Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
AGR406C1.9ON68368334160.0
AGR405Cna 1ON71767924550.0
Ecym_1011na 1ON71668018880.0
SAKL0C00550g1.9ON73267918430.0
ZYRO0F18392g1.9ON72567817720.0
Kpol_2002.121.9ON73968817490.0
KNAG0C002601.9ON74468417350.0
KLLA0C00572g1.9ON71267617300.0
NCAS0B090701.9ON73067817260.0
Suva_3.1561.9ON71267817020.0
Smik_3.181.9ON71267916950.0
YCL057W (PRD1)1.9ON71267916930.0
NDAI0A001801.9ON74068016900.0
KAFR0D001801.9ON72368616850.0
CAGL0B00418g1.9ON74368416850.0
TBLA0A075601.9ON74168516810.0
TPHA0E039701.9ON74769116790.0
Skud_3.71.9ON71268816690.0
ABR185WsingletonON4574149741e-125
KNAG0A062002.432ON7895504381e-44
KAFR0D029502.432ON7776224301e-43
Kpol_297.82.432ON7876234246e-43
SAKL0E03938g2.432ON7676744211e-42
ZYRO0G20130g2.432ON7866704113e-41
CAGL0D02112g2.432ON7616364069e-41
NDAI0E020102.432ON7786184023e-40
Ecym_60992.432ON7735514007e-40
Skud_11.932.432ON7726243911e-38
TPHA0G023902.432ON7956283855e-38
AFR198W2.432ON7766153856e-38
Smik_11.1022.432ON7726443802e-37
Suva_11.912.432ON7756393775e-37
YKL134C (OCT1)2.432ON7726393661e-35
KLLA0B12397g2.432ON7795543643e-35
Kwal_26.76162.432ON7706353563e-34
NCAS0A042802.432ON7736233535e-34
TDEL0A020802.432ON7876203492e-33
TBLA0I007102.432ON7736363456e-33
KLTH0D04730g2.432ON7726173412e-32
Suva_11.1232.479ON152661725.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AGR406C
         (683 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AGR406C Chr7 complement(1472496..1474547) [2052 bp, 683 aa] {ON}...  1320   0.0  
AGR405C Chr7 complement(1469769..1471922) [2154 bp, 717 aa] {ON}...   950   0.0  
Ecym_1011 Chr1 (19924..22074) [2151 bp, 716 aa] {ON} similar to ...   731   0.0  
SAKL0C00550g Chr3 (48410..50608) [2199 bp, 732 aa] {ON} highly s...   714   0.0  
ZYRO0F18392g Chr6 complement(1518902..1521079) [2178 bp, 725 aa]...   687   0.0  
Kpol_2002.12 s2002 (21544..23763) [2220 bp, 739 aa] {ON} (21544....   678   0.0  
KNAG0C00260 Chr3 (39428..41662) [2235 bp, 744 aa] {ON} Anc_1.9 Y...   672   0.0  
KLLA0C00572g Chr3 (42069..44207) [2139 bp, 712 aa] {ON} similar ...   671   0.0  
NCAS0B09070 Chr2 complement(1741718..1743910) [2193 bp, 730 aa] ...   669   0.0  
Suva_3.156 Chr3 (234520..236658) [2139 bp, 712 aa] {ON} YCL057W ...   660   0.0  
Smik_3.18 Chr3 (26213..28351) [2139 bp, 712 aa] {ON} YCL057W (REAL)   657   0.0  
YCL057W Chr3 (24768..26906) [2139 bp, 712 aa] {ON}  PRD1Zinc met...   656   0.0  
NDAI0A00180 Chr1 (14692..16914) [2223 bp, 740 aa] {ON} Anc_1.9        655   0.0  
KAFR0D00180 Chr4 (18900..21071) [2172 bp, 723 aa] {ON} Anc_1.9 Y...   653   0.0  
CAGL0B00418g Chr2 (26584..28815) [2232 bp, 743 aa] {ON} similar ...   653   0.0  
TBLA0A07560 Chr1 complement(1871629..1873854) [2226 bp, 741 aa] ...   652   0.0  
TPHA0E03970 Chr5 complement(834023..836266) [2244 bp, 747 aa] {O...   651   0.0  
Skud_3.7 Chr3 (12763..14901) [2139 bp, 712 aa] {ON} YCL057W (REAL)    647   0.0  
ABR185W Chr2 (758126..758380,758380..758709,758709..759029,75903...   379   e-125
KNAG0A06200 Chr1 complement(937577..939946) [2370 bp, 789 aa] {O...   173   1e-44
KAFR0D02950 Chr4 complement(581305..583638) [2334 bp, 777 aa] {O...   170   1e-43
Kpol_297.8 s297 complement(11648..14011) [2364 bp, 787 aa] {ON} ...   167   6e-43
SAKL0E03938g Chr5 (317017..319320) [2304 bp, 767 aa] {ON} simila...   166   1e-42
ZYRO0G20130g Chr7 (1666665..1669025) [2361 bp, 786 aa] {ON} simi...   162   3e-41
CAGL0D02112g Chr4 complement(216204..218489) [2286 bp, 761 aa] {...   160   9e-41
NDAI0E02010 Chr5 complement(404579..406915) [2337 bp, 778 aa] {O...   159   3e-40
Ecym_6099 Chr6 complement(186647..188968) [2322 bp, 773 aa] {ON}...   158   7e-40
Skud_11.93 Chr11 complement(175243..177561) [2319 bp, 772 aa] {O...   155   1e-38
TPHA0G02390 Chr7 complement(486025..488412) [2388 bp, 795 aa] {O...   152   5e-38
AFR198W Chr6 (797448..799778) [2331 bp, 776 aa] {ON} Syntenic ho...   152   6e-38
Smik_11.102 Chr11 complement(175013..177331) [2319 bp, 772 aa] {...   150   2e-37
Suva_11.91 Chr11 complement(175327..177654) [2328 bp, 775 aa] {O...   149   5e-37
YKL134C Chr11 complement(189124..191442) [2319 bp, 772 aa] {ON} ...   145   1e-35
KLLA0B12397g Chr2 complement(1084129..1086468) [2340 bp, 779 aa]...   144   3e-35
Kwal_26.7616 s26 (444266..446578) [2313 bp, 770 aa] {ON} YKL134C...   141   3e-34
NCAS0A04280 Chr1 complement(864327..866648) [2322 bp, 773 aa] {O...   140   5e-34
TDEL0A02080 Chr1 complement(373425..375788) [2364 bp, 787 aa] {O...   139   2e-33
TBLA0I00710 Chr9 (128272..130593) [2322 bp, 773 aa] {ON} Anc_2.4...   137   6e-33
KLTH0D04730g Chr4 (432572..434890) [2319 bp, 772 aa] {ON} simila...   135   2e-32
Suva_11.123 Chr11 (235064..239644) [4581 bp, 1526 aa] {ON} YKL10...    32   5.3  

>AGR406C Chr7 complement(1472496..1474547) [2052 bp, 683 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YCL057W
           (PRD1); Tandem gene duplication in this genome
          Length = 683

 Score = 1320 bits (3416), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 647/683 (94%), Positives = 647/683 (94%)

Query: 1   MKDLASLVPPQAAPSWNFSAQDVISLSHQLINQTEAVYHNVLQEKPPTIDNYIMPLIYHE 60
           MKDLASLVPPQAAPSWNFSAQDVISLSHQLINQTEAVYHNVLQEKPPTIDNYIMPLIYHE
Sbjct: 1   MKDLASLVPPQAAPSWNFSAQDVISLSHQLINQTEAVYHNVLQEKPPTIDNYIMPLIYHE 60

