVEGIEANREKINHNLHNS 424
            +TFAG+ GQFELNV+KP++ISNLLSSIRLL DA +SFRVHC++G++ANRE I  NL+ S
Sbjct: 377 TITFAGSQGQFELNVYKPLLISNLLSSIRLLTDASYSFRVHCIDGLKANRENITENLNKS 436

Query: 425 LMLVTALNPKIGYDAASKIAKNAFKKNITLKESALELKYLTSEEFDEWVIPENMVGP 481
           LMLVTALNP IGYD ASKIAKNA  KNITLKESALEL  LT E+F EWVIPE M+GP
Sbjct: 437 LMLVTALNPYIGYDNASKIAKNAHHKNITLKESALELGLLTEEQFSEWVIPEKMIGP 493

>YPL262W Chr16 (47336..48802) [1467 bp, 488 aa] {ON}  FUM1Fumarase,
           converts fumaric acid to L-malic acid in the TCA cycle;
           cytosolic and mitochondrial distribution determined by
           the N-terminal targeting sequence, protein conformation,
           and status of glyoxylate shunt; phosphorylated in
           mitochondria
          Length = 488

 Score =  779 bits (2011), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 371/460 (80%), Positives = 413/460 (89%)

Query: 22  YRVETDTFGEIKVPADKYWGAQTQRSFQNFKIGGARERMPEPIVRAFGVLKKSAAIVNEK 81
           +R ETD FGEI VPADKYWGAQTQRSFQNFKIGGARERMP P+V AFGVLKKSAAIVNE 
Sbjct: 28  FRTETDAFGEIHVPADKYWGAQTQRSFQNFKIGGARERMPLPLVHAFGVLKKSAAIVNES 87

Query: 82  LGTLDSEIAGPIQQAADEVAKGKLNDHFPLVVFQTGSGTQSNMNANEVISNRAIELIGGE 141
           LG LD +I+  IQQAADEVA GKL+DHFPLVVFQTGSGTQSNMNANEVISNRAIE++GG+
Sbjct: 88  LGGLDPKISKAIQQAADEVASGKLDDHFPLVVFQTGSGTQSNMNANEVISNRAIEILGGK 147

Query: 142 LGSKKIHPNNHCNQAQSSNDTFPSVMHIAAVTEITNSLLPEITQLKDALHKKAEEFQDIV 201
           +GSK++HPNNHCNQ+QSSNDTFP+VMHIAA  +I N L+PE+T LK+AL  K++EF  IV
Sbjct: 148 IGSKQVHPNNHCNQSQSSNDTFPTVMHIAASLQIQNELIPELTNLKNALEAKSKEFDHIV 207

Query: 202 KIGRTHLQDATPLTLGQEFSGYVQQLVNGIARIENTLPHLKYLAQGGTAVGTGLNTKEGF 261
           KIGRTHLQDATPLTLGQEFSGYVQQ+ NGI R+ ++L  L +LAQGGTAVGTGLNTK GF
Sbjct: 208 KIGRTHLQDATPLTLGQEFSGYVQQVENGIQRVAHSLKTLSFLAQGGTAVGTGLNTKPGF 267

Query: 262 DKLIAEQISKETGIDFKTAPNKFEALAAHDAIVEASGALNTVACSLFKIAQDIRYLGSGP 321
           D  IAEQISKETG+ F+TAPNKFEALAAHDAIVE SGALNT+ACSLFKIAQDIRYLGSGP
Sbjct: 268 DVKIAEQISKETGLKFQTAPNKFEALAAHDAIVECSGALNTLACSLFKIAQDIRYLGSGP 327

Query: 322 RCGYGELHLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAVTFAGANGQFELNVFK 381
           RCGY EL LPENEPGSSIMPGKVNPTQNEA+TQVCVQVMGNNAA+TFAG+ GQFELNVFK
Sbjct: 328 RCGYHELMLPENEPGSSIMPGKVNPTQNEALTQVCVQVMGNNAAITFAGSQGQFELNVFK 387

Query: 382 PVMISNLLSSIRLLADACHSFRVHCVEGIEANREKINHNLHNSLMLVTALNPKIGYDAAS 441
           PVMI+NLL+SIRL+ DA +SFRVHCVEGI+AN  +I+  L  SLMLVTALNPKIGYDAAS
Sbjct: 388 PVMIANLLNSIRLITDAAYSFRVHCVEGIKANEPRIHELLTKSLMLVTALNPKIGYDAAS 447

Query: 442 KIAKNAFKKNITLKESALELKYLTSEEFDEWVIPENMVGP 481
           K+AKNA KK ITLKESALEL  LT +EFDEWV+PE+M+GP
Sbjct: 448 KVAKNAHKKGITLKESALELGVLTEKEFDEWVVPEHMLGP 487

>Smik_6.470 Chr6 complement(772380..773846) [1467 bp, 488 aa] {ON}
           YPL262W (REAL)
          Length = 488

 Score =  778 bits (2010), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 375/487 (77%), Positives = 425/487 (87%), Gaps = 6/487 (1%)

Query: 1   MLRASSRAKTSLI----GYSARMMH--YRVETDTFGEIKVPADKYWGAQTQRSFQNFKIG 54
           MLR ++ +  + +     ++ R M+  +R ETD FGEI VPADKYWGAQTQRSFQNFKIG
Sbjct: 1   MLRLTNSSCKAFVQSSYKFNIRRMNSTFRTETDAFGEINVPADKYWGAQTQRSFQNFKIG 60

Query: 55  GARERMPEPIVRAFGVLKKSAAIVNEKLGTLDSEIAGPIQQAADEVAKGKLNDHFPLVVF 114
           GARERMP P+V AFGVLKKSAAIVNE LG LD +I+  IQ+AADEVA GKL+DHFPLVVF
Sbjct: 61  GARERMPLPLVHAFGVLKKSAAIVNESLGGLDPKISKAIQEAADEVASGKLDDHFPLVVF 120

Query: 115 QTGSGTQSNMNANEVISNRAIELIGGELGSKKIHPNNHCNQAQSSNDTFPSVMHIAAVTE 174
           QTGSGTQSNMNANEVISNRAIE++GG++GSK++HPNNHCNQ+QSSNDTFP+VMHIAA  +
Sbjct: 121 QTGSGTQSNMNANEVISNRAIEILGGKIGSKEVHPNNHCNQSQSSNDTFPTVMHIAASLQ 180

Query: 175 ITNSLLPEITQLKDALHKKAEEFQDIVKIGRTHLQDATPLTLGQEFSGYVQQLVNGIARI 234
           I N L+PE+  LK+AL  K++EF  IVKIGRTHLQDATPLTLGQEFSGYVQQ+ NGI R+
Sbjct: 181 IQNELIPELANLKNALEAKSKEFDHIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRV 240

Query: 235 ENTLPHLKYLAQGGTAVGTGLNTKEGFDKLIAEQISKETGIDFKTAPNKFEALAAHDAIV 294
            ++L  L +LAQGGTAVGTGLNTK GFD  IAEQISKETG+ F+TAPNKFEALAAHDAIV
Sbjct: 241 AHSLKTLSFLAQGGTAVGTGLNTKPGFDVKIAEQISKETGLKFQTAPNKFEALAAHDAIV 300

Query: 295 EASGALNTVACSLFKIAQDIRYLGSGPRCGYGELHLPENEPGSSIMPGKVNPTQNEAMTQ 354
           E SGALNT+ACSLFKIAQDIRYLGSGPRCGY EL LPENEPGSSIMPGKVNPTQNEA+TQ
Sbjct: 301 ECSGALNTLACSLFKIAQDIRYLGSGPRCGYHELMLPENEPGSSIMPGKVNPTQNEALTQ 360

Query: 355 VCVQVMGNNAAVTFAGANGQFELNVFKPVMISNLLSSIRLLADACHSFRVHCVEGIEANR 414
           VCVQVMGNNAA+TFAG+ GQFELNVFKPVMI+NLL+SIRL+ DA +SFRVHCVEGI+AN 
Sbjct: 361 VCVQVMGNNAAITFAGSQGQFELNVFKPVMIANLLNSIRLITDAAYSFRVHCVEGIKANE 420

Query: 415 EKINHNLHNSLMLVTALNPKIGYDAASKIAKNAFKKNITLKESALELKYLTSEEFDEWVI 474
            +I+  L  SLMLVTALNPKIGYDAASK+AKNA KK ITLKESALEL  LT +EFDEWV+
Sbjct: 421 PRIHELLTKSLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALELGVLTEKEFDEWVV 480

Query: 475 PENMVGP 481
           PENM+GP
Sbjct: 481 PENMLGP 487

>Suva_16.43 Chr16 (62871..64337) [1467 bp, 488 aa] {ON} YPL262W
           (REAL)
          Length = 488

 Score =  778 bits (2008), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 376/487 (77%), Positives = 424/487 (87%), Gaps = 6/487 (1%)

Query: 1   MLRASSRAKTSLIGYS----ARMMH--YRVETDTFGEIKVPADKYWGAQTQRSFQNFKIG 54
           MLR S+ +  +++  S     R M+  +R ETD FGEI VPADKYWGAQTQRSFQNFKIG
Sbjct: 1   MLRFSNSSCKAILQSSYKVNIRRMNSTFRTETDAFGEINVPADKYWGAQTQRSFQNFKIG 60

Query: 55  GARERMPEPIVRAFGVLKKSAAIVNEKLGTLDSEIAGPIQQAADEVAKGKLNDHFPLVVF 114
           GARERMP P+V AFGVLKKSAAIVNE LG LD +++  IQQAADEVA GKL+DHFPLVVF
Sbjct: 61  GARERMPLPLVHAFGVLKKSAAIVNESLGGLDPKVSKAIQQAADEVAAGKLDDHFPLVVF 120

Query: 115 QTGSGTQSNMNANEVISNRAIELIGGELGSKKIHPNNHCNQAQSSNDTFPSVMHIAAVTE 174
           QTGSGTQSNMNANEVISNRAIE++GG++GSK++HPNN CNQ+QSSNDTFP+VMHIAA  +
Sbjct: 121 QTGSGTQSNMNANEVISNRAIEILGGKIGSKQVHPNNDCNQSQSSNDTFPTVMHIAASLQ 180

Query: 175 ITNSLLPEITQLKDALHKKAEEFQDIVKIGRTHLQDATPLTLGQEFSGYVQQLVNGIARI 234
           I   L+PE+T LK+AL  K++EF+ IVKIGRTHLQDATPLTLGQEFSGYVQQ+ NGI R+
Sbjct: 181 IEKELIPELTNLKNALEAKSKEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRV 240

Query: 235 ENTLPHLKYLAQGGTAVGTGLNTKEGFDKLIAEQISKETGIDFKTAPNKFEALAAHDAIV 294
            +TL  L +LAQGGTAVGTGLNTK GFD  IAEQISKETG+ F+TAPNKFEALAAHDAIV
Sbjct: 241 AHTLKTLSFLAQGGTAVGTGLNTKPGFDVKIAEQISKETGLKFQTAPNKFEALAAHDAIV 300

Query: 295 EASGALNTVACSLFKIAQDIRYLGSGPRCGYGELHLPENEPGSSIMPGKVNPTQNEAMTQ 354
           E SGALNT+ACSLFKIAQDIRYLGSGPRCGY EL LPENEPGSSIMPGKVNPTQNEA+TQ
Sbjct: 301 ECSGALNTLACSLFKIAQDIRYLGSGPRCGYNELMLPENEPGSSIMPGKVNPTQNEALTQ 360

Query: 355 VCVQVMGNNAAVTFAGANGQFELNVFKPVMISNLLSSIRLLADACHSFRVHCVEGIEANR 414
           VCVQVMGNNAA+TF G+ GQFELNVFKPVMI+NLL+SIRL+ADA  SFR+HCVEGI+AN 
Sbjct: 361 VCVQVMGNNAAITFGGSQGQFELNVFKPVMIANLLNSIRLIADASRSFRIHCVEGIKANE 420

Query: 415 EKINHNLHNSLMLVTALNPKIGYDAASKIAKNAFKKNITLKESALELKYLTSEEFDEWVI 474
            +I+  L  SLMLVTALNPKIGYDAASK+AKNA KK ITLKESALEL  LT +EFDEWV+
Sbjct: 421 PRIHELLTKSLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALELGVLTEKEFDEWVV 480

Query: 475 PENMVGP 481
           PENM+GP
Sbjct: 481 PENMLGP 487

>Skud_16.16 Chr16 (26407..27873) [1467 bp, 488 aa] {ON} YPL262W
           (REAL)
          Length = 488

 Score =  777 bits (2007), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 368/460 (80%), Positives = 413/460 (89%)

Query: 22  YRVETDTFGEIKVPADKYWGAQTQRSFQNFKIGGARERMPEPIVRAFGVLKKSAAIVNEK 81
           +R+ETD FGEI VPADKYWGAQTQRSFQNFKIGGARERMP P+V AFGVLKKSAA+VNE 
Sbjct: 28  FRIETDAFGEINVPADKYWGAQTQRSFQNFKIGGARERMPLPLVHAFGVLKKSAAVVNES 87

Query: 82  LGTLDSEIAGPIQQAADEVAKGKLNDHFPLVVFQTGSGTQSNMNANEVISNRAIELIGGE 141
           LG LD +I+  IQQAADEV  GKL+DHFPLVVFQTGSGTQSNMNANEVISNRAIE++GG+
Sbjct: 88  LGGLDPKISKAIQQAADEVTSGKLDDHFPLVVFQTGSGTQSNMNANEVISNRAIEILGGK 147

Query: 142 LGSKKIHPNNHCNQAQSSNDTFPSVMHIAAVTEITNSLLPEITQLKDALHKKAEEFQDIV 201
           +GSK++HPNNHCNQ+QSSNDTFP+VMHIAA  +I N L+PE+T LK+AL  K++EF+ IV
Sbjct: 148 IGSKEVHPNNHCNQSQSSNDTFPTVMHIAASLQIQNELIPELTNLKNALEAKSKEFEHIV 207

