Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Agos_YGOB_Anc_2.5322.532ON1871734744e-60
Ecym_72562.532ON2431831326e-09
KLTH0D06820g2.532ON260751062e-05
Kwal_26.80162.532ON24081750.20
NOTE: 16 genes in the same pillar as Agos_YGOB_Anc_2.532 were not hit in these BLAST results
LIST: Kpol_1018.34 ZYRO0B01980g Skud_13.225 Smik_13.248 YMR069W NCAS0D02640 TBLA0G02220 KAFR0A01850 Suva_13.244 TDEL0A03060 KLLA0E18569g KNAG0C05820 TPHA0C04180 NDAI0I02270 CAGL0K02981g SAKL0A09460g

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Agos_YGOB_Anc_2.532
         (187 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Agos_YGOB_Anc_2.532 Chr7 complement(576382..576945) [564 bp, 187...   187   4e-60
Ecym_7256 Chr7 complement(541002..541733) [732 bp, 243 aa] {ON} ...    55   6e-09
KLTH0D06820g Chr4 (596520..597302) [783 bp, 260 aa] {ON} some si...    45   2e-05
Kwal_26.8016 s26 (612723..613445) [723 bp, 240 aa] {ON} YMR069W ...    33   0.20 

>Agos_YGOB_Anc_2.532 Chr7 complement(576382..576945) [564 bp, 187
           aa] {ON} ANNOTATED BY YGOB -
          Length = 187

 Score =  187 bits (474), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 109/173 (63%), Positives = 109/173 (63%)

Query: 15  FPPTLHGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPLYRAHARLLYPRLRDPAAWP 74
           FPPTLHG                                PLYRAHARLLYPRLRDPAAWP
Sbjct: 15  FPPTLHGLARAPAAPARLPAAARRRLAADLTALVAAGLAPLYRAHARLLYPRLRDPAAWP 74

Query: 75  RCKRAELLDPAALHILYRDPAGRLACFISLLLPGPADPVLYILELHVXXXXXXXXXXXXX 134
           RCKRAELLDPAALHILYRDPAGRLACFISLLLPGPADPVLYILELHV             
Sbjct: 75  RCKRAELLDPAALHILYRDPAGRLACFISLLLPGPADPVLYILELHVAAPFRRRGLAAAL 134

Query: 135 XXXXXXXXXXXXXXXXXXXVFTANRPALALYARAGFRPRRALHPDLTIMVCRL 187
                              VFTANRPALALYARAGFRPRRALHPDLTIMVCRL
Sbjct: 135 LDAATRTARAAGLTRLELTVFTANRPALALYARAGFRPRRALHPDLTIMVCRL 187

>Ecym_7256 Chr7 complement(541002..541733) [732 bp, 243 aa] {ON}
           similar to Saccharomyces cerevisiae YMR069W
          Length = 243

 Score = 55.5 bits (132), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 50/183 (27%), Positives = 63/183 (34%), Gaps = 50/183 (27%)

Query: 55  LYRAHARLLYPRLRDPAAWPRCKRAELLDPAALHILYR--DPAGRLACFISLLL------ 106
            Y  HA LLYPRL     W   KRAEL      H+LYR  +P G +A F+SLL       
Sbjct: 61  FYDVHAHLLYPRLTRSRPWQAHKRAELQGLGTCHVLYRKENPGGAIAGFVSLLFCDEPHW 120

Query: 107 --------------------------------PGPADPVLYILELHVXXXXXXXXXXXXX 134
                                           P P   V+Y++E+HV             
Sbjct: 121 PAGNGSRAAASTAERERGPSGRSAEPAFEETPPPPPCKVVYVMEIHVSPSFQNQGLGSCM 180

Query: 135 XXXXXXXXXXX-----XXXXXXXXVFTANRPALALYARAGFRPRRAL-----HPDLTIMV 184
                                   VFT NR ALALY R GF+          + +LT+M 
Sbjct: 181 LLCARQLVQHMQPSFPQLKGLELTVFTGNRQALALYRRQGFKTATNTEFFLSNSELTVMY 240

Query: 185 CRL 187
           C +
Sbjct: 241 CSI 243

>KLTH0D06820g Chr4 (596520..597302) [783 bp, 260 aa] {ON} some
           similarities with uniprot|Q04751 Saccharomyces
           cerevisiae YMR069W NAT4 N alpha-acetyl- transferase
           involved in acetylation of the N-terminal residues of
           histones H4 and H2A
          Length = 260

 Score = 45.4 bits (106), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 28/75 (37%), Positives = 40/75 (53%), Gaps = 9/75 (12%)

Query: 54  PLYRAHARLLYPRLRDPAAWPRCKRAELLDPAALHILYRDPAGRLACFISLLLPGP---- 109
           P+Y  HAR +Y   R   +WP  KRAE+  P  ++++Y D   +   F+SLLL       
Sbjct: 91  PMYTRHARAIYGAGRQ--SWPARKRAEMETPGLVYVVYSDSHSQPLVFMSLLLTDEPELG 148

Query: 110 ---ADPVLYILELHV 121
              A  VLY+ E+HV
Sbjct: 149 QELAARVLYLFEIHV 163

>Kwal_26.8016 s26 (612723..613445) [723 bp, 240 aa] {ON} YMR069W -
           Hypothetical ORF [contig 55] FULL
          Length = 240

 Score = 33.5 bits (75), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 40/81 (49%), Gaps = 16/81 (19%)

Query: 54  PLYRAHARLLYPRLRDPAAWPRCKRAELLDPAALHILYR---DPAGRLACFISL------ 104
           P+Y  HA+ LY       +W   KR E++ P  ++++YR   +  G+    ++       
Sbjct: 66  PVYAQHAKALYGD--QCGSWKERKRQEMVTPGLVYVVYRAVDEETGKEGLPLAFLSLLLT 123

Query: 105 ----LLPGPADPVLYILELHV 121
               L P PA  V+Y++E+HV
Sbjct: 124 DEPELGPAPA-AVVYLMEIHV 143

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.332    0.147    0.489 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 10,485,500
Number of extensions: 242646
Number of successful extensions: 388
Number of sequences better than 10.0: 4
Number of HSP's gapped: 391
Number of HSP's successfully gapped: 5
Length of query: 187
Length of database: 53,481,399
Length adjustment: 103
Effective length of query: 84
Effective length of database: 41,670,801
Effective search space: 3500347284
Effective search space used: 3500347284
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.9 bits)
S2: 62 (28.5 bits)