Query: 61  EETDLLWNQLVFLRNVSPDPEIREASKNATSMLDDWIIGLTSKYDLYQHFDEVWAQYXXX 120
           EETDLLWNQLVFLRNVSPDPEIREASKNATSMLDDWIIGLTSKYDLYQHFDEVWAQY   
Sbjct: 61  EETDLLWNQLVFLRNVSPDPEIREASKNATSMLDDWIIGLTSKYDLYQHFDEVWAQYKDD 120

Query: 121 XXXXXXXXXLYRYMEKDADGYRRSGMKVPVENRKRLDEVKSKIAAAELEFSSNLGEEVEY 180
                    LYRYMEKDADGYRRSGMKVPVENRKRLDEVKSKIAAAELEFSSNLGEEVEY
Sbjct: 121 EKFKKENFELYRYMEKDADGYRRSGMKVPVENRKRLDEVKSKIAAAELEFSSNLGEEVEY 180

Query: 181 IAFTKEELEGVPDTVLNQFEKIIEGGVEKFKVTFKYPDIGPVLRLASNPETRRRASMADE 240
           IAFTKEELEGVPDTVLNQFEKIIEGGVEKFKVTFKYPDIGPVLRLASNPETRRRASMADE
Sbjct: 181 IAFTKEELEGVPDTVLNQFEKIIEGGVEKFKVTFKYPDIGPVLRLASNPETRRRASMADE 240

Query: 241 NRVAANXXXXXXXXXXXXXXADLLGFKNFAAYNLDDKMAKNEETVLKFLNDLVEKLLPVG 300
           NRVAAN              ADLLGFKNFAAYNLDDKMAKNEETVLKFLNDLVEKLLPVG
Sbjct: 241 NRVAANEPLLFETLELRRELADLLGFKNFAAYNLDDKMAKNEETVLKFLNDLVEKLLPVG 300

Query: 301 KNDLEILKKKKAEDYKSKNLTFDGEFYSWDTGYYTNKILRERYNVNPDDLAQYFPVESAI 360
           KNDLEILKKKKAEDYKSKNLTFDGEFYSWDTGYYTNKILRERYNVNPDDLAQYFPVESAI
Sbjct: 301 KNDLEILKKKKAEDYKSKNLTFDGEFYSWDTGYYTNKILRERYNVNPDDLAQYFPVESAI 360

Query: 361 EGMLNIYTTLFRLKFVEITDECEKSVWHEDVKQFAVWNIDDEDNPKFQGWLYFDLHPRDG 420
           EGMLNIYTTLFRLKFVEITDECEKSVWHEDVKQFAVWNIDDEDNPKFQGWLYFDLHPRDG
Sbjct: 361 EGMLNIYTTLFRLKFVEITDECEKSVWHEDVKQFAVWNIDDEDNPKFQGWLYFDLHPRDG 420

Query: 421 KYGHAANFGMVSAYRKRDGSKSYPVTILVTNFSKPTPTRPALLKLGELTTFFHELGHGIH 480
           KYGHAANFGMVSAYRKRDGSKSYPVTILVTNFSKPTPTRPALLKLGELTTFFHELGHGIH
Sbjct: 421 KYGHAANFGMVSAYRKRDGSKSYPVTILVTNFSKPTPTRPALLKLGELTTFFHELGHGIH 480

Query: 481 DLVGSNDLESLNGPGSVPWDFVEAPSQMLEYWTARRDVLTMLSKHYETGEKIPKSLLDAW 540
           DLVGSNDLESLNGPGSVPWDFVEAPSQMLEYWTARRDVLTMLSKHYETGEKIPKSLLDAW
Sbjct: 481 DLVGSNDLESLNGPGSVPWDFVEAPSQMLEYWTARRDVLTMLSKHYETGEKIPKSLLDAW 540

Query: 541 FSVGGLNSGLANLGQLKLGLFDMYVHTRDYKGAEVRKLWNDLTREIGLMNLKNYTSTGYD 600
           FSVGGLNSGLANLGQLKLGLFDMYVHTRDYKGAEVRKLWNDLTREIGLMNLKNYTSTGYD
Sbjct: 541 FSVGGLNSGLANLGQLKLGLFDMYVHTRDYKGAEVRKLWNDLTREIGLMNLKNYTSTGYD 600

Query: 601 SFGHIMXXXXXXXXXXLWSQVFAADMYDTKFKPNPFNATVGVEYRDTILATGGLYDMTDN 660
           SFGHIM          LWSQVFAADMYDTKFKPNPFNATVGVEYRDTILATGGLYDMTDN
Sbjct: 601 SFGHIMAGYAAGYYGYLWSQVFAADMYDTKFKPNPFNATVGVEYRDTILATGGLYDMTDN 660

Query: 661 LRKFLGRDPNNKAFLRGLGLKAR 683
           LRKFLGRDPNNKAFLRGLGLKAR
Sbjct: 661 LRKFLGRDPNNKAFLRGLGLKAR 683

>AGR405C Chr7 complement(1469769..1471922) [2154 bp, 717 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YCL057W
           (PRD1); Tandem gene duplication in this genome
          Length = 717

 Score =  950 bits (2455), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 454/679 (66%), Positives = 536/679 (78%), Gaps = 2/679 (0%)

Query: 6   SLVPPQAAPSWNFSAQDVISLSHQLINQTEAVYHNVLQEKPP-TIDNYIMPLIYHEEETD 64
           SLVPPQ  P WN++A +VI L++ L  +++AVY +V  +K   T+DNYI PL+Y+++ETD
Sbjct: 11  SLVPPQPPPVWNYTATEVIDLAYGLAQKSDAVYESVFSQKDEFTLDNYIWPLLYNDQETD 70

Query: 65  LLWNQLVFLRNVSPDPEIREASKNATSMLDDWIIGLTSKYDLYQHFDEVWAQYXXXXXXX 124
           LLWNQL+FLRNVSPDP++REAS +   +LD W+  ++SKYDLY +F+ +W QY       
Sbjct: 71  LLWNQLIFLRNVSPDPKVREASLSTGKILDQWVANISSKYDLYTNFEHIWTQYKDDEEFK 130

Query: 125 XXXXXLYRYMEKDADGYRRSGMKVPVENRKRLDEVKSKIAAAELEFSSNLGEEVEYIAFT 184
                LY+YMEKDA  Y R+   +       L +V  KI+   L+FS NLGEE EYI FT
Sbjct: 131 VTNYELYKYMEKDASYYNRNKRNLTNAESIELGQVTRKISVDTLQFSINLGEETEYITFT 190

Query: 185 KEELEGVPDTVLNQFEKIIEGGVEKFKVTFKYPDIGPVLRLASNPETRRRASMADENRVA 244
           +EELEGV   VL+QFE+IIEGGV+K KVTFKYPDIGPVLR A+NPETRR+A +AD+NRVA
Sbjct: 191 EEELEGVSPLVLDQFERIIEGGVKKLKVTFKYPDIGPVLRTATNPETRRKAYVADQNRVA 250

Query: 245 ANXXXXXXXXXXXXXXADLLGFKNFAAYNLDDKMAKNEETVLKFLNDLVEKLLPVGKNDL 304
           AN              A L G+KN+A YNL DKMAKNEETV+ FL DLVE+LLPVG+ D 
Sbjct: 251 ANEQLLFETLDLRRRMAQLRGYKNYAEYNLRDKMAKNEETVIPFLTDLVERLLPVGEKDR 310

Query: 305 EILKKKKAEDYKSKNLTFDGEFYSWDTGYYTNKILRERYNVNPDDLAQYFPVESAIEGML 364
           EILK KKAEDYKSKNLTFDGE Y+WD  YY NKIL+E+Y ++P+D+AQYFP+ES IEGML
Sbjct: 311 EILKSKKAEDYKSKNLTFDGEIYAWDNAYYNNKILQEKYQIDPEDMAQYFPIESVIEGML 370