Query: 202 KIGRTHLQDATPLTLGQEFSGYVQQLVNGIARIENTLPHLKYLAQGGTAVGTGLNTKEGF 261
           KIGRTHLQDATPLTLGQEFSGYVQQ+ NGI R+ ++L  L +LAQGGTAVGTGLNTK GF
Sbjct: 208 KIGRTHLQDATPLTLGQEFSGYVQQVENGIQRVAHSLKTLSFLAQGGTAVGTGLNTKPGF 267

Query: 262 DKLIAEQISKETGIDFKTAPNKFEALAAHDAIVEASGALNTVACSLFKIAQDIRYLGSGP 321
           D  IAEQIS ETG+ F+TAPNKFEALAAHDAIVE SGALNT+ACSLFKIAQDIRYLGSGP
Sbjct: 268 DIKIAEQISSETGLKFQTAPNKFEALAAHDAIVECSGALNTLACSLFKIAQDIRYLGSGP 327

Query: 322 RCGYGELHLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAVTFAGANGQFELNVFK 381
           RCGY EL LPENEPGSSIMPGKVNPTQNEA+TQVCVQVMGNNAA+TFAG+ GQFELNVFK
Sbjct: 328 RCGYHELMLPENEPGSSIMPGKVNPTQNEALTQVCVQVMGNNAAITFAGSQGQFELNVFK 387

Query: 382 PVMISNLLSSIRLLADACHSFRVHCVEGIEANREKINHNLHNSLMLVTALNPKIGYDAAS 441
           PVMI+NLL+SIRL+ D+ +SFRVHCVEGI+AN  +I+  L  SLMLVTALNPKIGYDAAS
Sbjct: 388 PVMIANLLNSIRLITDSAYSFRVHCVEGIKANEPRIHELLTKSLMLVTALNPKIGYDAAS 447

Query: 442 KIAKNAFKKNITLKESALELKYLTSEEFDEWVIPENMVGP 481
           K+AKNA KK ITLKESALEL  LT +EFDEWV+PENM+GP
Sbjct: 448 KVAKNAHKKGITLKESALELGVLTEKEFDEWVVPENMLGP 487

>NDAI0I02470 Chr9 complement(567782..569209) [1428 bp, 475 aa] {ON}
           Anc_6.13 YPL262W
          Length = 475

 Score =  771 bits (1990), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 366/460 (79%), Positives = 420/460 (91%)

Query: 22  YRVETDTFGEIKVPADKYWGAQTQRSFQNFKIGGARERMPEPIVRAFGVLKKSAAIVNEK 81
           +RVETD+FGEIKVP++KYWGAQTQRSFQNFKIGG RE++P PI++AFG+LKKSAAIVN+ 
Sbjct: 14  FRVETDSFGEIKVPSNKYWGAQTQRSFQNFKIGGEREKIPLPIIKAFGILKKSAAIVNQS 73

Query: 82  LGTLDSEIAGPIQQAADEVAKGKLNDHFPLVVFQTGSGTQSNMNANEVISNRAIELIGGE 141
           LGTLD  IA PI +A+DEV +GKLNDHFPLVVFQTGSGTQ+NMNANEVISNRA ELIG E
Sbjct: 74  LGTLDPSIATPIIKASDEVIQGKLNDHFPLVVFQTGSGTQTNMNANEVISNRANELIGAE 133

Query: 142 LGSKKIHPNNHCNQAQSSNDTFPSVMHIAAVTEITNSLLPEITQLKDALHKKAEEFQDIV 201
           LGSKKIHPNNH NQ+QSSNDTFPSVMHIAAV E+ N+L+P++T+LK++L  KA+E+ +IV
Sbjct: 134 LGSKKIHPNNHVNQSQSSNDTFPSVMHIAAVLELNNNLIPQLTELKNSLDNKAKEYANIV 193

Query: 202 KIGRTHLQDATPLTLGQEFSGYVQQLVNGIARIENTLPHLKYLAQGGTAVGTGLNTKEGF 261
           KIGRTHLQDATPLTLGQEFSGYVQQL NGI RI+ +L HLK+LAQGGTAVGTGLNTK GF
Sbjct: 194 KIGRTHLQDATPLTLGQEFSGYVQQLTNGIERIQASLYHLKFLAQGGTAVGTGLNTKVGF 253

Query: 262 DKLIAEQISKETGIDFKTAPNKFEALAAHDAIVEASGALNTVACSLFKIAQDIRYLGSGP 321
           DK+IA+++SKETGIDF+TAPNKFEALAAHDAIV AS A+ TVA SLFKIAQDIRYLGSGP
Sbjct: 254 DKMIAQEVSKETGIDFETAPNKFEALAAHDAIVFASSAITTVAGSLFKIAQDIRYLGSGP 313

Query: 322 RCGYGELHLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAVTFAGANGQFELNVFK 381
           RCGYGEL LPENEPGSSIMPGKVNPTQNEAMTQV +Q+MGNN  +  AG+ GQFELNV+K
Sbjct: 314 RCGYGELQLPENEPGSSIMPGKVNPTQNEAMTQVALQIMGNNQTIVMAGSQGQFELNVYK 373

Query: 382 PVMISNLLSSIRLLADACHSFRVHCVEGIEANREKINHNLHNSLMLVTALNPKIGYDAAS 441
           P+MI+NLL+SIRL++DACHSF++HCV+G++AN +KIN NLH SLMLVTALNPKIGYDAAS
Sbjct: 374 PLMIANLLNSIRLMSDACHSFKIHCVDGLKANTDKINENLHKSLMLVTALNPKIGYDAAS 433

Query: 442 KIAKNAFKKNITLKESALELKYLTSEEFDEWVIPENMVGP 481
           K+AKNA  KNITLKESALEL  LT EEFD+WVIPENM+GP
Sbjct: 434 KLAKNAHAKNITLKESALELGLLTEEEFDQWVIPENMIGP 473

>ZYRO0C07964g Chr3 complement(607609..609126) [1518 bp, 505 aa] {ON}
           highly similar to uniprot|P08417 Saccharomyces
           cerevisiae YPL262W FUM1 Fumarase converts fumaric acid
           to L-malic acid in the TCA cycle cytosolic and
           mitochondrial localization determined by the N-terminal
           mitochondrial targeting sequence and protein
           conformation
          Length = 505

 Score =  771 bits (1992), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 366/463 (79%), Positives = 411/463 (88%)

Query: 19  MMHYRVETDTFGEIKVPADKYWGAQTQRSFQNFKIGGARERMPEPIVRAFGVLKKSAAIV 78
           +  +RVETD FGEIKVPADKYWGAQTQRSF+NF+IGG RERMPE +V AFG+LKK+ A V
Sbjct: 41  LQEHRVETDAFGEIKVPADKYWGAQTQRSFENFRIGGQRERMPEAVVHAFGILKKATATV 100

Query: 79  NEKLGTLDSEIAGPIQQAADEVAKGKLNDHFPLVVFQTGSGTQSNMNANEVISNRAIELI 138
           NE  G LD ++A  I+QAADEVA GKL DHFPLVVFQTGSGTQSNMNANEVISNRAIEL+
Sbjct: 101 NEANGQLDPKLAVAIKQAADEVASGKLKDHFPLVVFQTGSGTQSNMNANEVISNRAIELL 160

Query: 139 GGELGSKKIHPNNHCNQAQSSNDTFPSVMHIAAVTEITNSLLPEITQLKDALHKKAEEFQ 198
           GG+LGSK +HPNNH N +QSSNDTFP+VMHIAAV  IT  LLP +T LKD+L KK+EEF 
Sbjct: 161 GGKLGSKSVHPNNHINMSQSSNDTFPTVMHIAAVLAITKDLLPNLTALKDSLQKKSEEFA 220

Query: 199 DIVKIGRTHLQDATPLTLGQEFSGYVQQLVNGIARIENTLPHLKYLAQGGTAVGTGLNTK 258
           DIVKIGRTHLQDATPLTLGQEFSGYVQQ+ NGI R+E+TL  LK LAQGGTAVGTGLNTK
Sbjct: 221 DIVKIGRTHLQDATPLTLGQEFSGYVQQVANGIKRVESTLDSLKLLAQGGTAVGTGLNTK 280

Query: 259 EGFDKLIAEQISKETGIDFKTAPNKFEALAAHDAIVEASGALNTVACSLFKIAQDIRYLG 318
            G+ + +A +++KETGIDF+TAPNKFEALAAHDA+VEASGALNT+A SLFKIAQDIRYLG
Sbjct: 281 IGWAENVAAEVAKETGIDFQTAPNKFEALAAHDAVVEASGALNTLAVSLFKIAQDIRYLG 340

Query: 319 SGPRCGYGELHLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAVTFAGANGQFELN 378
           SGPRCGYGEL LPENEPGSSIMPGKVNPTQNEA+TQVCVQV GN++A+TFAGA+GQFELN
Sbjct: 341 SGPRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQVCVQVFGNHSAITFAGASGQFELN 400

Query: 379 VFKPVMISNLLSSIRLLADACHSFRVHCVEGIEANREKINHNLHNSLMLVTALNPKIGYD 438
           VFKPVMISNLLSSI LL+DA +SFRVHCV+GI+ANRE I   LH SLMLVTALNPKIGYD
Sbjct: 401 VFKPVMISNLLSSINLLSDASYSFRVHCVDGIQANRENIAKLLHESLMLVTALNPKIGYD 460

Query: 439 AASKIAKNAFKKNITLKESALELKYLTSEEFDEWVIPENMVGP 481
           AASK+AKNA K  ITLKESAL+L  LT+EEFD WV+PE+M+GP
Sbjct: 461 AASKVAKNAHKNGITLKESALQLNILTAEEFDHWVVPEHMIGP 503

>TPHA0J00270 Chr10 (61961..63451) [1491 bp, 496 aa] {ON} Anc_6.13
           YPL262W
          Length = 496

 Score =  768 bits (1982), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 361/460 (78%), Positives = 410/460 (89%)

Query: 22  YRVETDTFGEIKVPADKYWGAQTQRSFQNFKIGGARERMPEPIVRAFGVLKKSAAIVNEK 81
           +R+ETD FGEIKVPA+KYWGAQT+RSF+NF+IGG RERMP+P+V+AFGVLKKSAAIVNE 
Sbjct: 36  FRIETDGFGEIKVPANKYWGAQTERSFENFRIGGPRERMPDPVVKAFGVLKKSAAIVNEG 95

Query: 82  LGTLDSEIAGPIQQAADEVAKGKLNDHFPLVVFQTGSGTQSNMNANEVISNRAIELIGGE 141
            GTLD +I+  IQ+AADEV +GKLNDHFPLVVFQTGSGTQSNMNANEVISNRAIEL+GG 
Sbjct: 96  YGTLDPQISKVIQEAADEVIQGKLNDHFPLVVFQTGSGTQSNMNANEVISNRAIELLGGT 155

Query: 142 LGSKKIHPNNHCNQAQSSNDTFPSVMHIAAVTEITNSLLPEITQLKDALHKKAEEFQDIV 201
           LGSK++HPNNH NQAQSSND+FP+VMHIAAVTEIT+ L+PE+  L+DAL  K+++F  IV
Sbjct: 156 LGSKQVHPNNHVNQAQSSNDSFPTVMHIAAVTEITDHLIPEVANLRDALESKSKDFAHIV 215

Query: 202 KIGRTHLQDATPLTLGQEFSGYVQQLVNGIARIENTLPHLKYLAQGGTAVGTGLNTKEGF 261
           KIGRTHLQDATPLTLGQEFSGYVQQL NGI RIE++L +LK+LAQGGTAVGTGLNT+ GF
Sbjct: 216 KIGRTHLQDATPLTLGQEFSGYVQQLTNGIGRIEHSLINLKFLAQGGTAVGTGLNTRIGF 275

Query: 262 DKLIAEQISKETGIDFKTAPNKFEALAAHDAIVEASGALNTVACSLFKIAQDIRYLGSGP 321
            + IAEQISKETG+ FKTAPNKFEALAAHDAIVEASGA+ TVA SLFKIAQDIRYLGSGP
Sbjct: 276 AEKIAEQISKETGVAFKTAPNKFEALAAHDAIVEASGAITTVATSLFKIAQDIRYLGSGP 335

Query: 322 RCGYGELHLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAVTFAGANGQFELNVFK 381
           RCGYGEL LPENEPGSSIMPGK+NPTQNEA+TQVC Q++GNN  + FAG  GQFELNVFK
Sbjct: 336 RCGYGELSLPENEPGSSIMPGKINPTQNEAVTQVCAQIIGNNQTIIFAGTQGQFELNVFK 395

Query: 382 PVMISNLLSSIRLLADACHSFRVHCVEGIEANREKINHNLHNSLMLVTALNPKIGYDAAS 441
           PVMISNLLSSIRLL D   SFR+HCVEGI+AN E+I   ++ SLMLVTALNPKIGYD A+
Sbjct: 396 PVMISNLLSSIRLLGDVSKSFRIHCVEGIKANEERIADLMNKSLMLVTALNPKIGYDEAT 455

Query: 442 KIAKNAFKKNITLKESALELKYLTSEEFDEWVIPENMVGP 481
           K+AKNA KK ITLKESA++L  LT  EFDEWV+PE M+GP
Sbjct: 456 KVAKNAHKKGITLKESAMQLGSLTESEFDEWVVPEKMIGP 495

>TBLA0G01000 Chr7 (252070..253467) [1398 bp, 465 aa] {ON} Anc_6.13
           YPL262W
          Length = 465

 Score =  741 bits (1913), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 341/465 (73%), Positives = 410/465 (88%)