Query: 365 NIYTTLFRLKFVEITDECEKSVWHEDVKQFAVWNIDDEDNPKFQGWLYFDLHPRDGKYGH 424
           + Y TLFRLKFVE+TD  +K+VWHEDVKQFAVWNIDDED P+FQGW+YFDL+PRDGKY H
Sbjct: 371 DTYQTLFRLKFVEVTDPSQKNVWHEDVKQFAVWNIDDEDCPEFQGWIYFDLYPRDGKYSH 430

Query: 425 AANFGMVSAYRKRDGSKSYPVTILVTNFSKPTPTRPALLKLGELTTFFHELGHGIHDLVG 484
           AANFGM SA+RK+DGS+SYPVT+LV N +KPTPTR A+L+ GE+TT FHELGHGIH LV 
Sbjct: 431 AANFGMASAFRKKDGSQSYPVTVLVCNLTKPTPTRTAILRPGEITTLFHELGHGIHHLVA 490

Query: 485 SNDLESLNGPGSVPWDFVEAPSQMLEYWTARRDVLTMLSKHYETGEKIPKSLLDAWFSVG 544
           +N L + N  GSVPWDFVEAPSQMLEYWT RRDVLTMLSKHYETGEKIP SLLDAWF+  
Sbjct: 491 NNKLAAHNSLGSVPWDFVEAPSQMLEYWTGRRDVLTMLSKHYETGEKIPPSLLDAWFNSS 550

Query: 545 GLNSGLANLGQLKLGLFDMYVHTRDYKGAEVRKLWNDLTREIGLMNLKNYTSTGYDSFGH 604
           GL SGL  LGQL+LGLFDMYVHTR+Y G EVRKLWND+ REI L+N +NYTSTGY++FGH
Sbjct: 551 GLGSGLYYLGQLRLGLFDMYVHTREYHGLEVRKLWNDMRREISLINSQNYTSTGYNTFGH 610

Query: 605 IMX-XXXXXXXXXLWSQVFAADMYDTKFKPNPFNATVGVEYRDTILATGGLYDMTDNLRK 663
           IM           LWSQVFAADMY TKFK NPFN+TVG +YRDTILA GGLYDM DNLRK
Sbjct: 611 IMTGSYSAGYYGYLWSQVFAADMYQTKFKSNPFNSTVGRQYRDTILAPGGLYDMNDNLRK 670

Query: 664 FLGRDPNNKAFLRGLGLKA 682
           FLGR+PNN+AFLRGLG  A
Sbjct: 671 FLGREPNNRAFLRGLGFNA 689

>Ecym_1011 Chr1 (19924..22074) [2151 bp, 716 aa] {ON} similar to
           Ashbya gossypii AGR406C/ AGR405C
          Length = 716

 Score =  731 bits (1888), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 354/680 (52%), Positives = 476/680 (70%), Gaps = 2/680 (0%)

Query: 2   KDLASLVPPQAAPSWNFSAQDVISLSHQLINQTEAVYHNVLQEKPPTIDNYIMPLIYHEE 61
           ++++SL+ P+ APSW+F+A +++SL+ + I++    Y +V   + P ++N+++ +I HE+
Sbjct: 38  RNMSSLLSPKLAPSWDFAADEIVSLAQKAIDEGTKFYDSVASLETPDLENFVVAVIDHED 97

Query: 62  ETDLLWNQLVFLRNVSPDPEIREASKNATSMLDDWIIGLTSKYDLYQHFDEVWAQYXXXX 121
           ETD   +QL FL++VS D E+R+AS  AT ++ +W I  +S+YDLY  F +VW QY    
Sbjct: 98  ETDGYMSQLTFLQHVSADKEVRDASIEATKLIQEWGIETSSRYDLYSQFSKVWEQYKDDE 157

Query: 122 XXXXXXXXLYRYMEKDADGYRRSGMKVPVENRKRLDEVKSKIAAAELEFSSNLGEEVEYI 181
                   LY YME     Y  +GM +P E+R ++ E+K K+A   L FS+NLGE+ +YI
Sbjct: 158 NLKKNDPELYWYMENVNKDYIHAGMGLPEESRNKIKEIKKKLANNSLAFSNNLGEQNDYI 217

Query: 182 AFTKEELEGVPDTVLNQFEKIIEGGVEKFKVTFKYPDIGPVLRLASNPETRRRASMADEN 241
           AFTK+EL GV +T L QFEK+IE GVEK+K+TFKYPDI PVL  A NPETR+RA + D+N
Sbjct: 218 AFTKDELVGVSETTLGQFEKVIEDGVEKYKMTFKYPDIHPVLNTAKNPETRKRAYIGDQN 277

Query: 242 RVAANXXXXXXXXXXXXXXADLLGFKNFAAYNLDDKMAKNEETVLKFLNDLVEKLLPVGK 301
           +V  N              A++ G   +A+Y L+ KMAK +ETV  FL DL +KLLP GK
Sbjct: 278 KVPQNEQILIETLKLRNELAEIHGHPTYASYQLEMKMAKKQETVFNFLYDLKDKLLPGGK 337

Query: 302 NDLEILKKKKAEDYKSKNLTFDGEFYSWDTGYYTNKILRERYNVNPDDLAQYFPVESAIE 361
            DLE LK  K ++YK   L ++G F SWD  YY +K L+E ++V+ ++LA+YFP++  I+
Sbjct: 338 KDLENLKSLKEQEYKELGLPYNGSFNSWDYRYYDDKYLKENFDVDEEELAKYFPLQHTID 397

Query: 362 GMLNIYTTLFRLKFVEITDECEKSVWHEDVKQFAVWNIDDEDNPKFQGWLYFDLHPRDGK 421
           GMLNIY  LF LKFVE T EC K+VWHEDVKQFAVW++ D+ NP+F GW+YFDLHPR+GK
Sbjct: 398 GMLNIYQKLFNLKFVEETRECGKNVWHEDVKQFAVWDL-DKCNPEFVGWIYFDLHPREGK 456

Query: 422 YGHAANFGMVSAYRKRDGSKSYPVTILVTNFSKPTPTRPALLKLGELTTFFHELGHGIHD 481
           YGHAANFG+ S Y   +G++ YPVT+LV NFSKP+ TRPALLK GE+ TFFHELGHGIH 
Sbjct: 457 YGHAANFGLYSPYVTEEGTRHYPVTVLVCNFSKPSSTRPALLKHGEVVTFFHELGHGIHA 516

Query: 482 LVGSNDLESLNGPGSVPWDFVEAPSQMLEYWTARRDVLTMLSKHYETGEKIPKSLLDAWF 541
           LVG + +  LNGP S+PWDFVEAPSQMLE+W   +D +  LSKHYETGE+IP  L+D+  
Sbjct: 517 LVGKSRIGHLNGPSSIPWDFVEAPSQMLEFWPWNKDQILKLSKHYETGEQIPDELVDSLI 576

Query: 542 SVGGLNSGLANLGQLKLGLFDMYVHT-RDYKGAEVRKLWNDLTREIGLMNLKNYTSTGYD 600
               +N+GL+NL QL   LFDM VHT ++    +++ LWN+L  E+ L++  +  + GYD
Sbjct: 577 KTKHVNAGLSNLRQLHFSLFDMTVHTDKELDKLDIKSLWNNLREEVTLISNGDVLTKGYD 636

Query: 601 SFGHIMXXXXXXXXXXLWSQVFAADMYDTKFKPNPFNATVGVEYRDTILATGGLYDMTDN 660
           SF HIM          +WS+VFAADMY T F PNP + +VG  YRD ILA GGL D+ D+
Sbjct: 637 SFSHIMSGYSAGYYGYMWSEVFAADMYHTMFAPNPLDTSVGTRYRDIILAKGGLRDIEDS 696

Query: 661 LRKFLGRDPNNKAFLRGLGL 680
           L +FLGR+PNNKAFL+ LGL
Sbjct: 697 LEEFLGREPNNKAFLKELGL 716

>SAKL0C00550g Chr3 (48410..50608) [2199 bp, 732 aa] {ON} highly
           similar to gnl|GLV|KLLA0C00572g Kluyveromyces lactis
           KLLA0C00572g and similar to YCL057W uniprot|P25375
           Saccharomyces cerevisiae YCL057W PRD1 Zinc
           metalloendopeptidase found in the cytoplasm and
           intermembrane space of mitochondria
          Length = 732

 Score =  714 bits (1843), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 349/679 (51%), Positives = 466/679 (68%), Gaps = 4/679 (0%)

Query: 5   ASLVPPQAAPSWNFSAQDVISLSHQLINQTEAVYHNVLQEKPPTIDNYIMPLIYHEEETD 64
           A+LVPPQAAPSW +S +D++ L+++ I  T A++  +   + PT+++ + P + HE  T 
Sbjct: 54  ATLVPPQAAPSWKYSPEDILQLTNETIASTSALHDALAGVENPTVESLVKPFLEHENTTQ 113

Query: 65  LLWNQLVFLRNVSPDPEIREASKNATSMLDDWIIGLTSKYDLYQHFDEVWAQYXXXXXXX 124
            L NQL FL++VS D E+R+AS  AT +L D+ I  + ++DL+  FD+VW          
Sbjct: 114 PLINQLTFLQHVSADKEVRDASTKATELLQDFEIEASLRHDLFVQFDKVWQACKDDAKFK 173

Query: 125 XXXXXLYRYMEKDADGYRRSGMKVPVENRKRLDEVKSKIAAAELEFSSNLGEEVEYIAFT 184
                LY+++EK    Y R+G+ +P E R  + E++ KI+   L+FS NLGE+ E++AFT
Sbjct: 174 KEHFELYKFVEKCHKDYVRAGLNLPEEKRNEVKELQKKISNNSLQFSKNLGEQKEFVAFT 233

Query: 185 KEELEGVPDTVLNQFEKIIEG-GVEKFKVTFKYPDIGPVLRLASNPETRRRASMADENRV 243
            EEL+GV  +V++QFEK  +  GVEK KV+FKYPDI PVL+ A NPETR+RA   D+N+V
Sbjct: 234 TEELDGVSASVMDQFEKFTDTDGVEKHKVSFKYPDILPVLKTAKNPETRKRAFGGDQNKV 293

Query: 244 AANXXXXXXXXXXXXXXADLLGFKNFAAYNLDDKMAKNEETVLKFLNDLVEKLLPVGKND 303
             N              A LLG+  +A YNLD KMAK +ETVL FL DL  KL P+G  +
Sbjct: 294 PQNEVLFLETLRLRDELAGLLGYSTYANYNLDIKMAKKQETVLAFLEDLKNKLKPLGVKE 353

Query: 304 LEILKKKKAEDYKSKNLTFDGEFYSWDTGYYTNKILRERYNVNPDDLAQYFPVESAIEGM 363
           +E LK  K +D K   + FD  +Y WD  YY NK L+E YNV+ + +++YFP+E  I GM
Sbjct: 354 IEALKSLKEKDCKELAIPFDNHYYIWDNRYYDNKYLKENYNVDEEKISEYFPLEPTIGGM 413

Query: 364 LNIYTTLFRLKFVEITDECEKSVWHEDVKQFAVWNIDDEDNPKFQGWLYFDLHPRDGKYG 423
           L IY T+ +LKFVE TD  +K VWHEDVKQ AVW +D  ++P+F GW+YFDLHPRDGKYG
Sbjct: 414 LKIYETVLKLKFVEETDAEKKQVWHEDVKQLAVWKVDKAESPEFVGWIYFDLHPRDGKYG 473

Query: 424 HAANFGMVSAYRKRDGSKSYPVTILVTNFSKPTPTRPALLKLGELTTFFHELGHGIHDLV 483
           HAANFG+ S+Y  RDG++S+PVT LV NFSKP+  +PALLK  E+TTFFHELGHGIHDLV
Sbjct: 474 HAANFGIASSYV-RDGARSHPVTALVCNFSKPSAKKPALLKHSEITTFFHELGHGIHDLV 532

Query: 484 GSNDLESLNGPGSVPWDFVEAPSQMLEYWTARRDVLTMLSKHYETGEKIPKSLLDAWFSV 543
           G N +   NGPG+ PWDFVEAPSQMLE+WT  ++ L+ LS+HYETGEKIP+ LLD+  + 
Sbjct: 533 GGNHIGRFNGPGATPWDFVEAPSQMLEFWTWNKNELSTLSQHYETGEKIPEQLLDSLIAT 592

Query: 544 GGLNSGLANLGQLKLGLFDMYVHT-RDYKGAEVRKLWNDLTREIGLMNLKNYTSTGYDSF 602
             +N  L  L QL  GLFDM VHT +D +  +V  LWNDL +E+ L+   +  + G++SF
Sbjct: 593 KHVNGALFALRQLTFGLFDMTVHTCKDLESLDVTSLWNDLRQEVSLVENGDQVTKGFNSF 652

Query: 603 GHIMX-XXXXXXXXXLWSQVFAADMYDTKFKPNPFNATVGVEYRDTILATGGLYDMTDNL 661
           GHIM           +W++VFAADMY TKF  +P N  VGV YRD +L+ GGLY++ DNL
Sbjct: 653 GHIMSGAYSAGYYGYMWAEVFAADMYHTKFAADPLNGDVGVRYRDIVLSRGGLYEIDDNL 712

Query: 662 RKFLGRDPNNKAFLRGLGL 680
           R+FLGR+PNN+AFL+ LGL
Sbjct: 713 REFLGREPNNEAFLKELGL 731

>ZYRO0F18392g Chr6 complement(1518902..1521079) [2178 bp, 725 aa]
           {ON} similar to uniprot|P25375 Saccharomyces cerevisiae
           YCL057W PRD1 Zinc metalloendopeptidase found in the
           cytoplasm and intermembrane space of mitochondria
          Length = 725

 Score =  687 bits (1772), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 334/678 (49%), Positives = 464/678 (68%), Gaps = 4/678 (0%)

Query: 7   LVPPQAAPSWNFSAQDVISLSHQLINQTEAVYHNVLQEKPPTIDNYIMPLIYHEEETDLL 66
            + PQ+APSW F+ Q ++  +H+LI  ++  Y ++ Q   PT++N + P ++HE    L+
Sbjct: 47  FIAPQSAPSWAFTPQSLLDETHRLIESSKQFYDSLAQLSNPTVENLVKPYMHHENGVGLI 106

Query: 67  WNQLVFLRNVSPDPEIREASKNATSMLDDWIIGLTSKYDLYQHFDEVWAQYXXXXXXX-X 125
            +QL F + VS D EIR+AS  AT  L ++ I  + ++DL+  FD++W +          
Sbjct: 107 ESQLTFPQQVSADKEIRDASVQATEFLQNFGIEQSLRHDLFLQFDKIWNELKDKSFEQGS 166

Query: 126 XXXXLYRYMEKDADGYRRSGMKVPVENRKRLDEVKSKIAAAELEFSSNLGEEVEYIAFTK 185
               +Y+Y+EK    Y R G+++P + R ++ ++K KIAA  LEFS NLGE+ E++AFTK
Sbjct: 167 QEYEIYKYVEKIHRDYTRDGLQLPEDKRDKVKQLKIKIAANSLEFSKNLGEQKEFVAFTK 226

Query: 186 EELEGVPDTVLNQFEKII-EGGVEKFKVTFKYPDIGPVLRLASNPETRRRASMADENRVA 244
           EEL+GV ++V++QFE+   E G  K+KVTFKYPDI PVL+ A NP+TR+ A   D+++V 
Sbjct: 227 EELDGVSESVMDQFEQFKDENGTTKYKVTFKYPDIFPVLKTAKNPKTRKLAFARDQDKVP 286