Query: 19  MMHYRVETDTFGEIKVPADKYWGAQTQRSFQNFKIGGARERMPEPIVRAFGVLKKSAAIV 78
           M   R+E D FGE++VPA+KYWGAQTQR+  NF IGG RERMPEP++ A+G+LKKS AIV
Sbjct: 1   MPETRIEVDGFGELEVPANKYWGAQTQRALNNFHIGGERERMPEPLILAYGILKKSVAIV 60

Query: 79  NEKLGTLDSEIAGPIQQAADEVAKGKLNDHFPLVVFQTGSGTQSNMNANEVISNRAIELI 138
           NE LGTLD +I+  IQ+AADEVAKG LN+HFPLVVFQTGSGTQ+NMN NEVISNRAIE++
Sbjct: 61  NESLGTLDPKISKAIQEAADEVAKGSLNEHFPLVVFQTGSGTQTNMNVNEVISNRAIEIL 120

Query: 139 GGELGSKKIHPNNHCNQAQSSNDTFPSVMHIAAVTEITNSLLPEITQLKDALHKKAEEFQ 198
           GG+LGSK +HPNNH NQ+QS+ND+FP+ MHI+AV E+   LLPE+ +L+DAL  K+ EF 
Sbjct: 121 GGQLGSKTVHPNNHVNQSQSTNDSFPTAMHISAVREVVFKLLPELEKLRDALKDKSIEFN 180

Query: 199 DIVKIGRTHLQDATPLTLGQEFSGYVQQLVNGIARIENTLPHLKYLAQGGTAVGTGLNTK 258
            IVKIGRTHLQDATPLTLGQEFSGYVQQ+ NGI R++N+L +LK++AQGGTAVGTG+NTK
Sbjct: 181 KIVKIGRTHLQDATPLTLGQEFSGYVQQVENGITRVQNSLTNLKFIAQGGTAVGTGINTK 240

Query: 259 EGFDKLIAEQISKETGIDFKTAPNKFEALAAHDAIVEASGALNTVACSLFKIAQDIRYLG 318
           + FD L+A+QIS ETGI+FKTAPNKFEALA+HDAIVE SGALNT+ACSLFKI+QDIR+LG
Sbjct: 241 KDFDILVAKQISLETGIEFKTAPNKFEALASHDAIVECSGALNTLACSLFKISQDIRFLG 300

Query: 319 SGPRCGYGELHLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAVTFAGANGQFELN 378
           SGPRCGYGEL LPENEPGSSIMPGKVNPTQNEAM Q C+QVMGNN+A+TFAGA+GQFELN
Sbjct: 301 SGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMCQACIQVMGNNSAITFAGASGQFELN 360

Query: 379 VFKPVMISNLLSSIRLLADACHSFRVHCVEGIEANREKINHNLHNSLMLVTALNPKIGYD 438
            +KP+MISNLL+SIRLL D+C+SFR+HC+ GI AN +KIN  L+ SLMLVTALNPKIGYD
Sbjct: 361 TYKPLMISNLLNSIRLLTDSCNSFRIHCIVGIRANEDKINKLLNESLMLVTALNPKIGYD 420

Query: 439 AASKIAKNAFKKNITLKESALELKYLTSEEFDEWVIPENMVGPTK 483
           AA+ IAK+A K  +TLKE+AL+ K LT+E+FDEW++PE+MV P++
Sbjct: 421 AATAIAKDAHKNGLTLKEAALKSKLLTAEQFDEWIVPESMVHPSE 465

>TBLA0A07130 Chr1 (1770536..1772038) [1503 bp, 500 aa] {ON} Anc_6.13
           YPL262W
          Length = 500

 Score =  730 bits (1885), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 341/465 (73%), Positives = 397/465 (85%)

Query: 17  ARMMHYRVETDTFGEIKVPADKYWGAQTQRSFQNFKIGGARERMPEPIVRAFGVLKKSAA 76
           A +   R ETD+FGEI+VPA+KYWGAQTQRSF NFKIGG RERMPEPI+RAFG  KK+AA
Sbjct: 35  ADLQGTRTETDSFGEIQVPANKYWGAQTQRSFMNFKIGGERERMPEPIIRAFGQQKKAAA 94

Query: 77  IVNEKLGTLDSEIAGPIQQAADEVAKGKLNDHFPLVVFQTGSGTQSNMNANEVISNRAIE 136
           IVN  LGTLD  +   I QAA+EV++G LN+HFPLVVFQTGSGTQSNMNANEVISNRAIE
Sbjct: 95  IVNNSLGTLDDTLKDAIVQAAEEVSQGLLNEHFPLVVFQTGSGTQSNMNANEVISNRAIE 154

Query: 137 LIGGELGSKKIHPNNHCNQAQSSNDTFPSVMHIAAVTEITNSLLPEITQLKDALHKKAEE 196
           L+GG LGSK++HPNNH NQ+QSSNDTFP+VMHIAA+TEITN+LLP +  L++ L  KA+E
Sbjct: 155 LLGGTLGSKQVHPNNHVNQSQSSNDTFPTVMHIAALTEITNTLLPNLIVLRETLDSKAKE 214

Query: 197 FQDIVKIGRTHLQDATPLTLGQEFSGYVQQLVNGIARIENTLPHLKYLAQGGTAVGTGLN 256
           F+ I+KIGRTHLQDATPLTLGQEFSGY QQL N I RIE  LP L+Y+AQGGTAVGTGLN
Sbjct: 215 FEKIIKIGRTHLQDATPLTLGQEFSGYTQQLTNAIKRIEKNLPELQYIAQGGTAVGTGLN 274

Query: 257 TKEGFDKLIAEQISKETGIDFKTAPNKFEALAAHDAIVEASGALNTVACSLFKIAQDIRY 316
           TK GF +  A Q+S +T + F T+PNKFE+LAAHDAIV    +LNT+ACSLFKI+QDIRY
Sbjct: 275 TKIGFAEQFARQLSNQTNLSFLTSPNKFESLAAHDAIVNVHASLNTLACSLFKISQDIRY 334

Query: 317 LGSGPRCGYGELHLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAVTFAGANGQFE 376
           L SGPRCGYGEL +PENEPGSSIMPGKVNPTQNEAM Q CVQVMGNN+ ++FAGA+GQFE
Sbjct: 335 LASGPRCGYGELSIPENEPGSSIMPGKVNPTQNEAMCQACVQVMGNNSTISFAGASGQFE 394

Query: 377 LNVFKPVMISNLLSSIRLLADACHSFRVHCVEGIEANREKINHNLHNSLMLVTALNPKIG 436
           LN +KP+MI+NLLSS RLL+DA  SF +HC  GI+AN++KI+  LH SLMLVT+LNPKIG
Sbjct: 395 LNTYKPLMIANLLSSTRLLSDAIFSFNLHCATGIQANKDKIDRLLHESLMLVTSLNPKIG 454

Query: 437 YDAASKIAKNAFKKNITLKESALELKYLTSEEFDEWVIPENMVGP 481
           YDAASK+AKNA  K ITLK+SALEL  L+S++FDEWV PENM+GP
Sbjct: 455 YDAASKVAKNAHHKGITLKQSALELDILSSKQFDEWVRPENMLGP 499

>Suva_15.201 Chr15 complement(348498..349889) [1392 bp, 463 aa] {ON}
           YHR018C (REAL)
          Length = 463

 Score = 56.6 bits (135), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 73/286 (25%), Positives = 110/286 (38%), Gaps = 30/286 (10%)

Query: 80  EKLGTLDSEIAGPIQQAADEVAKGKLNDHFPLVVFQTGSGTQSNMNANEVISNRAIELIG 139
           +KLG L       I +   E+ K    D F        +  +    ANE    R  ELIG
Sbjct: 50  QKLGLLTETELAKIHEGLAEIKKEWEADKFV-----RHANDEDIHTANE---RRLGELIG 101

Query: 140 GELGSKKIHPNNHCNQAQSSNDTFPSVMHIAAVTEITNSLLPEITQLKDALHKKAEEFQD 199
            ++  K        +  +S ND   + + I     + +SL P +  L D L K+AE   D
Sbjct: 102 RDIAGK-------VHTGRSRNDQVVTDLRIYCRDVVNDSLFPAMKGLVDVLVKRAEGEMD 154

Query: 200 IVKIGRTHLQDATPLTLGQEFSGYVQQLVNGIARIENTLPHLKYLAQGGTAVGTGLNTKE 259
           I+  G THLQ A P+      S Y         R+   L  L     G  A+        
Sbjct: 155 ILMPGYTHLQRAQPIRWSHWLSSYATYFTEDYKRLVQILHRLNQSPLGAGALA---GHPY 211

Query: 260 GFDK-LIAEQISKETGIDFKTA-PNKFEALAAHDAIVEASGALNTVACSLFKIAQDIRYL 317
           G D+  +AE      G+ F +   N   A++  D IVE           + + A+D+   
Sbjct: 212 GIDREFLAE------GLGFNSVIGNSLVAVSDRDFIVELMFWGTLFMNHISRFAEDLIIY 265

Query: 318 GSGPRCGYGELHLPE-NEPGSSIMPGKVNPTQNEAMTQVCVQVMGN 362
            +     +G + L +    GSS+MP K N    E +     +V G+
Sbjct: 266 CTAE---FGFIQLSDAYSTGSSLMPQKKNADSLELLRGKSGRVFGD 308

>AEL019W Chr5 (600410..601819) [1410 bp, 469 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YHR018C (ARG4)
          Length = 469

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 62/241 (25%), Positives = 98/241 (40%), Gaps = 19/241 (7%)

Query: 125 NANEVISNRAIELIGGELGSKKIHPNNHCNQAQSSNDTFPSVMHIAAVTEITNSLLPEIT 184
            ANE    R  E+IG  + S K+H        +S ND   + M +     + + + P + 
Sbjct: 90  TANE---RRLGEIIGRHI-SGKVHT------GRSRNDQVATDMRLYCREMLQDKVEPALF 139

Query: 185 QLKDALHKKAEEFQDIVKIGRTHLQDATPLTLGQEFSGYVQQLVNGIARIENTLPHLKYL 244
           +L   L  +A E  D++  G THLQ A P+      S Y    V    R++  +  L   
Sbjct: 140 ELIKVLLHRAREEIDVLMPGYTHLQRAQPIRWSHWLSCYATYFVEDFKRLKEVIARLN-- 197

Query: 245 AQGGTAVGTGLNTKEGFDKLIAEQISKETGIDFKTAPNKFEALAAHDAIVEASGALNTVA 304
            Q     G       G D+   E ++ E G D     N   A++  D +VE     +   
Sbjct: 198 -QSPLGAGALAGHPYGIDR---EYLACELGFD-GVIGNSMTAVSDRDFVVEIMSWGSLFM 252

Query: 305 CSLFKIAQDIRYLGSGPRCGYGELHLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNA 364
             + ++A+D+  + S    G+ +L       GSS+MP K NP   E +     +V G  A
Sbjct: 253 NHISRLAEDL-IIYSTAEFGFVKL-ADAYSTGSSLMPQKRNPDSLELLRGKSGRVFGQLA 310

Query: 365 A 365
            
Sbjct: 311 G 311

>NDAI0G05940 Chr7 (1470741..1472129) [1389 bp, 462 aa] {ON}
           Anc_1.354 YHR018C
          Length = 462

 Score = 55.5 bits (132), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 61/242 (25%), Positives = 97/242 (40%), Gaps = 21/242 (8%)

Query: 125 NANEVISNRAIELIGGELGSKKIHPNNHCNQAQSSNDTFPSVMHIAAVTEITNSLLPEIT 184
            ANE    R  E+IG ++  K        +  +S ND   + + I     +   L P +T
Sbjct: 90  TANE---RRLGEIIGRDIAGK-------VHTGRSRNDQCVTDLRIYCRDVLNEKLFPGMT 139

Query: 185 QLKDALHKKAEEFQDIVKIGRTHLQDATPLTLGQEFSGYVQQLVNGIARIENTLPHLKYL 244
            L + L K+AEE  DI+  G THLQ A P+      S Y       + R++  L      
Sbjct: 140 SLIEVLIKRAEEEIDILMPGYTHLQRAQPIRWSHWLSSYATYFTEDLKRLKQILERFNKS 199

Query: 245 AQGGTAVGTGLNTKEGFDKLIAEQISKETGIDFKTAPNKFEALAAHDAIVEASGALNTVA 304
             G  A+        G D+   E +++  G D     N   A++  D +VE         
Sbjct: 200 PLGAGALA---GHPYGIDR---EFLAEGLGFD-GVIGNSLVAVSDRDFVVELMFWGTLFM 252

Query: 305 CSLFKIAQDIRYLGSGPRCGYGELHLPE-NEPGSSIMPGKVNPTQNEAMTQVCVQVMGNN 363
             + + A+D+    +     +G + L +    GSS+MP K N    E +     +V G+ 
Sbjct: 253 NHISRFAEDLVIYSTAE---FGFIKLSDAYSTGSSLMPQKKNADSLELLRGKSGRVFGDL 309

Query: 364 AA 365
           A 
Sbjct: 310 AG 311

>NCAS0A09010 Chr1 complement(1783858..1785246) [1389 bp, 462 aa]
           {ON} Anc_1.354 YHR018C
          Length = 462

 Score = 55.5 bits (132), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 70/285 (24%), Positives = 110/285 (38%), Gaps = 28/285 (9%)

Query: 80  EKLGTLDSEIAGPIQQAADEVAKGKLNDHFPLVVFQTGSGTQSNMNANEVISNRAIELIG 139
           +K+G L  E    I    D++ K    D F           +    ANE    R  E+IG
Sbjct: 50  QKIGLLTEEELAKIHVGLDQIKKEWDEDKFV-----RHPNDEDIHTANE---RRLGEIIG 101

Query: 140 GELGSKKIHPNNHCNQAQSSNDTFPSVMHIAAVTEITNSLLPEITQLKDALHKKAEEFQD 199
            ++  K        +  +S ND   + + I     +   L P +T L   L K+ EE  D
Sbjct: 102 RDIAGK-------VHTGRSRNDQCVTDLRIYCRDVLNEKLFPALTSLIQVLIKRGEEEID 154

Query: 200 IVKIGRTHLQDATPLTLGQEFSGYVQQLVNGIARIENTLPHLKYLAQGGTAVGTGLNTKE 259
           I+  G THLQ A P+      S Y       + R++  L        G  A+        
Sbjct: 155 ILMPGYTHLQRAQPIRWSHWLSSYATYFTEDLNRLKQILVRFNKSPLGAGALA---GHPY 211

Query: 260 GFDK-LIAEQISKETGIDFK-TAPNKFEALAAHDAIVEASGALNTVACSLFKIAQDIRYL 317
           G D+  +AE      G++F     N   A++  D +VE           + + A+D+  +
Sbjct: 212 GIDREFLAE------GLEFNGVIGNSLVAVSDRDFVVELMFWSTLFMNHISRFAEDL-II 264

Query: 318 GSGPRCGYGELHLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGN 362
            S    G+ +L+      GSS+MP K N    E +     +V G+
Sbjct: 265 YSTAEFGFIKLN-DAYSTGSSLMPQKKNADSLELLRGKSGRVFGD 308

>TBLA0F03480 Chr6 (857021..858421) [1401 bp, 466 aa] {ON} Anc_1.354
           YHR018C
          Length = 466

 Score = 54.7 bits (130), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 69/283 (24%), Positives = 107/283 (37%), Gaps = 26/283 (9%)

Query: 80  EKLGTLDSEIAGPIQQAADEVAKGKLNDHFPLVVFQTGSGTQSNMNANEVISNRAIELIG 139
           +KLG L SE    I     E+ K   N       F+     +    ANE    R  E+IG
Sbjct: 50  QKLGLLTSEELEKIHYGLGEIKKEWDNG-----TFKRHPNDEDIHTANE---RRLGEIIG 101

Query: 140 GELGSKKIHPNNHCNQAQSSNDTFPSVMHIAAVTEITNSLLPEITQLKDALHKKAEEFQD 199
             +  K        +  +S ND   + + I     +   LLP +  L   + K+AE   D
Sbjct: 102 THIAGK-------VHTGRSRNDQCVTDLRIYCRDILVEKLLPFMIDLVQVITKRAENEID 154

Query: 200 IVKIGRTHLQDATPLTLGQEFSGYVQQLVNGIARIENTLPHLKYLAQGGTAVGTGLNTKE 259
           I+  G THLQ A P+      S Y         R++  L  L     G  A+        
Sbjct: 155 ILMPGYTHLQRAQPIRWSHWLSSYATYFTEDYKRLKQVLERLNKCPLGAGAIA---GHPY 211

Query: 260 GFDKLIAEQISKETGIDFKTAPNKFEALAAHDAIVEASGALNTVACSLFKIAQDIRYLGS 319
           G D+   + +S E G +     N   A++  D IV+           + + ++D+    +
Sbjct: 212 GIDR---QYLSDELGFN-SIIGNSLVAVSDRDFIVDIMFWSTLFMNHISRFSEDLIIYST 267

Query: 320 GPRCGYGELHLPE-NEPGSSIMPGKVNPTQNEAMTQVCVQVMG 361
                +G + L +    GSS+MP K N    E +     +V G
Sbjct: 268 AE---FGFIKLSDAYSTGSSLMPQKKNADSLELLRGKSGRVFG 307

>KLLA0A08404g Chr1 complement(743192..744577) [1386 bp, 461 aa] {ON}
           highly similar to uniprot|P04076 Saccharomyces
           cerevisiae YHR018C ARG4 Argininosuccinate lyase
           catalyzes the final step in the arginine biosynthesis
           pathway
          Length = 461

 Score = 53.5 bits (127), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 55/228 (24%), Positives = 91/228 (39%), Gaps = 15/228 (6%)

Query: 140 GELGSKKIHPNNHCNQAQSSNDTFPSVMHIAAVTEITNSLLPEITQLKDALHKKAEEFQD 199
           GE+  + I    H    +S ND   + M I     +  ++LP ++ L   + ++AEE  D
Sbjct: 96  GEIIGRGIAGKVHT--GRSRNDQVATDMRIYCRDILNGTVLPALSSLIKVILQRAEEEID 153

Query: 200 IVKIGRTHLQDATPLTLGQEFSGYVQQLVNGIARIENTLPHLKYLAQGGTAVGTGLNTKE 259
           ++  G THLQ A P+      S Y         R++  +  L     G  A+        
Sbjct: 154 VLMPGYTHLQRAQPIRWAHWLSCYATYFTEDYKRLQQIVERLNVSPLGAGALA---GHPY 210

Query: 260 GFDKLIAEQISKETGIDFK-TAPNKFEALAAHDAIVEASGALNTVACSLFKIAQDIRYLG 318
           G D+          G++F     N   A+A  D +VE     +     + + A+D+    
Sbjct: 211 GIDREFL-----AAGLNFNGVIGNSLTAVADRDFVVEIMFWGSLFMNHISRFAEDLIIYS 265

Query: 319 SGPRCGYGELHLPE-NEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAA 365
           +     +G + L +    GSS+MP K NP   E +     +V G  A 
Sbjct: 266 TAE---FGFIQLSDAYSTGSSLMPQKKNPDSLELLRGKSGRVFGQLAG 310

>Smik_8.83 Chr8 complement(120320..121711) [1392 bp, 463 aa] {ON}
           YHR018C (REAL)
          Length = 463

 Score = 53.1 bits (126), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 63/241 (26%), Positives = 95/241 (39%), Gaps = 25/241 (10%)

Query: 125 NANEVISNRAIELIGGELGSKKIHPNNHCNQAQSSNDTFPSVMHIAAVTEITNSLLPEIT 184
            ANE    R  ELIG ++  K        +  +S ND   + + I     +  +L P + 
Sbjct: 90  TANE---RRLGELIGRDIAGK-------VHTGRSRNDQVVTDLRIYCRDVVNGTLFPALK 139

Query: 185 QLKDALHKKAEEFQDIVKIGRTHLQDATPLTLGQEFSGYVQQLVNGIARIENTLPHLKYL 244
            L D L K+AE   DI+  G THLQ A P+      S Y         R+   L  L   
Sbjct: 140 GLVDVLIKRAEGEIDILMPGYTHLQRAQPIRWSHWLSSYATYFTEDYKRLGQILHRLNQS 199

Query: 245 AQGGTAVGTGLNTKEGFDK-LIAEQISKETGIDFKTA-PNKFEALAAHDAIVEASGALNT 302
             G  A+        G D+  +AE      G+ F +   N   A++  D IVE       
Sbjct: 200 PLGAGALA---GHPYGIDREFLAE------GLGFNSVIGNSLVAVSDRDFIVELMFWGTL 250

Query: 303 VACSLFKIAQDIRYLGSGPRCGYGELHLPE-NEPGSSIMPGKVNPTQNEAMTQVCVQVMG 361
               + + A+D+    +     +G + L +    GSS+MP K N    E +     +V G
Sbjct: 251 FMNHISRFAEDLIIYCTAE---FGFIQLSDAYSTGSSLMPQKKNADSLELLRGKSGRVFG 307

Query: 362 N 362
           +
Sbjct: 308 D 308

>Ecym_2749 Chr2 complement(1453019..1454431) [1413 bp, 470 aa] {ON}
           similar to Ashbya gossypii AEL019W
          Length = 470

 Score = 53.1 bits (126), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 70/287 (24%), Positives = 109/287 (37%), Gaps = 36/287 (12%)

Query: 81  KLGTLDSEIAGPIQQAADEV----AKGKLNDHFPLVVFQTGSGTQSNMNANEVISNRAIE 136
           K+G LD E    I +   E+    + GK  +H            +    ANE    R  E
Sbjct: 51  KIGLLDVEELSLIHKGLLEIESEWSSGKFEEH---------PDDEDIHTANE---RRLGE 98

Query: 137 LIGGELGSKKIHPNNHCNQAQSSNDTFPSVMHIAAVTEITNSLLPEITQLKDALHKKAEE 196
           LIG  +  K        +  +S ND   + M I     +   +LP ++     L  +A E
Sbjct: 99  LIGTAVAGK-------VHTGRSRNDQVATDMRIYCREILNEKILPAVSSFIRVLINRARE 151

Query: 197 FQDIVKIGRTHLQDATPLTLGQEFSGYVQQLVNGIARIENTLPHLKYLAQGGTAVGTGLN 256
             D++  G THLQ A P+      S Y         R+   +  L    Q     G    
Sbjct: 152 EVDVLMPGYTHLQRAQPIRWSHWLSCYATYFTEDYNRLRQVVERLN---QSPLGAGALAG 208

Query: 257 TKEGFD-KLIAEQISKETGIDFKTAPNKFEALAAHDAIVEASGALNTVACSLFKIAQDIR 315
              G D K +AEQ+    GI      N   A++  D ++E     +     + + A+D+ 
Sbjct: 209 HPYGIDRKYLAEQLGF-NGI----IGNSLVAVSDRDFVIEIMFWGSLFMNHISRFAEDLI 263

Query: 316 YLGSGPRCGYGELHLPE-NEPGSSIMPGKVNPTQNEAMTQVCVQVMG 361
              +     +G ++L +    GSS+MP K NP   E +     +V G
Sbjct: 264 IYSTAE---FGFINLADAYSTGSSLMPQKKNPDSLELLRGKSGRVFG 307

>TDEL0D02220 Chr4 (428430..429827) [1398 bp, 465 aa] {ON} Anc_1.354
           YHR018C
          Length = 465

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 67/286 (23%), Positives = 108/286 (37%), Gaps = 24/286 (8%)

Query: 80  EKLGTLDSEIAGPIQQAADEVAKGKLNDHFPLVVFQTGSGTQSNMNANEVISNRAIELIG 139
           +KLG L  +    I    +E+ K    D F           +    ANE    R  E+IG
Sbjct: 50  QKLGLLTEDELKKIHSGLEEIKKEWDEDKFV-----RHPNDEDIHTANE---RRLGEIIG 101

Query: 140 GELGSKKIHPNNHCNQAQSSNDTFPSVMHIAAVTEITNSLLPEITQLKDALHKKAEEFQD 199
             +  K        +  +S ND   + + I     + + L P++  L D + K+ +E  D
Sbjct: 102 RNIAGK-------VHTGRSRNDQCVTDLRIYCRDLLNDKLFPDLQALVDVMIKRGKEEID 154

Query: 200 IVKIGRTHLQDATPLTLGQEFSGYVQQLVNGIARIENTLPHLKYLAQGGTAVGTGLNTKE 259
           ++  G THLQ A P+      S Y         R+   +  +    Q     G       
Sbjct: 155 VLMPGYTHLQRAQPIRWSHWLSSYATYFTEDFKRLRQIMDRIN---QSPLGAGALAGHPY 211

Query: 260 GFDKLIAEQISKETGIDFKTAPNKFEALAAHDAIVEASGALNTVACSLFKIAQDIRYLGS 319
           G D+   E ++   G D     N   A++  D IVE           + + A+D+  + S
Sbjct: 212 GIDR---EFLAAGLGFD-GVIGNSLVAVSDRDFIVELMFWGTLFMNHISRFAEDL-IIYS 266

Query: 320 GPRCGYGELHLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAA 365
               G+ +L+      GSS+MP K N    E +     +V G+ A 
Sbjct: 267 TAEFGFIKLN-DAYSTGSSLMPQKKNADSLELLRGKSGRVFGDLAG 311

>KAFR0A00950 Chr1 (178176..179570) [1395 bp, 464 aa] {ON} Anc_1.354
           YHR018C
          Length = 464

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 59/241 (24%), Positives = 96/241 (39%), Gaps = 21/241 (8%)

Query: 126 ANEVISNRAIELIGGELGSKKIHPNNHCNQAQSSNDTFPSVMHIAAVTEITNSLLPEITQ 185
           ANE    R  E+IG  +  K        +  +S ND   + M I     +TN+LL  + +
Sbjct: 92  ANE---RRLGEIIGTGIAGK-------VHTGRSRNDQVATDMRIYCRDILTNNLLTYLKE 141

Query: 186 LKDALHKKAEEFQDIVKIGRTHLQDATPLTLGQEFSGYVQQLVNGIARIENTLPHLKYLA 245
           L   + ++A E  DI+  G THLQ A P+      S Y         R++  L  L    
Sbjct: 142 LISVICRRANEEMDILMPGYTHLQRAQPIRWSHWLSFYATYFTEDYKRLQEILARLNVSP 201

Query: 246 QGGTAVGTGLNTKEGFDKLIAEQISKETGIDFKTAPNKFEALAAHDAIVEASGALNTVAC 305
            G  A+        G D+    Q    +G+      N   A++  D +VE     +    
Sbjct: 202 LGAGALA---GHPYGIDREFLAQDLGFSGV----IGNSLVAVSDRDFVVEIMFWGSLFMN 254

Query: 306 SLFKIAQDIRYLGSGPRCGYGELHLPE-NEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNA 364
            + + ++D+    +     +G + L +    GSS+MP K N    E +     +V G+ A
Sbjct: 255 HISRFSEDLIIYSTAE---FGFIKLSDAYSTGSSLMPQKKNADSLELLRGKSGRVFGDLA 311

Query: 365 A 365
            
Sbjct: 312 G 312

>YHR018C Chr8 complement(140011..141402) [1392 bp, 463 aa] {ON}
           ARG4Argininosuccinate lyase, catalyzes the final step in
           the arginine biosynthesis pathway
          Length = 463

 Score = 50.8 bits (120), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 61/241 (25%), Positives = 96/241 (39%), Gaps = 25/241 (10%)

Query: 125 NANEVISNRAIELIGGELGSKKIHPNNHCNQAQSSNDTFPSVMHIAAVTEITNSLLPEIT 184
            ANE    R  ELIG ++  K        +  +S ND   + + I     + ++L P + 
Sbjct: 90  TANE---RRLGELIGRDIAGK-------VHTGRSRNDQVVTDLRIYCRDIVNDTLFPALK 139