Query: 245 ANXXXXXXXXXXXXXXADLLGFKNFAAYNLDDKMAKNEETVLKFLNDLVEKLLPVGKNDL 304
            N              AD+LG+  +A YNL+ KMAKN++ V KFLN+L +KL P+G  + 
Sbjct: 287 QNEKLFVETLQLRNELADILGYSTYANYNLELKMAKNQDNVWKFLNELKDKLKPLGLKEA 346

Query: 305 EILKKKKAEDYKSKNLTFDGEFYSWDTGYYTNKILRERYNVNPDDLAQYFPVESAIEGML 364
           E LK+ K ++ +S  L +DG +Y WD  YY NK L++ YNV+ + +++Y+P+ES I GML
Sbjct: 347 ENLKQIKQKECESLGLPYDGHYYVWDHRYYDNKYLKDNYNVDLEKISEYYPIESTISGML 406

Query: 365 NIYTTLFRLKFVEITDECEKSVWHEDVKQFAVWNIDDEDNPKFQGWLYFDLHPRDGKYGH 424
           +IY TL +LKFVE TD  ++SVWHEDVKQ AVW +D+   P+F GW+YFDLHPRDGKYGH
Sbjct: 407 SIYETLLKLKFVEETDPEKRSVWHEDVKQLAVWKMDNPSKPEFVGWIYFDLHPRDGKYGH 466

Query: 425 AANFGMVSAYRKRDGSKSYPVTILVTNFSKPTPTRPALLKLGELTTFFHELGHGIHDLVG 484
           AANFG+ ++Y K DG++SYPVT LV NFSKP+  +P+LLK  E++TFFHELGHGIHDLVG
Sbjct: 467 AANFGISASYVKEDGTRSYPVTALVCNFSKPSAKKPSLLKHNEISTFFHELGHGIHDLVG 526

Query: 485 SNDLESLNGPGSVPWDFVEAPSQMLEYWTARRDVLTMLSKHYETGEKIPKSLLDAWFSVG 544
            N L + NGPG+VPWDFVEAPSQMLE+WT     L  LS HYE+GEKIPK LL +  S  
Sbjct: 527 ENRLTTFNGPGAVPWDFVEAPSQMLEFWTWNERELHELSSHYESGEKIPKDLLQSLISTK 586

Query: 545 GLNSGLANLGQLKLGLFDMYVHT-RDYKGAEVRKLWNDLTREIGLMNLKNYTSTGYDSFG 603
            ++  L  L QL  GLFDMYVHT ++    ++ KLWN+L  E+ L+   +  + GYDSFG
Sbjct: 587 HVDGALFALRQLHFGLFDMYVHTSKNVAKLDLLKLWNELREEVSLVENGDTFTKGYDSFG 646

Query: 604 HIMXXXXXX-XXXXLWSQVFAADMYDTKFKPNPFNATVGVEYRDTILATGGLYDMTDNLR 662
           HIM           +W++VFAADMY T+F  +P ++  GV+YRD +L  GGLY+  DNLR
Sbjct: 647 HIMSDSYSAGYYGYMWAEVFAADMYHTRFAADPLDSKAGVQYRDIVLGRGGLYETNDNLR 706

Query: 663 KFLGRDPNNKAFLRGLGL 680
           +FLGR+P+ +AFL+ LGL
Sbjct: 707 EFLGREPSEEAFLKELGL 724

>Kpol_2002.12 s2002 (21544..23763) [2220 bp, 739 aa] {ON}
           (21544..23763) [2220 nt, 740 aa]
          Length = 739

 Score =  678 bits (1749), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 337/688 (48%), Positives = 460/688 (66%), Gaps = 8/688 (1%)

Query: 1   MKDLASLVPPQAAPSWNFSAQDVISLSHQLINQTEAVYHNVLQEKPPTIDNYIMPLIYHE 60
           M + + L+ PQ AP+WN++ + ++  +  LI  +  ++ N+     PT++N+I+P + HE
Sbjct: 51  MTNSSLLIAPQPAPTWNWTPEGIVKDAESLIKDSNRIFDNLAAISSPTVENFIVPYMNHE 110

Query: 61  EETDLLWNQLVFLRNVSPDPEIREASKNATSMLDDWIIGLTSKYDLYQHFDEVWAQYXXX 120
            +   L NQL FL++VS D +IR++S  AT ++ ++ I  + + DL+  FD++W      
Sbjct: 111 NKVSPLINQLTFLQHVSADKDIRDSSMKATELIQNFEIEASLRKDLFIQFDKIWTDVKDN 170

Query: 121 X----XXXXXXXXLYRYMEKDADGYRRSGMKVPVENRKRLDEVKSKIAAAELEFSSNLGE 176
                         YR++EK    + RSG+ +  E R+ + +++ KIA+  L FS NLGE
Sbjct: 171 SEFNEKSDSKNYESYRFIEKCHKDFIRSGLNLSDEKREIVKDIQKKIASNSLNFSKNLGE 230

Query: 177 EVEYIAFTKEELEGVPDTVLNQFEKIIE--GGVEKFKVTFKYPDIGPVLRLASNPETRRR 234
           + E+IAFTKEEL+GV D V+ QFEK  +   G EKFKVTFKYPDI PVL+ A NP TR+ 
Sbjct: 231 QKEFIAFTKEELDGVSDAVMEQFEKFKDEKTGEEKFKVTFKYPDILPVLKSAKNPNTRKL 290

Query: 235 ASMADENRVAANXXXXXXXXXXXXXXADLLGFKNFAAYNLDDKMAKNEETVLKFLNDLVE 294
           A  AD+N+V  N              + +L + N+A YNL+ KMAKNEETV  FL+DL  
Sbjct: 291 AFNADQNKVPENEALFVDTLKLRNDLSTVLDYSNYANYNLEMKMAKNEETVFNFLDDLKT 350

Query: 295 KLLPVGKNDLEILKKKKAEDYKSKNLTFDGEFYSWDTGYYTNKILRERYNVNPDDLAQYF 354
           KL P+G  ++EILK+ K +D K  NL +D  +Y WD  YY NK L++ +NV+ + +++Y+
Sbjct: 351 KLRPLGLKEIEILKQLKEKDMKELNLPYDNHYYIWDHRYYDNKYLKDNFNVDLEKISEYY 410

Query: 355 PVESAIEGMLNIYTTLFRLKFVEITDECEKSVWHEDVKQFAVWNIDDEDNPKFQGWLYFD 414
           P+ES+I+GML IY T+ +LKFVE TD  +++VWHEDVKQ +VW +D+ D P+F GW+YFD
Sbjct: 411 PIESSIDGMLKIYETVMKLKFVEETDPAKRNVWHEDVKQLSVWKMDNPDAPEFIGWIYFD 470

Query: 415 LHPRDGKYGHAANFGMVSAYRKRDGSKSYPVTILVTNFSKPTPTRPALLKLGELTTFFHE 474
           LHPRDGKYGHAANFG+ S+Y   +  +SYPVT LV NFSKPT  +P+LLK  ELTTFFHE
Sbjct: 471 LHPRDGKYGHAANFGISSSYVDENDKRSYPVTALVCNFSKPTSDKPSLLKHNELTTFFHE 530

Query: 475 LGHGIHDLVGSNDLESLNGPGSVPWDFVEAPSQMLEYWTARRDVLTMLSKHYETGEKIPK 534
           LGHGIHDLVG+N    LNGPGSVPWDFVEAPSQMLE+WT  ++ L  LSKHY+TGEKIP+
Sbjct: 531 LGHGIHDLVGANRCSRLNGPGSVPWDFVEAPSQMLEFWTWNKNELISLSKHYKTGEKIPE 590

Query: 535 SLLDAWFSVGGLNSGLANLGQLKLGLFDMYVHT-RDYKGAEVRKLWNDLTREIGLMNLKN 593
           SL+++  S   +N  L  L QL    FDM VHT  D     + +LWN L  +I L+   +
Sbjct: 591 SLIESLVSTKHVNGALFALRQLHFSTFDMEVHTAEDVSKLNLLELWNGLREQICLVENGD 650

Query: 594 YTSTGYDSFGHIMX-XXXXXXXXXLWSQVFAADMYDTKFKPNPFNATVGVEYRDTILATG 652
             S GYDSFGHIM           +W++VFA DMY TKF  +P N+  GVEYRD IL+ G
Sbjct: 651 EMSKGYDSFGHIMSGAYSAGYYGYMWAEVFATDMYYTKFAADPLNSKSGVEYRDIILSRG 710

Query: 653 GLYDMTDNLRKFLGRDPNNKAFLRGLGL 680
           G+Y++ DNL +FLGR+PNN AFL+ +GL
Sbjct: 711 GIYEVNDNLEEFLGREPNNSAFLKEMGL 738

>KNAG0C00260 Chr3 (39428..41662) [2235 bp, 744 aa] {ON} Anc_1.9
           YCL057W
          Length = 744

 Score =  672 bits (1735), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 331/684 (48%), Positives = 458/684 (66%), Gaps = 8/684 (1%)

Query: 7   LVPPQAA-PSWNFSAQDVISLSHQLINQTEAVYHNVLQEKPPTIDNYIMPLIYHEEETDL 65
           LVPP  A P W F +  +   + ++I  T   Y  +++   P+IDN + P + HE    L
Sbjct: 61  LVPPAGALPRWEFPSAKIGEEATRIIESTNKFYDELVEISNPSIDNLVKPYMNHENSIGL 120

Query: 66  LWNQLVFLRNVSPDPEIREASKNATSMLDDWIIGLTSKYDLYQHFDEVWAQYX---XXXX 122
           + NQL FL++VS D EIREAS  AT +L ++ I  + ++DL+  FD++W +         
Sbjct: 121 MVNQLCFLQHVSSDKEIREASNKATELLQNFEIETSLRHDLFLQFDKIWKELKPRKEEFS 180

Query: 123 XXXXXXXLYRYMEKDADGYRRSGMKVPVENRKRLDEVKSKIAAAELEFSSNLGEEVEYIA 182
                  +Y+++EK    + R+G+ +  E+R ++ ++K KIA+  LEFS NLGE+ E++ 
Sbjct: 181 HDEEQFEIYKFVEKCHKDFVRAGLNLSEEDRNKVKDIKIKIASNSLEFSKNLGEQKEFLL 240

Query: 183 FTKEELEGVPDTVLNQFEKIIEGGVEK--FKVTFKYPDIGPVLRLASNPETRRRASMADE 240
           F+KE+L+GV DTV+ QFE++ +    +  +KVTFKYPDI PVL++A N ETR+ A   D+
Sbjct: 241 FSKEQLDGVSDTVMEQFEQVKDETTNETNYKVTFKYPDIFPVLKMAKNAETRKTAFCGDQ 300

Query: 241 NRVAANXXXXXXXXXXXXXXADLLGFKNFAAYNLDDKMAKNEETVLKFLNDLVEKLLPVG 300
           N+V  N              A LLG+  +A YNL+ KMAK + TV KFLNDL +KL P+G
Sbjct: 301 NKVPQNEELFVATLKLRDELATLLGYDTYANYNLEIKMAKKQSTVFKFLNDLKDKLKPLG 360

Query: 301 KNDLEILKKKKAEDYKSKNLTFDGEFYSWDTGYYTNKILRERYNVNPDDLAQYFPVESAI 360
           + ++ ILK  K  + K   + FDG +Y WD  YY  K L++ +NV+ + +A+Y+P++S I
Sbjct: 361 EKEIGILKSIKEAECKELGVPFDGRYYIWDHRYYDTKYLKDNFNVDHEAIAEYYPIDSTI 420

Query: 361 EGMLNIYTTLFRLKFVEITDECEKSVWHEDVKQFAVWNIDDEDNPKFQGWLYFDLHPRDG 420
           EGML IY T+F+LKFVE  D  +K+VW+EDVKQ AVW +D+   P F GW+YFDLHPRDG
Sbjct: 421 EGMLKIYETVFKLKFVEEKDTAKKNVWNEDVKQIAVWKMDNVKTPVFVGWIYFDLHPRDG 480

Query: 421 KYGHAANFGMVSAYRKRDGSKSYPVTILVTNFSKPTPTRPALLKLGELTTFFHELGHGIH 480
           KYGHAANFG+ S+Y + DGS+SYPVT LV NFSK + T+P+LLK  E+TTFFHELGHGIH
Sbjct: 481 KYGHAANFGIASSYIREDGSRSYPVTALVCNFSKSSATKPSLLKHNEITTFFHELGHGIH 540

Query: 481 DLVGSNDLESLNGPGSVPWDFVEAPSQMLEYWTARRDVLTMLSKHYETGEKIPKSLLDAW 540
           DLVG N     NGPG+ PWDFVEAPSQMLE++T  ++ L  LSKHY+TGE+IP+ LLD+ 
Sbjct: 541 DLVGKNRAARFNGPGATPWDFVEAPSQMLEFYTWDKNALQSLSKHYKTGEQIPEKLLDSL 600

Query: 541 FSVGGLNSGLANLGQLKLGLFDMYVHT-RDYKGAEVRKLWNDLTREIGLMNLKNYTSTGY 599
            +   +N  L  L QL  GLFDM VHT +D    ++ KLW DL +EI L+      + GY
Sbjct: 601 IATKHVNGALFALRQLHFGLFDMTVHTSKDVASLDLLKLWGDLRQEISLVENGGQYTKGY 660

Query: 600 DSFGHIMXXXXXX-XXXXLWSQVFAADMYDTKFKPNPFNATVGVEYRDTILATGGLYDMT 658
           DSFGHIM           +W++VFA DMY TKF PNP +++VG++YRD +LA GGLY++ 
Sbjct: 661 DSFGHIMSDSYSAGYYGYMWAEVFATDMYRTKFAPNPLDSSVGMKYRDIVLANGGLYEID 720

Query: 659 DNLRKFLGRDPNNKAFLRGLGLKA 682
           DNL++FLGR+P+  AFL+ LGL+A
Sbjct: 721 DNLKEFLGREPSKDAFLKELGLQA 744

>KLLA0C00572g Chr3 (42069..44207) [2139 bp, 712 aa] {ON} similar to
           uniprot|P25375 Saccharomyces cerevisiae YCL057W PRD1
           Zinc metalloendopeptidase found in the cytoplasm and
           intermembrane space of mitochondria
          Length = 712

 Score =  671 bits (1730), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 331/676 (48%), Positives = 450/676 (66%), Gaps = 6/676 (0%)

Query: 7   LVPPQAAPSWNFSAQDVISLSHQLINQTEAVYHNVLQEKPPTIDNYIMPLIYHEEETDLL 66
            V PQAAPSWN++ ++++  +H+ I+ +  +  ++     P+++N++ P ++HE     L
Sbjct: 41  FVVPQAAPSWNYTTEELLKQTHEAIDSSNELLDSLESISNPSVENFVTPYLHHENTISPL 100

Query: 67  WNQLVFLRNVSPDPEIREASKNATSMLDDWIIGLTSKYDLYQHFDEVWAQYXXXXXXXXX 126
           +NQL FL++VS D E+R+ S   T +++++ I  + ++ L++ FD VW Q          
Sbjct: 101 FNQLTFLQHVSSDKELRDTSTKVTELIENFGIESSLRFKLFRQFDIVWNQLKDDAQFKKD 160