Query: 185 QLKDALHKKAEEFQDIVKIGRTHLQDATPLTLGQEFSGYVQQLVNGIARIENTLPHLKYL 244
            L + L K+AE   D++  G THLQ A P+      S Y         R+   L  L   
Sbjct: 140 GLVEVLIKRAEGEIDVLMPGYTHLQRAQPIRWSHWLSSYATYFTEDYKRLGQILHRLNQS 199

Query: 245 AQGGTAVGTGLNTKEGFDK-LIAEQISKETGIDFKTA-PNKFEALAAHDAIVEASGALNT 302
             G  A+        G D+  +AE      G+ F +   N   A++  D IVE       
Sbjct: 200 PLGAGALA---GHPYGIDREFLAE------GLGFNSVIGNSLVAVSDRDFIVELMFWGTL 250

Query: 303 VACSLFKIAQDIRYLGSGPRCGYGELHLPE-NEPGSSIMPGKVNPTQNEAMTQVCVQVMG 361
               + + A+D+    +     +G + L +    GSS+MP K N    E +     +V G
Sbjct: 251 FMNHISRFAEDLIIYCTAE---FGFIQLSDAYSTGSSLMPQKKNADSLELLRGKSGRVFG 307

Query: 362 N 362
           +
Sbjct: 308 D 308

>KNAG0I01560 Chr9 (303704..305092) [1389 bp, 462 aa] {ON} Anc_1.354
           YHR018C
          Length = 462

 Score = 50.8 bits (120), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 63/242 (26%), Positives = 94/242 (38%), Gaps = 23/242 (9%)

Query: 125 NANEVISNRAIELIGGELGSKKIHPNNHCNQAQSSNDTFPSVMHIAAVTEITNSLLPEIT 184
            ANE    R  E+IG  +  K        +  +S ND   + M I     +   LLP + 
Sbjct: 90  TANE---RRLGEIIGRHIAGK-------VHTGRSRNDQVVTDMRIYCRDILNEKLLPFMA 139

Query: 185 QLKDALHKKAEEFQDIVKIGRTHLQDATPLTLGQEFSGYVQQLVNGIARIENTLPHLKYL 244
            L   L K+AE   D +  G THLQ A P+      S Y         R++  L  L   
Sbjct: 140 DLIKVLVKRAENEIDTLMPGYTHLQRAQPIRWAHWLSSYATYFTEDYKRLKQILERLNVS 199

Query: 245 AQGGTAVGTGLNTKEGFDK-LIAEQISKETGIDF-KTAPNKFEALAAHDAIVEASGALNT 302
             G  A+        G D+  +AE      G++F     N   A++  D +VE       
Sbjct: 200 PLGAGALA---GHPYGIDREFLAE------GLNFGGVIGNSLVAVSDRDFVVELMFWGTL 250

Query: 303 VACSLFKIAQDIRYLGSGPRCGYGELHLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGN 362
               + + A+D+  + S    G+ +L       GSS+MP K N    E +     +V G+
Sbjct: 251 FMNHISRFAEDL-IIYSTAEFGFVKLS-DSYSTGSSLMPQKKNADSLELLRGKSGRVFGD 308

Query: 363 NA 364
            A
Sbjct: 309 LA 310

>SAKL0D09746g Chr4 complement(808721..810115) [1395 bp, 464 aa] {ON}
           highly similar to uniprot|P04076 Saccharomyces
           cerevisiae YHR018C ARG4 Argininosuccinate lyase
           catalyzes the final step in the arginine biosynthesis
           pathway
          Length = 464

 Score = 50.8 bits (120), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 69/288 (23%), Positives = 114/288 (39%), Gaps = 36/288 (12%)

Query: 80  EKLGTLDSE----IAGPIQQAADEVAKGKLNDHFPLVVFQTGSGTQSNMNANEVISNRAI 135
           +K+G L S+    +   ++Q   E A G+   H            +    ANE    R  
Sbjct: 51  QKIGLLTSDELTKVHHGLEQIEKEWAAGEFARH---------PSDEDIHTANE---RRLG 98

Query: 136 ELIGGELGSKKIHPNNHCNQAQSSNDTFPSVMHIAAVTEITNSLLPEITQLKDALHKKAE 195
           E+IG E+ S K+H        +S ND   + M I     +   LLP +      L  +A+
Sbjct: 99  EIIGREI-SGKVHT------GRSRNDQVATDMRIYCRDILNEVLLPALQAFIKVLTTRAK 151

Query: 196 EFQDIVKIGRTHLQDATPLTLGQEFSGYVQQLVNGIARIENTLPHLKYLAQGGTAVGTGL 255
           E  D++  G THLQ A P+      S Y         R++  +  L     G  A+    
Sbjct: 152 EEIDVLMPGYTHLQRAQPIRWSHWLSSYATYFTEDYNRLKQIVERLNKSPLGAGALA--- 208

Query: 256 NTKEGFDKLIAEQISKETGIDFK-TAPNKFEALAAHDAIVEASGALNTVACSLFKIAQDI 314
               G D+   E +++  G+ F+    N   A++  D +VE           + + ++D+
Sbjct: 209 GHPYGIDR---EFLAR--GLGFQGVIGNSLTAVSDRDFVVEIMFWGTLFMNHISRFSEDL 263

Query: 315 RYLGSGPRCGYGELHLPE-NEPGSSIMPGKVNPTQNEAMTQVCVQVMG 361
               +     +G + L +    GSS+MP K NP   E +     +V G
Sbjct: 264 IIYSTAE---FGFIKLSDAYSTGSSLMPQKKNPDSLELLRGKAGRVFG 308

>ZYRO0G00748g Chr7 (57164..58552) [1389 bp, 462 aa] {ON} highly
           similar to uniprot|P04076 Saccharomyces cerevisiae
           YHR018C ARG4 Argininosuccinate lyase catalyzes the final
           step in the arginine biosynthesis pathway
          Length = 462

 Score = 50.4 bits (119), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 59/240 (24%), Positives = 95/240 (39%), Gaps = 19/240 (7%)

Query: 126 ANEVISNRAIELIGGELGSKKIHPNNHCNQAQSSNDTFPSVMHIAAVTEITNSLLPEITQ 185
           ANE    R  E+IG ++  K        +  +S ND   + M I     +   LLP + +
Sbjct: 91  ANE---RRLGEIIGRDIAGK-------VHTGRSRNDQVVTDMRIFCRDTVNEKLLPGLKE 140

Query: 186 LKDALHKKAEEFQDIVKIGRTHLQDATPLTLGQEFSGYVQQLVNGIARIENTLPHLKYLA 245
           L   + K+AE+    +  G THLQ A P+      S Y       + R+   L       
Sbjct: 141 LVSVMVKRAEKEIGYLMPGYTHLQRAQPIRWSHWLSSYATYFTEDLKRLRQLLERFNQSP 200

Query: 246 QGGTAVGTGLNTKEGFDKLIAEQISKETGIDFKTAPNKFEALAAHDAIVEASGALNTVAC 305
            G  A+        G D+   E +++E G       N   A++  D +VE          
Sbjct: 201 LGAGALA---GHPYGIDR---EFLAEELGFQ-GVIGNSLVAVSDRDFVVELMFWGTLFMN 253

Query: 306 SLFKIAQDIRYLGSGPRCGYGELHLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAA 365
            + + A+D+  + S    G+ +L+      GSS+MP K N    E +     +V G+ A 
Sbjct: 254 HISRFAEDL-IIYSTAEFGFIKLN-DAYSTGSSLMPQKKNADSLELLRGKSGRVFGDLAG 311

>Kpol_1018.125 s1018 complement(330965..332347) [1383 bp, 460 aa]
           {ON} complement(330965..332347) [1383 nt, 461 aa]
          Length = 460

 Score = 50.1 bits (118), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 72/284 (25%), Positives = 107/284 (37%), Gaps = 26/284 (9%)

Query: 80  EKLGTLDSEIAGPIQQAADEVAKGKLNDHFPLVVFQTGSGTQSNMNANEVISNRAIELIG 139
           EKLG L       I    D + K   +D F           +    ANE    R  ELIG
Sbjct: 48  EKLGLLTEVELSKIHDGLDAIKKEWDSDSFV-----RHPNDEDIHTANE---RRLGELIG 99

Query: 140 GELGSKKIHPNNHCNQAQSSNDTFPSVMHIAAVTEITNSLLPEITQLKDALHKKAEEFQD 199
            ++ S K+H        +S ND   + + I     I + LLP +  L   L K+ E    
Sbjct: 100 TDI-SGKVHT------GRSRNDQCVTDLRIYCRDIIQDKLLPSLKSLIQVLVKRGEGEIG 152

Query: 200 IVKIGRTHLQDATPLTLGQEFSGYVQQLVNGIARIENTLPHLKYLAQGGTAVGTGLNTKE 259
           I+  G THLQ A P+      S Y         R++  L  L     G  A+        
Sbjct: 153 ILMPGYTHLQRAQPIRWSHWLSSYATYFTEDYKRLKQLLDRLNVSPLGAGALA---GHPY 209

Query: 260 GFDKLIAEQISKETGIDFKTAPNKFEALAAHDAIVEASGALNTVACSLFKIAQDIRYLGS 319
           G D+   E ++   G +     N   A++  D +VE           + + A+D+    +
Sbjct: 210 GIDR---EFLANGLGFN-GVIGNSLVAVSDRDFVVELLFWGTLFMNHISRFAEDLIIYST 265

Query: 320 GPRCGYGELHLPE-NEPGSSIMPGKVNPTQNEAMTQVCVQVMGN 362
                +G + L +    GSS+MP K N    E +     +V GN
Sbjct: 266 AE---FGFITLSDAYSTGSSLMPQKKNSDSLELLRGKSGRVFGN 306

>Skud_8.70 Chr8 complement(121600..122991) [1392 bp, 463 aa] {ON}
           YHR018C (REAL)
          Length = 463

 Score = 50.1 bits (118), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 60/241 (24%), Positives = 97/241 (40%), Gaps = 25/241 (10%)

Query: 125 NANEVISNRAIELIGGELGSKKIHPNNHCNQAQSSNDTFPSVMHIAAVTEITNSLLPEIT 184
            ANE    R  E+IG ++  K        +  +S ND   + + I     + ++L P + 
Sbjct: 90  TANE---RRLGEIIGRDIAGK-------VHTGRSRNDQVVTDLRIYCRDVVNDNLFPALK 139

Query: 185 QLKDALHKKAEEFQDIVKIGRTHLQDATPLTLGQEFSGYVQQLVNGIARIENTLPHLKYL 244
            L D L K+A+   +I+  G THLQ A P+      S Y         R++  L  L   
Sbjct: 140 GLVDVLIKRAKGEINILMPGYTHLQRAQPIRWSHWLSSYATYFTEDYKRLDQILHRLNQS 199

Query: 245 AQGGTAVGTGLNTKEGFDK-LIAEQISKETGIDFKTA-PNKFEALAAHDAIVEASGALNT 302
             G  A+        G D+  +AE      G+ F +   N   A++  D IVE       
Sbjct: 200 PLGAGALA---GHPYGIDREFLAE------GLGFNSVIGNSMVAVSDRDFIVELMFWGTL 250

Query: 303 VACSLFKIAQDIRYLGSGPRCGYGELHLPE-NEPGSSIMPGKVNPTQNEAMTQVCVQVMG 361
               + + A+D+    +     +G + L +    GSS+MP K N    E +     +V G
Sbjct: 251 FMNHISRFAEDLIIYCTAE---FGFIQLSDAYSTGSSLMPQKKNADSLELLRGKSGRVFG 307

Query: 362 N 362
           +
Sbjct: 308 D 308

>CAGL0I08987g Chr9 complement(871699..873084) [1386 bp, 461 aa] {ON}
           highly similar to uniprot|P04076 Saccharomyces
           cerevisiae YHR018c ARLY
          Length = 461

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 59/239 (24%), Positives = 93/239 (38%), Gaps = 25/239 (10%)

Query: 126 ANEVISNRAIELIGGELGSKKIHPNNHCNQAQSSNDTFPSVMHIAAVTEITNSLLPEITQ 185
           ANE    R  ELIG ++  K        +  +S ND   + M I     +   + P +  
Sbjct: 92  ANE---RRLGELIGRDIAGK-------VHTGRSRNDQVVTDMRIYCREILNEKIFPAMKS 141

Query: 186 LKDALHKKAEEFQDIVKIGRTHLQDATPLTLGQEFSGYVQQLVNGIARIENTLPHLKYLA 245
           L + L  +AE+  DI+  G THLQ A P+      S Y       + R+E     L    
Sbjct: 142 LINVLVNRAEKEIDILMPGYTHLQRAQPIRWAHWLSSYATYFTEDLKRLEQIAERLNKSP 201

Query: 246 QGGTAVGTGLNTKEGFDK-LIAEQISKETGIDFK-TAPNKFEALAAHDAIVEASGALNTV 303
            G  A+        G D+  +AE      G+ F     N   A++  D +VE        
Sbjct: 202 LGSGALA---GHPYGIDRQFLAE------GLGFNGVIGNSLVAVSDRDFVVELMFWATLF 252

Query: 304 ACSLFKIAQDIRYLGSGPRCGYGELHLPE-NEPGSSIMPGKVNPTQNEAMTQVCVQVMG 361
              + + ++D+    +     +G + L +    GSS+MP K N    E +     +V G
Sbjct: 253 MNHVSRFSEDLIIYSTAE---FGFIKLSDAYSTGSSLMPQKKNADSLELLRGKSGRVFG 308

>TPHA0A02190 Chr1 (452902..454293) [1392 bp, 463 aa] {ON} Anc_1.354
           YHR018C
          Length = 463

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 59/238 (24%), Positives = 97/238 (40%), Gaps = 21/238 (8%)

Query: 126 ANEVISNRAIELIGGELGSKKIHPNNHCNQAQSSNDTFPSVMHIAAVTEITNSLLPEITQ 185
           ANE    R  E+IG ++ S K+H        +S ND   + + I     +++ LL  +  
Sbjct: 91  ANE---RRLGEIIGTKI-SGKVHT------GRSRNDQCVTDLRIYCREYLSDKLLKNLET 140

Query: 186 LKDALHKKAEEFQDIVKIGRTHLQDATPLTLGQEFSGYVQQLVNGIARIENTLPHLKYLA 245
           L + L  +AEE  + +  G THLQ A P+      S Y    +    R+      L    
Sbjct: 141 LINVLINRAEEEIEFIMPGYTHLQRAQPIRWSHWLSSYATYFLEDYKRLVQLKERLNKSP 200

Query: 246 QGGTAVGTGLNTKEGFDKLIAEQISKETGIDFKTAPNKFEALAAHDAIVEASGALNTVAC 305
            G  A+        G D+   E ++++ G D     N   A++  D +VE          
Sbjct: 201 LGAGALA---GHPYGIDR---EYLAEKLGFD-SVIGNSLVAVSDRDFVVEILFWSTLFMN 253

Query: 306 SLFKIAQDIRYLGSGPRCGYGELHLPE-NEPGSSIMPGKVNPTQNEAMTQVCVQVMGN 362
            + + A+D+    +     +G + L +    GSS+MP K N    E +     +V GN
Sbjct: 254 HISRFAEDLIIYSTAE---FGFIKLSDAYSTGSSLMPQKKNADSLELLRGKSGRVFGN 308

>NDAI0J01950 Chr10 (485753..487201) [1449 bp, 482 aa] {ON} Anc_4.197
           YLR359W
          Length = 482

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 52/191 (27%), Positives = 88/191 (46%), Gaps = 29/191 (15%)

Query: 179 LLPEITQLKDALHKKAEEFQDIVKIGRTHLQDATPLTLGQEFSGYVQQL---VNGIARIE 235
           ++P++  + D L K A E++D+  +G TH Q A   TLG+  + ++Q+L   +    R  
Sbjct: 128 VIPKLVNVIDRLSKFAMEYKDLPVLGWTHFQPAQLTTLGKRATLWIQELLWDLRNFVRAR 187

Query: 236 NTLPHLKYLAQGGT-----AVGTGLNTK-EGFDKLIAEQISKET--GIDFKTAPNKFEAL 287
           N +         GT     A+  G + K E  DK + E +  +T   +  +T   K +  
Sbjct: 188 NDIGLRGVKGTTGTQASFLALFHGDHDKVEALDKRVTELLGFDTVYPVTGQTYSRKID-- 245

Query: 288 AAHDAIVEASGALNTVACSLFKIAQDIRYLGSGPRCGYGELHLP--ENEPGSSIMPGKVN 345
                 ++    L++ A +  K+A DIR L +       EL  P  +++ GSS M  K N
Sbjct: 246 ------IDVLAPLSSFAATAHKMATDIRLLAN-----LKELEEPFEKSQIGSSAMAYKRN 294

Query: 346 PTQNEAMTQVC 356
           P + E   +VC
Sbjct: 295 PMRCE---RVC 302

>Kwal_47.18066 s47 (668459..669907) [1449 bp, 482 aa] {ON} YLR359W
           (ADE13) - Adenylosuccinate Lyase [contig 198] FULL
          Length = 482

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 51/192 (26%), Positives = 87/192 (45%), Gaps = 31/192 (16%)

Query: 179 LLPEITQLKDALHKKAEEFQDIVKIGRTHLQDATPLTLGQEFSGYVQQL---VNGIARIE 235
           L+P++  + D L K A E++D+  +G TH Q A   TLG+  + ++Q+L   +    R  
Sbjct: 128 LIPKLVNVIDRLSKFAMEWKDLPVLGWTHFQPAQLTTLGKRVTLWIQELLWDLRNFVRAR 187

Query: 236 NTLPHLKYLAQGGTAVGTGL-------NTKEGFDKLIAEQISKET--GIDFKTAPNKFEA 286
           N +         GT  G+ L       +  E  DK + E +  +T   +  +T   K + 
Sbjct: 188 NDIGLRGVKGTTGTQ-GSFLALFHSDHDKVEALDKRVTELLGFDTVYPVTGQTYSRKID- 245

Query: 287 LAAHDAIVEASGALNTVACSLFKIAQDIRYLGSGPRCGYGELHLP--ENEPGSSIMPGKV 344
                  ++    L++ A +  K+A DIR L +       E+  P  +++ GSS M  K 
Sbjct: 246 -------IDVLAPLSSFAATAHKMATDIRLLAN-----LKEIEEPFEKSQIGSSAMAYKR 293

Query: 345 NPTQNEAMTQVC 356
           NP + E   +VC
Sbjct: 294 NPMRCE---RVC 302

>Kpol_1042.16 s1042 (40749..42197) [1449 bp, 482 aa] {ON}
           (40749..42197) [1449 nt, 483 aa]
          Length = 482

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 49/189 (25%), Positives = 86/189 (45%), Gaps = 25/189 (13%)

Query: 179 LLPEITQLKDALHKKAEEFQDIVKIGRTHLQDATPLTLGQEFSGYVQQL---VNGIARIE 235
           ++P++  + D L K A E++D+  +G TH Q A   T+G+  + ++Q+L   +    R  
Sbjct: 128 IIPKLVNVIDRLAKFASEYKDLPVLGWTHFQPAQLTTMGKRATLWIQELLWDLRNFVRAR 187

Query: 236 NTLPHLKYLAQGGT-----AVGTGLNTK-EGFDKLIAEQISKET--GIDFKTAPNKFEAL 287
           N +         GT     A+  G + K E  DK + E +  +T   +  +T   K +  
Sbjct: 188 NDIGLRGVKGTTGTQASFLALFHGDDDKVEALDKRVVELLGFDTVYPVTGQTYSRKID-- 245

Query: 288 AAHDAIVEASGALNTVACSLFKIAQDIRYLGSGPRCGYGELHLPENEPGSSIMPGKVNPT 347
                 ++    L++ A +  K+A DIR L +       E    +++ GSS M  K NP 
Sbjct: 246 ------IDVLAPLSSFAATAHKMATDIRLLANLKEV---EEPFEKSQIGSSAMAYKRNPM 296

Query: 348 QNEAMTQVC 356
           + E   +VC
Sbjct: 297 RCE---RVC 302

>NCAS0J01200 Chr10 (209722..211170) [1449 bp, 482 aa] {ON} Anc_4.197
           YLR359W
          Length = 482

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 51/191 (26%), Positives = 87/191 (45%), Gaps = 29/191 (15%)

Query: 179 LLPEITQLKDALHKKAEEFQDIVKIGRTHLQDATPLTLGQEFSGYVQQL---VNGIARIE 235
           ++P++  + D L K A E++D+  +G TH Q A   TLG+  + ++Q+L   +    R  
Sbjct: 128 IIPKLVNVIDRLSKFAMEYKDLPVLGWTHFQPAQLTTLGKRVTLWIQELLWDLRNFVRAR 187

Query: 236 NTLPHLKYLAQGGT-----AVGTGLNTK-EGFDKLIAEQISKET--GIDFKTAPNKFEAL 287
           N +         GT     A+  G + K E  DK + E +  +T   +  +T   K +  
Sbjct: 188 NDIGLRGVKGTTGTQASFLALFHGDHDKVEALDKRVTELLGFDTVYPVTGQTYSRKID-- 245

Query: 288 AAHDAIVEASGALNTVACSLFKIAQDIRYLGSGPRCGYGELHLP--ENEPGSSIMPGKVN 345
                 ++    L + A +  K+A DIR L +       E+  P  +++ GSS M  K N
Sbjct: 246 ------IDVLAPLASFAATAHKMATDIRLLAN-----LKEIEEPFEKSQIGSSAMAYKRN 294

Query: 346 PTQNEAMTQVC 356
           P + E   +VC
Sbjct: 295 PMRCE---RVC 302

>KLLA0B13189g Chr2 complement(1153780..1155228) [1449 bp, 482 aa]
           {ON} highly similar to uniprot|Q05911 Saccharomyces
           cerevisiae YLR359W ADE13 Adenylosuccinate lyase
           catalyzes two steps in the 'de novo' purine nucleotide
           biosynthetic pathway
          Length = 482

 Score = 47.4 bits (111), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 52/191 (27%), Positives = 87/191 (45%), Gaps = 29/191 (15%)

Query: 179 LLPEITQLKDALHKKAEEFQDIVKIGRTHLQDATPLTLGQEFSGYVQQL---VNGIARIE 235
           L+P++  + + L K A E++D+  +G TH Q A   TLG+  + ++Q+L   +    R  
Sbjct: 128 LIPKLVNVINRLSKFALEYKDLPVLGWTHFQPAQLTTLGKRVTLWIQELLWDLRNFVRAR 187

Query: 236 NTLPHLKYLAQGGT-----AVGTGLNTK-EGFDKLIAEQISKET--GIDFKTAPNKFEAL 287
           N +         GT      +  G + K E  DK +AE +   T   +  +T   K +  
Sbjct: 188 NDIGLRGVKGTTGTQASFLTLFHGDHDKVEALDKRVAELLGFSTVYPVTGQTYSRKID-- 245

Query: 288 AAHDAIVEASGALNTVACSLFKIAQDIRYLGSGPRCGYGELHLP--ENEPGSSIMPGKVN 345
                 ++    L++ A +  K+A DIR L +       EL  P  +++ GSS M  K N
Sbjct: 246 ------IDVLAPLSSFAATAHKMATDIRLLAN-----LKELEEPFEKSQIGSSAMAYKRN 294

Query: 346 PTQNEAMTQVC 356
           P + E   +VC
Sbjct: 295 PMRCE---RVC 302

>KLTH0G19338g Chr7 complement(1665123..1666520) [1398 bp, 465 aa]
           {ON} highly similar to uniprot|P04076 Saccharomyces
           cerevisiae YHR018C ARG4 Argininosuccinate lyase
           catalyzes the final step in the arginine biosynthesis
           pathway
          Length = 465

 Score = 47.4 bits (111), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 66/276 (23%), Positives = 109/276 (39%), Gaps = 32/276 (11%)

Query: 94  QQAADEVAKGK--LNDHFPLVVFQTGSGTQSNMNANEVISNRAIELIGGELGSKKIHPNN 151
           Q+  DE+ +G   +   +    F    G +    ANE    R  E+IG  +  K      
Sbjct: 59  QEELDEIHRGLEIIRGEWASNSFVEKDGDEDIHTANE---RRLGEIIGRHIAGK------ 109

Query: 152 HCNQAQSSNDTFPSVMHIAAVTEITNSLLPEITQLKDALHKKAEEFQDIVKIGRTHLQDA 211
             +  +S ND   + M I    E  +++   +  L  A+ ++AE+  D +  G THLQ A
Sbjct: 110 -VHTGRSRNDQVATDMRIYC-REALDNMAKILKDLVGAILQRAEQEIDALMPGYTHLQRA 167

Query: 212 TPLTLGQEFSGYVQQLVNGIARIENTLPHLKYLAQGGTAVGTGLNTKEGFDKLIAEQISK 271
            P+      + Y         R++     L     G  A+        G D+   E I++
Sbjct: 168 QPIRWSHWLNLYATYFTEDFKRLKQIRERLNVSPLGCGALA---GHPYGIDR---EHIAE 221

Query: 272 ETGIDFKTAPNKFEALAAHDAIVEASGALNTVACSLF-----KIAQDIRYLGSGPRCGYG 326
             G D     N  +A++  D +VE         CSLF     + ++D+  + S     + 
Sbjct: 222 RLGFD-GVIGNSLQAVSDRDFVVEI-----LFWCSLFMNHISRFSEDL-IIYSTAEFNFV 274

Query: 327 ELHLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGN 362
           +L       GSS+MP K NP   E +     +V G+
Sbjct: 275 KLS-DAYSTGSSLMPQKKNPDSLELLRGKSGRVFGS 309

>KNAG0B05840 Chr2 (1150025..1151473) [1449 bp, 482 aa] {ON}
           Anc_4.197 YLR359W
          Length = 482

 Score = 47.0 bits (110), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 50/189 (26%), Positives = 86/189 (45%), Gaps = 25/189 (13%)

Query: 179 LLPEITQLKDALHKKAEEFQDIVKIGRTHLQDATPLTLGQEFSGYVQQL---VNGIARIE 235
           ++P++  + D L K A +++D+  +G TH Q A   TLG+  + ++Q+L   +    R  
Sbjct: 128 VIPKLVNVIDRLSKFALQYKDLPVLGWTHFQPAQLTTLGKRTTLWIQELLWDLRNFVRAR 187

Query: 236 NTLPHLKYLAQGGT-----AVGTGLNTK-EGFDKLIAEQISKET--GIDFKTAPNKFEAL 287
           N +         GT     A+  G + K E  DK + E +  +T   +  +T   K +  
Sbjct: 188 NDIGLRGVKGTTGTQASFLALFHGDHDKVEALDKRVTELLGFDTVYPVTGQTYSRKID-- 245

Query: 288 AAHDAIVEASGALNTVACSLFKIAQDIRYLGSGPRCGYGELHLPENEPGSSIMPGKVNPT 347
                 ++    L++ A S  K+A DIR L +       E    +++ GSS M  K NP 
Sbjct: 246 ------IDVLAPLSSFAASAHKMATDIRLLANLKEV---EEPFEKSQIGSSAMAYKRNPM 296

Query: 348 QNEAMTQVC 356
           + E   +VC
Sbjct: 297 RCE---RVC 302

>Suva_10.459 Chr10 (803809..805257) [1449 bp, 482 aa] {ON} YLR359W
           (REAL)
          Length = 482