Query: 127 XXXLYRYMEKDADGYRRSGMKVPVENRKRLDEVKSKIAAAELEFSSNLGEEVEYIAFTKE 186
              +Y+++EK    + RSG+ +P E R ++ E+K KI+   L+FS NLGE+ E+I FTKE
Sbjct: 161 HFEIYKFVEKCHKDFLRSGLNLPEEQRDKVKEIKKKISNNSLQFSKNLGEQNEFITFTKE 220

Query: 187 ELEGVPDTVLNQFEKIIEGGVEKFKVTFKYPDIGPVLRLASNPETRRRASMADENRVAAN 246
           EL GV + V+ QFE + E G+ K+KVTFKYPDI PVL+ A N ETR+RA + D+N+V  N
Sbjct: 221 ELIGVSENVMKQFETVDEDGITKYKVTFKYPDIFPVLKSAKNAETRKRAFIGDQNKVPQN 280

Query: 247 XXXXXXXXXXXXXXADLLGFKNFAAYNLDDKMAKNEETVLKFLNDLVEKLLPVGKNDLEI 306
                         A+LL + ++A YNLD KMAK EE VL FLNDL  KL P+G+ +L  
Sbjct: 281 EALFLETLQLRNDLAELLNYDSYADYNLDIKMAKKEEAVLTFLNDLKNKLKPLGEKELTK 340

Query: 307 LKKKKAEDYKSKNLTFDGEFYSWDTGYYTNKILRERYNVNPDDLAQYFPVESAIEGMLNI 366
           LK  K E+ K  N  +D  +Y WD  YY N+ L++ + ++ + +A+YFP+ES I+GML I
Sbjct: 341 LKNLKEEECKELNTPYDRRYYIWDNRYYDNQYLKKNFQIDEEKIAEYFPLESTIKGMLQI 400

Query: 367 YTTLFRLKFVEITDECEKSVWHEDVKQFAVWNIDDEDNPKFQGWLYFDLHPRDGKYGHAA 426
           Y T+ +LKF+E   E     WH DVK+ +VW +DD + P F GW+YFDLHPR+GKYGHAA
Sbjct: 401 YETVLKLKFIE---EDNGDTWHPDVKKLSVWKMDD-NFPSFVGWIYFDLHPREGKYGHAA 456

Query: 427 NFGMVSAYRKRDGSKSYPVTILVTNFSKPTPTRPALLKLGELTTFFHELGHGIHDLVGSN 486
           NFG+ S++ K DGS+SYPVT LV NFSKPT  +PALLK  ELTTFFHELGHGIHDLVG N
Sbjct: 457 NFGISSSFLKSDGSRSYPVTALVCNFSKPTKDKPALLKHSELTTFFHELGHGIHDLVGGN 516

Query: 487 DLESLNGPGSVPWDFVEAPSQMLEYWTARRDVLTMLSKHYETGEKIPKSLLDAWFSVGGL 546
           D+   NGP + PWDFVEAPSQMLE+WT  +  L  LSKHY+T EKIP SLLD+      +
Sbjct: 517 DIGRFNGPSATPWDFVEAPSQMLEFWTWNKKELKSLSKHYQTEEKIPDSLLDSLVRTKHI 576

Query: 547 NSGLANLGQLKLGLFDMYVH-TRDYKGAEVRKLWNDLTREIGLMNLKNYTSTGYDSFGHI 605
           N  L  L QL  GLFDM VH T+D     V +LWN L  EI L++  +  + G++SFGHI
Sbjct: 577 NGALFALRQLHFGLFDMKVHTTKDISKLNVTELWNSLREEICLIDNGDIQTKGFNSFGHI 636

Query: 606 MXXXXXX-XXXXLWSQVFAADMYDTKFKPNPFNATVGVEYRDTILATGGLYDMTDNLRKF 664
           M           +W+ VFA+DMY TKF  +P N+ VGV+YRD ILA GGLY++ DNL +F
Sbjct: 637 MSDSYSAGYYGYMWADVFASDMYYTKFLEDPLNSDVGVQYRDIILARGGLYEIEDNLTEF 696

Query: 665 LGRDPNNKAFLRGLGL 680
           LGR PNNKAFL+ LGL
Sbjct: 697 LGRKPNNKAFLKELGL 712

>NCAS0B09070 Chr2 complement(1741718..1743910) [2193 bp, 730 aa]
           {ON} Anc_1.9
          Length = 730

 Score =  669 bits (1726), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 324/678 (47%), Positives = 457/678 (67%), Gaps = 4/678 (0%)

Query: 7   LVPPQAAPSWNFSAQDVISLSHQLINQTEAVYHNVLQEKPPTIDNYIMPLIYHEEETDLL 66
           + P   AP+W +S + +++ + ++I+    +Y ++   + P++++ + P +++E +  L+
Sbjct: 51  VAPTGTAPTWKWSPESILAKTKEVIDNATNLYDSLAAIEEPSVESLVKPYMHYENDEGLI 110

Query: 67  WNQLVFLRNVSPDPEIREASKNATSMLDDWIIGLTSKYDLYQHFDEVWAQYXXXXXXXXX 126
            NQL FL++VS D  IR+AS  AT +L D+ I  + + DL+Q FD++W Q          
Sbjct: 111 VNQLTFLQHVSADKLIRDASVEATELLQDFSIEASMRLDLFQQFDKIWNQVKDDDDLKSK 170

Query: 127 XXXLYRYMEKDADGYRRSGMKVPVENRKRLDEVKSKIAAAELEFSSNLGEEVEYIAFTKE 186
               Y+++EK    Y R+G+ +P E R ++ ++K KIA+  L +S NLGE+ EY++FTKE
Sbjct: 171 DFETYKFIEKVHKDYVRNGLNLPEEKRNQVKDIKKKIASNSLNYSKNLGEQKEYVSFTKE 230

Query: 187 ELEGVPDTVLNQFEKIIEGGV--EKFKVTFKYPDIGPVLRLASNPETRRRASMADENRVA 244
           +L+GV ++V+ QFEK ++     EK+KVTFKYPDI PVL+ A  P+TR+ A ++D+N+V 
Sbjct: 231 QLKGVSESVMEQFEKFVDPKTNEEKYKVTFKYPDIFPVLKTAQVPKTRKLAYISDQNKVP 290

Query: 245 ANXXXXXXXXXXXXXXADLLGFKNFAAYNLDDKMAKNEETVLKFLNDLVEKLLPVGKNDL 304
            N              A LLG+  +A YNLD KMAKN+ETV  F+N+L +KL P+G+ ++
Sbjct: 291 QNEALFVETLKLRNQLAQLLGYSTYANYNLDIKMAKNQETVFDFVNNLKDKLKPLGQKEI 350

Query: 305 EILKKKKAEDYKSKNLTFDGEFYSWDTGYYTNKILRERYNVNPDDLAQYFPVESAIEGML 364
           E LK  K +D +   L +D  +Y WD  YY NK L++ YNV+ + +++Y+P+ES I+GML
Sbjct: 351 ETLKTLKKKDCEELGLAYDDHYYIWDHRYYDNKFLKDNYNVDLEQISEYYPLESTIKGML 410

Query: 365 NIYTTLFRLKFVEITDECEKSVWHEDVKQFAVWNIDDEDNPKFQGWLYFDLHPRDGKYGH 424
            IY TL +LKFV+ T+   K VWHEDVKQ AVW +DDE NP+F GW+YFDLHPRDGKY H
Sbjct: 411 GIYETLLKLKFVDETNPKIKDVWHEDVKQLAVWKMDDEKNPEFIGWIYFDLHPRDGKYSH 470

Query: 425 AANFGMVSAYRKRDGSKSYPVTILVTNFSKPTPTRPALLKLGELTTFFHELGHGIHDLVG 484
           AANFG+ S+Y  +DG +S+PVT LV NFSK T  +P+LLK  E+TTFFHELGHGIHDLVG
Sbjct: 471 AANFGISSSYITQDGDRSFPVTALVCNFSKSTDKKPSLLKHNEITTFFHELGHGIHDLVG 530