 Score = 46.6 bits (109), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 48/184 (26%), Positives = 87/184 (47%), Gaps = 15/184 (8%)

Query: 179 LLPEITQLKDALHKKAEEFQDIVKIGRTHLQDATPLTLGQEFSGYVQQLVNGIARIENTL 238
           ++P++  + + L K A E++D+  +G TH Q A   TLG+  + ++Q+L+  +   E   
Sbjct: 128 IIPKLVNVINRLAKFAMEYKDLPVLGWTHFQPAQLTTLGKRTTLWIQELLWDLRNFERAR 187

Query: 239 PHLKYLAQGGTAVGTGLNTKEGF----DKL--IAEQISKETGIDFKTAPNKFEALAAHDA 292
             +      GT  GT  +    F    DK+  + E++++  G D K  P   +   +   
Sbjct: 188 NDIGLRGVKGTT-GTQASFLALFHGNHDKVEALDERVTELLGFD-KVYPVTGQTY-SRKI 244

Query: 293 IVEASGALNTVACSLFKIAQDIRYLGSGPRCGYGELHLPENEPGSSIMPGKVNPTQNEAM 352
            ++    L++ A +  K+A DIR L +       E    +++ GSS M  K NP + E  
Sbjct: 245 DIDVLAPLSSFAATAHKMATDIRLLANLKEV---EEPFEKSQIGSSAMAYKRNPMRCE-- 299

Query: 353 TQVC 356
            +VC
Sbjct: 300 -RVC 302

>YLR359W Chr12 (844282..845730) [1449 bp, 482 aa] {ON}
           ADE13Adenylosuccinate lyase, catalyzes two steps in the
           'de novo' purine nucleotide biosynthetic pathway;
           expression is repressed by adenine and activated by
           Bas1p and Pho2p; mutations in human ortholog ADSL cause
           adenylosuccinase deficiency
          Length = 482

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 48/184 (26%), Positives = 87/184 (47%), Gaps = 15/184 (8%)

Query: 179 LLPEITQLKDALHKKAEEFQDIVKIGRTHLQDATPLTLGQEFSGYVQQLVNGIARIENTL 238
           ++P++  + + L K A E++D+  +G TH Q A   TLG+  + ++Q+L+  +   E   
Sbjct: 128 IIPKLVNVINRLAKFAMEYKDLPVLGWTHFQPAQLTTLGKRATLWIQELLWDLRNFERAR 187

Query: 239 PHLKYLAQGGTAVGTGLNTKEGF----DKL--IAEQISKETGIDFKTAPNKFEALAAHDA 292
             +      GT  GT  +    F    DK+  + E++++  G D K  P   +   +   
Sbjct: 188 NDIGLRGVKGTT-GTQASFLALFHGNHDKVEALDERVTELLGFD-KVYPVTGQTY-SRKI 244

Query: 293 IVEASGALNTVACSLFKIAQDIRYLGSGPRCGYGELHLPENEPGSSIMPGKVNPTQNEAM 352
            ++    L++ A +  K+A DIR L +       E    +++ GSS M  K NP + E  
Sbjct: 245 DIDVLAPLSSFAATAHKMATDIRLLANLKEV---EEPFEKSQIGSSAMAYKRNPMRCE-- 299

Query: 353 TQVC 356
            +VC
Sbjct: 300 -RVC 302

>Smik_12.446 Chr12 (783341..784789) [1449 bp, 482 aa] {ON} YLR359W
           (REAL)
          Length = 482

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 48/184 (26%), Positives = 86/184 (46%), Gaps = 15/184 (8%)

Query: 179 LLPEITQLKDALHKKAEEFQDIVKIGRTHLQDATPLTLGQEFSGYVQQLVNGIARIENTL 238
           ++P++  + + L K A E++D+  +G TH Q A   TLG+  + ++Q+L+  +   E   
Sbjct: 128 IIPKLVNVINRLAKFAMEYKDLPVLGWTHFQPAQLTTLGKRATLWIQELLWDLRNFERAR 187

Query: 239 PHLKYLAQGGTAVGTGLNTKEGF----DKL--IAEQISKETGIDFKTAPNKFEALAAHDA 292
             +      GT  GT  +    F    DK+  + E++++  G D K  P   +   +   
Sbjct: 188 NDIGLRGVKGTT-GTQASFLALFHGNHDKVEALDERVTELLGFD-KVYPVTGQTY-SRKI 244

Query: 293 IVEASGALNTVACSLFKIAQDIRYLGSGPRCGYGELHLPENEPGSSIMPGKVNPTQNEAM 352
            ++    L++ A +  K+A DIR L +       E    + + GSS M  K NP + E  
Sbjct: 245 DIDVLAPLSSFAATAHKMATDIRLLANLKEV---EEPFEKTQIGSSAMAYKRNPMRCE-- 299

Query: 353 TQVC 356
            +VC
Sbjct: 300 -RVC 302

>SAKL0B04972g Chr2 (430349..431797) [1449 bp, 482 aa] {ON} highly
           similar to uniprot|Q05911 Saccharomyces cerevisiae
           YLR359W ADE13 Adenylosuccinate lyase catalyzes two steps
           in the 'de novo' purine nucleotide biosynthetic pathway
          Length = 482

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 50/191 (26%), Positives = 88/191 (46%), Gaps = 29/191 (15%)

Query: 179 LLPEITQLKDALHKKAEEFQDIVKIGRTHLQDATPLTLGQEFSGYVQQL---VNGIARIE 235
           L+P++  + + L + A E++D+  +G TH Q A   TLG+  + ++Q+L   +    R  
Sbjct: 128 LIPKLVNVINRLSQFALEYKDLPVLGWTHFQPAQLTTLGKRVTLWIQELLWDLRNFVRAR 187

Query: 236 NTLPHLKYLAQGGT-----AVGTGLNTK-EGFDKLIAEQISKET--GIDFKTAPNKFEAL 287
           N +         GT     A+  G + K E  DK + E +  +T   +  +T   K +  
Sbjct: 188 NDIGLRGVKGTTGTQASFLALFHGDHDKVEALDKRVTELLGFDTVYPVTGQTYSRKID-- 245

Query: 288 AAHDAIVEASGALNTVACSLFKIAQDIRYLGSGPRCGYGELHLP--ENEPGSSIMPGKVN 345
                 ++    L++ A +  K+A DIR L +       E+  P  +++ GSS M  K N
Sbjct: 246 ------IDVLAPLSSFAATAHKMATDIRLLAN-----LKEMEEPFEKSQIGSSAMAYKRN 294

Query: 346 PTQNEAMTQVC 356
           P + E   +VC
Sbjct: 295 PMRCE---RVC 302

>CAGL0B02794g Chr2 complement(269303..270751) [1449 bp, 482 aa] {ON}
           highly similar to uniprot|Q05911 Saccharomyces
           cerevisiae YLR359w ADE13
          Length = 482

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 49/190 (25%), Positives = 87/190 (45%), Gaps = 27/190 (14%)

Query: 179 LLPEITQLKDALHKKAEEFQDIVKIGRTHLQDATPLTLGQEFSGYVQQLVNGIARIENTL 238
           ++P++  + + L K A E++D+  +G TH Q A   TLG+  + ++Q+L+  +   E   
Sbjct: 128 VIPKLVNVINRLAKFALEYKDLPVLGWTHFQPAQLTTLGKRATLWIQELLWDLRNFERAR 187

Query: 239 PHLKYLAQGGTAVGTGLNTKEGF----DKL--IAEQISKETGIDF------KTAPNKFEA 286
             +      GT  GT  +    F    DK+  + E++++  G D       +T   K + 
Sbjct: 188 NDIGLRGVKGT-TGTQASFLALFHGNHDKVEELDERVTELLGFDTVYPVTGQTYSRKID- 245

Query: 287 LAAHDAIVEASGALNTVACSLFKIAQDIRYLGSGPRCGYGELHLPENEPGSSIMPGKVNP 346
                  ++    L++ A S  K+A DIR L +       E    +++ GSS M  K NP
Sbjct: 246 -------IDVLAPLSSFAASAHKMATDIRLLANLKEV---EEPFEKSQIGSSAMAYKRNP 295

Query: 347 TQNEAMTQVC 356
            + E   +VC
Sbjct: 296 MRCE---RVC 302

>TPHA0B01040 Chr2 complement(235467..236915) [1449 bp, 482 aa] {ON}
           Anc_4.197 YLR359W
          Length = 482

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 50/191 (26%), Positives = 86/191 (45%), Gaps = 25/191 (13%)

Query: 177 NSLLPEITQLKDALHKKAEEFQDIVKIGRTHLQDATPLTLGQEFSGYVQQL---VNGIAR 233
           + ++P++  + D L K A E++D+  +G TH Q A   TLG+  + ++Q+L   +    R
Sbjct: 126 DVIIPKLVNVIDRLSKFAMEYKDLPVLGWTHFQPAQLTTLGKRSTLWIQELLWDLRNFVR 185

Query: 234 IENTLPHLKYLAQGGT-----AVGTGLNTK-EGFDKLIAEQISKET--GIDFKTAPNKFE 285
             N L         GT     A+  G + K E  D+ + E +  +T   +  +T   K +
Sbjct: 186 ARNDLGLRGVKGTTGTQASFLALFHGNHDKVEELDERVTELLGFDTVYPVTGQTYSRKID 245

Query: 286 ALAAHDAIVEASGALNTVACSLFKIAQDIRYLGSGPRCGYGELHLPENEPGSSIMPGKVN 345
                   ++    L + A +  K+A DIR L +       E    +++ GSS M  K N
Sbjct: 246 --------IDVLAPLASFAATAHKMATDIRLLANLKEV---EEPFEKSQIGSSAMAYKRN 294

Query: 346 PTQNEAMTQVC 356
           P + E   +VC
Sbjct: 295 PMRCE---RVC 302

>Ecym_2452 Chr2 (881643..883091) [1449 bp, 482 aa] {ON} similar to
           Ashbya gossypii ABL006C
          Length = 482

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 51/195 (26%), Positives = 87/195 (44%), Gaps = 37/195 (18%)

Query: 179 LLPEITQLKDALHKKAEEFQDIVKIGRTHLQDATPLTLGQEFSGYVQQLVNGIARIENTL 238
           L+P++  + + L   A +++D+  +G TH Q A   TLG+  + ++Q+L+  +       
Sbjct: 128 LIPKLVNVINRLSTFAIKYKDLPVLGWTHYQPAQLTTLGKRVTLWIQELLWDLRNFVRAR 187

Query: 239 PHLKYLAQGGT--------AVGTGLNTK-EGFDKLIAEQISKETGIDF------KTAPNK 283
             + +    GT        A+  G + K E  DK +AE     +G D       +T   K
Sbjct: 188 NDIGFRGVKGTTGTQASFLALFHGDHDKVEALDKRVAEL----SGFDIIYPVTGQTYSRK 243

Query: 284 FEALAAHDAIVEASGALNTVACSLFKIAQDIRYLGSGPRCGYGELHLP--ENEPGSSIMP 341
            +        ++  G L++ A +  K+A DIR L +       EL  P   ++ GSS M 
Sbjct: 244 VD--------IDVLGPLSSFAATSHKLATDIRLLAN-----LKELEEPFEASQIGSSAMA 290

Query: 342 GKVNPTQNEAMTQVC 356
            K NP + E   +VC
Sbjct: 291 YKRNPMRCE---RVC 302

>Skud_12.443 Chr12 (784448..785896) [1449 bp, 482 aa] {ON} YLR359W
           (REAL)
          Length = 482

 Score = 44.3 bits (103), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 47/184 (25%), Positives = 86/184 (46%), Gaps = 15/184 (8%)

Query: 179 LLPEITQLKDALHKKAEEFQDIVKIGRTHLQDATPLTLGQEFSGYVQQLVNGIARIENTL 238
           ++P++  + + L K A E++D+  +G TH Q A   TLG+  + ++Q+L+  +   E   
Sbjct: 128 IIPKLVNVINRLAKFAMEYKDLPVLGWTHFQPAQLTTLGKRATLWIQELLWDLRNFERAR 187

Query: 239 PHLKYLAQGGTAVGTGLNTKEGF----DKL--IAEQISKETGIDFKTAPNKFEALAAHDA 292
             +      GT  GT  +    F    DK+  +  ++++  G D K  P   +   +   
Sbjct: 188 NDIGLRGVKGTT-GTQASFLALFHGNHDKVEALDARVTELLGFD-KVYPVTGQTY-SRKI 244

Query: 293 IVEASGALNTVACSLFKIAQDIRYLGSGPRCGYGELHLPENEPGSSIMPGKVNPTQNEAM 352
            ++    L++ A +  K+A DIR L +       E    +++ GSS M  K NP + E  
Sbjct: 245 DIDVLAPLSSFAATAHKMATDIRLLANLKEV---EEPFEKSQIGSSAMAYKRNPMRCE-- 299

Query: 353 TQVC 356
            +VC
Sbjct: 300 -RVC 302

>ZYRO0B07964g Chr2 complement(620761..622209) [1449 bp, 482 aa] {ON}
           highly similar to uniprot|Q05911 Saccharomyces
           cerevisiae YLR359W ADE13 Adenylosuccinate lyase
           catalyzes two steps in the 'de novo' purine nucleotide
           biosynthetic pathway
          Length = 482

 Score = 43.9 bits (102), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 47/191 (24%), Positives = 83/191 (43%), Gaps = 25/191 (13%)

Query: 177 NSLLPEITQLKDALHKKAEEFQDIVKIGRTHLQDATPLTLGQEFSGYVQQLVNGIARIEN 236
           + ++P++  + D L K A  ++D+  +G TH Q A   TLG+  + ++Q L+  +   + 
Sbjct: 126 DVIIPKLINVIDRLSKFALNYKDVPVLGWTHFQPAQLTTLGKRVTLWIQDLLWDLRNFDR 185

Query: 237 TLPHLKYLAQGGT--------AVGTGLNTK-EGFDKLIAEQISKET--GIDFKTAPNKFE 285
               +      GT        A+  G + K E  D+ + E +  ET   +  +T   K +
Sbjct: 186 ARNDIGLRGVKGTTGTQASFLALFHGNHDKVEELDQRVTELLGFETVYPVTGQTYSRKID 245

Query: 286 ALAAHDAIVEASGALNTVACSLFKIAQDIRYLGSGPRCGYGELHLPENEPGSSIMPGKVN 345
                   ++    L + A +  K+A DIR L +       E    + + GSS M  K N
Sbjct: 246 --------IDVLAPLASFAATAHKMATDIRLLANLKEV---EEPFEKTQIGSSAMAYKRN 294

Query: 346 PTQNEAMTQVC 356
           P + E   +VC
Sbjct: 295 PMRCE---RVC 302

>KLTH0A03344g Chr1 (289188..290636) [1449 bp, 482 aa] {ON} highly
           similar to uniprot|Q05911 Saccharomyces cerevisiae
           YLR359W ADE13 Adenylosuccinate lyase catalyzes two steps
           in the 'de novo' purine nucleotide biosynthetic pathway
          Length = 482

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 49/191 (25%), Positives = 87/191 (45%), Gaps = 29/191 (15%)

Query: 179 LLPEITQLKDALHKKAEEFQDIVKIGRTHLQDATPLTLGQEFSGYVQQL---VNGIARIE 235
           L+P++  + + L + A +++D+  +G TH Q A   TLG+  + ++Q+L   +    R  
Sbjct: 128 LIPKLVNVINRLSQFALQWKDLPVLGWTHFQPAQLTTLGKRVTLWIQELLWDLRNFVRAR 187

Query: 236 NTLPHLKYLAQGGT-----AVGTGLNTK-EGFDKLIAEQISKET--GIDFKTAPNKFEAL 287
           N +         GT     A+  G + K E  DK + E +  +T   +  +T   K +  
Sbjct: 188 NDIGLRGVKGTTGTQASFLALFHGDHDKVEALDKRVTELLGFDTVYPVTGQTYSRKID-- 245

Query: 288 AAHDAIVEASGALNTVACSLFKIAQDIRYLGSGPRCGYGELHLP--ENEPGSSIMPGKVN 345
                 ++    L + A +  K+A DIR L +       E+  P  +++ GSS M  K N
Sbjct: 246 ------IDVLAPLCSFAATAHKMATDIRLLAN-----LKEIEEPFEKSQIGSSAMAYKRN 294

Query: 346 PTQNEAMTQVC 356
           P + E   +VC
Sbjct: 295 PMRCE---RVC 302

>TDEL0E01760 Chr5 complement(337315..338763) [1449 bp, 482 aa] {ON}
           Anc_4.197 YLR359W
          Length = 482

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 48/191 (25%), Positives = 87/191 (45%), Gaps = 29/191 (15%)

Query: 179 LLPEITQLKDALHKKAEEFQDIVKIGRTHLQDATPLTLGQEFSGYVQQL---VNGIARIE 235
           ++P++  + + L   A +++D+  +G TH Q A   TLG+  + ++Q+L   +    R  
Sbjct: 128 IIPKLVNVINRLSDFALKYKDLPVLGWTHFQPAQLTTLGKRVTLWIQELLWDLRNFVRAR 187

Query: 236 NTLPHLKYLAQGGT-----AVGTGLNTK-EGFDKLIAEQISKET--GIDFKTAPNKFEAL 287
           N +         GT     A+  G + K E  DK + E +  +T   +  +T   K +  
Sbjct: 188 NDIGLRGVKGTTGTQASFLALFHGDHDKVEALDKRVTELLGFDTVYPVTGQTYSRKID-- 245

Query: 288 AAHDAIVEASGALNTVACSLFKIAQDIRYLGSGPRCGYGELHLP--ENEPGSSIMPGKVN 345
                 ++    L++ A +  K+A DIR L +       E+  P  +++ GSS M  K N
Sbjct: 246 ------IDVLSPLSSFAATAHKMATDIRLLAN-----LKEMEEPFEKSQIGSSAMAYKRN 294

Query: 346 PTQNEAMTQVC 356
           P + E   +VC
Sbjct: 295 PMRCE---RVC 302

>Kwal_27.12782 s27 complement(1373166..1374563) [1398 bp, 465 aa]
           {ON} YHR018C (ARG4) - argininosuccinate lyase [contig
           260] FULL
          Length = 465

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 62/262 (23%), Positives = 102/262 (38%), Gaps = 32/262 (12%)

Query: 114 FQTGSGTQSNMNANEVISNRAIELIGGELGSKKIHPNNHCNQAQSSNDTFPSVMHIAAVT 173
           F    G +    ANE    R  E+IG  +  K        +  +S ND   + M I    
Sbjct: 81  FVEKDGDEDIHTANE---RRLGEIIGRHIAGK-------VHTGRSRNDQVATDMRIYC-R 129

Query: 174 EITNSLLPEITQLKDALHKKAEEFQDIVKIGRTHLQDATPLTLGQEFSGYVQQLVNGIAR 233
           E  ++L   +  L  A+ +++E+  D +  G THLQ A P+      + Y         R
Sbjct: 130 EALDNLAKILEDLIGAILQRSEQEIDALMPGYTHLQRAQPIRWSHWLNLYATYFTEDFKR 189

Query: 234 IENTLPHLKYLAQGGTAVGTGLNTKEGFDK-LIAEQISKETGIDFKTAPNKFEALAAHDA 292
           ++     L     G  A+        G D+  +AE++     I      N  +A++  D 
Sbjct: 190 LKQIRERLNVSPLGCGALA---GHPYGIDREFLAERLGFSDVI-----GNSLQAVSDRDF 241

Query: 293 IVEASGALNTVACSLF-----KIAQDIRYLGSGPRCGYGELHLPENEPGSSIMPGKVNPT 347
           +VE         CSLF     + ++D+  + S     + +L       GSS+MP K NP 
Sbjct: 242 VVEI-----MFWCSLFMNHISRFSEDL-IIYSTAEFNFVKLS-DAYSTGSSLMPQKKNPD 294

Query: 348 QNEAMTQVCVQVMGNNAAVTFA 369
             E +     +V G+ A    +
Sbjct: 295 SLELLRGKSGRVFGSLAGFMMS 316

>KAFR0A06230 Chr1 complement(1257709..1259157) [1449 bp, 482 aa]
           {ON} Anc_4.197 YLR359W
          Length = 482

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 48/190 (25%), Positives = 83/190 (43%), Gaps = 27/190 (14%)

Query: 179 LLPEITQLKDALHKKAEEFQDIVKIGRTHLQDATPLTLGQEFSGYVQQLVNGIARIENTL 238
           L+P++  + + L K A   +D+  +G TH Q A   TLG+  + ++Q+L+  +   E   
Sbjct: 128 LIPKLVNVINRLCKFAMANKDLPVLGWTHFQPAQLTTLGKRATLWIQELLWDLRNFERAR 187

Query: 239 PHLKYLAQGGTAVGTGL----------NTKEGFDKLIAEQISKET--GIDFKTAPNKFEA 286
             +      GT  GT            N  E  D+ + E +  +T   +  +T   K + 
Sbjct: 188 NDIGLRGVKGT-TGTQASFLALFHGDHNKVEKLDERVVELLGFDTVYPVTGQTYSRKID- 245

Query: 287 LAAHDAIVEASGALNTVACSLFKIAQDIRYLGSGPRCGYGELHLPENEPGSSIMPGKVNP 346
                  ++A   L++ A +  K+A DIR L +       E    +++ GSS M  K NP
Sbjct: 246 -------IDAFAPLSSFAATAHKMATDIRLLANLKEV---EEPFEKSQIGSSAMAYKRNP 295

Query: 347 TQNEAMTQVC 356
            + E   +VC
Sbjct: 296 MRCE---RVC 302

>TBLA0A08320 Chr1 complement(2043721..2045169) [1449 bp, 482 aa]
           {ON} Anc_4.197 YLR359W
          Length = 482

 Score = 40.4 bits (93), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 46/189 (24%), Positives = 84/189 (44%), Gaps = 25/189 (13%)

Query: 179 LLPEITQLKDALHKKAEEFQDIVKIGRTHLQDATPLTLGQEFSGYVQQLVNGIARIENTL 238
           ++P++  + + L   A E++D+  +G TH Q A   TLG+  + ++Q+L+  +   E   
Sbjct: 128 VIPKLVNVINRLANFALEYKDLPVLGWTHFQPAQLTTLGKRATLWIQELLWDLRNFERAR 187

Query: 239 PHLKYLAQGGT--------AVGTGLNTK-EGFDKLIAEQISKET--GIDFKTAPNKFEAL 287
             +      GT        A+  G + K E  D+ + E +  +T   +  +T   K +  
Sbjct: 188 NDIGLRGVKGTTGTQASFLALFHGNHDKVEELDERVVELLGFDTVYPVTGQTYSRKID-- 245

Query: 288 AAHDAIVEASGALNTVACSLFKIAQDIRYLGSGPRCGYGELHLPENEPGSSIMPGKVNPT 347
                 ++    L + A +  K+A DIR L +       E    +++ GSS M  K NP 
Sbjct: 246 ------IDVVSPLVSFAATAHKMATDIRLLANLKEV---EEPFEKSQIGSSAMAYKRNPM 296

Query: 348 QNEAMTQVC 356
           + E   +VC
Sbjct: 297 RCE---RVC 302

>ABL006C Chr2 complement(385134..386582) [1449 bp, 482 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR359W
           (ADE13)
          Length = 482

 Score = 40.0 bits (92), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 51/200 (25%), Positives = 83/200 (41%), Gaps = 47/200 (23%)

Query: 179 LLPEITQLKDALHKKAEEFQDIVKIGRTHLQDATPLTLGQEFSGYVQQL---VNGIARIE 235
           ++P++  + + L K A E++D+  +G TH Q A   TLG+  + ++Q+L   +    R  
Sbjct: 128 IIPKLVNVINRLSKFACEYKDLPVLGWTHFQPAQLTTLGKRATLWIQELLWDLRNFVRAR 187

Query: 236 NTLPHLKYLAQGGT-----AVGTGLNTK-EGFDKLIAEQI-------------SKETGID 276
           N +         GT     A+  G + + E  DK + E +             S++  ID
Sbjct: 188 NDIGLRGVKGTTGTQASFLALFHGDHDRVEALDKRVTELLGFDIVYPVTGQTYSRKIDID 247

Query: 277 FKTAPNKFEALAAHDAIVEASGALNTVACSLFKIAQDIRYLGSGPRCGYGELHLPENEPG 336
              + + FEA  AH                  K+A DIR L +       E    + + G
Sbjct: 248 ILGSGSSFEA-TAH------------------KMATDIRLLANLKEV---EEPFEKTQIG 285

Query: 337 SSIMPGKVNPTQNEAMTQVC 356
           SS M  K NP + E   +VC
Sbjct: 286 SSAMAYKRNPMRCE---RVC 302

>ZYRO0E09460g Chr5 complement(753030..756059) [3030 bp, 1009 aa]
           {ON} similar to uniprot|P53067 Saccharomyces cerevisiae
           YGL241W
          Length = 1009

 Score = 34.3 bits (77), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 32/54 (59%), Gaps = 1/54 (1%)

Query: 259 EGFDKLIAEQISKETGIDFKTAPNKFEALAAHDAIVEAS-GALNTVACSLFKIA 311
           E +D +I+E++  E GI F+T    F  + ++DA  EA   ALN + C + +++
Sbjct: 153 EIYDDVISEEMFFEEGIGFETLKIVFHVMNSYDANWEAKVAALNLLHCCILQMS 206

>Suva_2.256 Chr2 complement(439531..443268) [3738 bp, 1245 aa] {ON}
           YDR097C (REAL)
          Length = 1245

 Score = 31.2 bits (69), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 29/116 (25%), Positives = 55/116 (47%), Gaps = 11/116 (9%)

Query: 132 NRAIELIGGELGSKKI-HPNNHCNQAQSSNDTFPSVMHIAAVTE---ITNSLLPEITQLK 187
           NRAI  +G  +  K + HP  H +  +   D+  S++   A+ E   +T S LP++ ++ 
Sbjct: 647 NRAITPMGKRMMKKWLMHPLLHKHDIEKRLDSVDSLLQDIALREELEVTFSKLPDLERML 706

Query: 188 DALHK---KAEEFQDIVKIGRTHLQDATPL---TLGQEFSGYVQQLVNGIAR-IEN 236
             +H    K ++F+ ++    T +Q  + L    L  + S Y+     G+   +EN
Sbjct: 707 ARIHSRTIKVKDFEKVITAFETIVQLQSSLQNNNLKGDVSDYISSFPKGLVEGVEN 762

>KLTH0D14080g Chr4 (1149555..1152863) [3309 bp, 1102 aa] {ON}
           similar to uniprot|Q12749 Saccharomyces cerevisiae
           YLR383W RHC18 Protein involved in structural maintenance
           of chromosomes required for interchromosomal and sister
           chromatid recombination
          Length = 1102

 Score = 30.8 bits (68), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 13/39 (33%), Positives = 25/39 (64%)

Query: 175 ITNSLLPEITQLKDALHKKAEEFQDIVKIGRTHLQDATP 213
           +T++ LP+I  L+ ++H+K E+ +DI +  R  L +  P
Sbjct: 461 VTSNALPKIGSLQKSIHEKTEQIRDIAQGKRNFLSNFDP 499

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.131    0.373 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 48,730,842
Number of extensions: 2061592
Number of successful extensions: 5928
Number of sequences better than 10.0: 80
Number of HSP's gapped: 6119
Number of HSP's successfully gapped: 80
Length of query: 483
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 370
Effective length of database: 40,524,141
Effective search space: 14993932170
Effective search space used: 14993932170
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 68 (30.8 bits)