Query: 485 SNDLESLNGPGSVPWDFVEAPSQMLEYWTARRDVLTMLSKHYETGEKIPKSLLDAWFSVG 544
            N     NGPG+ PWDFVEAPSQMLE+WT  ++ L  LS HY+TGEKI + LLD+  +  
Sbjct: 531 KNKCARFNGPGATPWDFVEAPSQMLEFWTWNKNELLSLSGHYQTGEKISEDLLDSLIATK 590

Query: 545 GLNSGLANLGQLKLGLFDMYVH-TRDYKGAEVRKLWNDLTREIGLMNLKNYTSTGYDSFG 603
            +N  L  L QL  GLFDM VH T++ +   + KLWN+L  +I L+   N  + GYDSFG
Sbjct: 591 HVNGALFALRQLHFGLFDMTVHTTKNVEDLNLLKLWNELREKICLVENGNELTKGYDSFG 650

Query: 604 HIMXXXXXX-XXXXLWSQVFAADMYDTKFKPNPFNATVGVEYRDTILATGGLYDMTDNLR 662
           HIM           +W++VFAADMY TKF  +P N+  GV+YRD +LA GGLY++ D L+
Sbjct: 651 HIMSDSYSAGYYGYMWAEVFAADMYYTKFASDPLNSQAGVQYRDIVLANGGLYEIADKLK 710

Query: 663 KFLGRDPNNKAFLRGLGL 680
           +FLGR+P N AFL+ LGL
Sbjct: 711 EFLGREPTNDAFLKELGL 728

>Suva_3.156 Chr3 (234520..236658) [2139 bp, 712 aa] {ON} YCL057W
           (REAL)
          Length = 712

 Score =  660 bits (1702), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 327/678 (48%), Positives = 449/678 (66%), Gaps = 9/678 (1%)

Query: 10  PQAAPSWNFSAQDVISLSHQLINQTEAVYHNVLQEKPPTIDNYIMPLIYHEEETDLLWNQ 69
           PQ  PSW+F+  D+   + ++I ++   Y ++ Q + P + N++ P +  E E   + NQ
Sbjct: 37  PQTPPSWSFTPNDISGRTKEIIEKSNKFYDSMSQVESPAVTNFVEPFMKFENELGPIINQ 96

Query: 70  LVFLRNVSPDPEIREASKNATSMLDDWIIGLTSKYDLYQHFDEVWAQYXXXXXXXXXXXX 129
           L FL++VS D EIR+AS +++  LD+  I L+ ++D++  F  VW               
Sbjct: 97  LTFLQHVSSDKEIRDASVDSSMKLDELNIDLSLRHDVFLQFARVWQD--AQSQADSIERE 154

Query: 130 LYRYMEKDADGYRRSGMKVPVENRKRLDEVKSKIAAAELEFSSNLGEEVEYIAFTKEELE 189
            +RY+EK    Y  SG+++   +R ++ E+K KI+   + FS NLGE+ E+I FTKE+LE
Sbjct: 155 TFRYIEKSYKDYIHSGLELDEPDRLKVKEIKKKISVNSINFSKNLGEQKEFITFTKEQLE 214

Query: 190 GVPDTVLNQFEKIIEGGVEK----FKVTFKYPDIGPVLRLASNPETRRRASMADENRVAA 245
           GVPD++L QFE  IE G +     +KVTFKYPDI PV++LAS+ +TR++A +AD+N+V+ 
Sbjct: 215 GVPDSILAQFE-TIESGKDSNETLYKVTFKYPDIFPVMKLASSSQTRKQAFLADQNKVSE 273

Query: 246 NXXXXXXXXXXXXXXADLLGFKNFAAYNLDDKMAKNEETVLKFLNDLVEKLLPVGKNDLE 305
           N              A LLG+  +A YNL DKMAK+  TV+ FLNDL +KL+P+G+ +L+
Sbjct: 274 NEAILLDTLKLRDEVASLLGYDTYANYNLYDKMAKDSTTVMDFLNDLKKKLIPLGEKELQ 333

Query: 306 ILKKKKAEDYKSKNLTFDGEFYSWDTGYYTNKILRERYNVNPDDLAQYFPVESAIEGMLN 365
           IL+  KA+D K +N   D  +Y WD  YY NK L E +NV+ + ++++FP+E+ I GML 
Sbjct: 334 ILQDMKAKDVKKRNQDEDPNYYIWDHRYYDNKYLLENFNVDLEKISEFFPLETTITGMLQ 393

Query: 366 IYTTLFRLKFVEITDECEKSVWHEDVKQFAVWNIDDEDNPKFQGWLYFDLHPRDGKYGHA 425
           IY TLF LKF+E  +  EKSVWHEDVKQ AVWN+DD  +P+F GW+YFDLHPRDGKYGHA
Sbjct: 394 IYETLFNLKFIETKNPQEKSVWHEDVKQLAVWNMDDPKSPRFIGWIYFDLHPRDGKYGHA 453

Query: 426 ANFGMVSAYRKRDGSKSYPVTILVTNFSKPTPTRPALLKLGELTTFFHELGHGIHDLVGS 485
           ANFG+ S++   D ++SYPVT LV NFSK T  +P+LLK  E+ TFFHELGHGIHDLVG 
Sbjct: 454 ANFGLSSSFMVNDTTRSYPVTALVCNFSKSTKDKPSLLKHNEIVTFFHELGHGIHDLVGQ 513

Query: 486 NDLESLNGPGSVPWDFVEAPSQMLEYWTARRDVLTMLSKHYETGEKIPKSLLDAWFSVGG 545
           N     NGPGSVPWDFVEAPSQMLE+WT  ++ L  LS HY+TGEKIP+ L+D+      
Sbjct: 514 NKESRFNGPGSVPWDFVEAPSQMLEFWTWNKNELMHLSSHYKTGEKIPEPLIDSLIKTKH 573

Query: 546 LNSGLANLGQLKLGLFDMYVHT-RDYKGAEVRKLWNDLTREIGLMNLKNYTSTGYDSFGH 604
           +N  L  L QL  GLFDM VH+ +D +   +   WN L ++I LM+     S GY SFGH
Sbjct: 574 VNGALFTLRQLHFGLFDMKVHSCKDLQNLSICDTWNQLRQDISLMSNGGTLSKGYASFGH 633

Query: 605 IMXXXXXX-XXXXLWSQVFAADMYDTKFKPNPFNATVGVEYRDTILATGGLYDMTDNLRK 663
           IM           LW++VFA DMY TKF  +P N   G++YRD +LA GGL D+ D+L++
Sbjct: 634 IMSDSYSAGYYGYLWAEVFATDMYHTKFAKDPLNTKNGIQYRDIVLARGGLRDINDSLKE 693

Query: 664 FLGRDPNNKAFLRGLGLK 681
           FLGR+P+  AFL+ LGL+
Sbjct: 694 FLGREPSKDAFLKELGLQ 711

>Smik_3.18 Chr3 (26213..28351) [2139 bp, 712 aa] {ON} YCL057W (REAL)
          Length = 712

 Score =  657 bits (1695), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 334/679 (49%), Positives = 448/679 (65%), Gaps = 7/679 (1%)

Query: 8   VPPQAAPSWNFSAQDVISLSHQLINQTEAVYHNVLQEKPPTIDNYIMPLIYHEEETDLLW 67
           + PQA P+W F+  D+   + ++I+++   Y ++   + PT+ N++ P +  E E   + 
Sbjct: 35  IAPQAPPNWTFTPNDINGKTKEIIDKSNNFYESMSNVETPTVTNFVEPFMKFENELGPII 94

Query: 68  NQLVFLRNVSPDPEIREASKNATSMLDDWIIGLTSKYDLYQHFDEVWAQYXXXXXXXXXX 127
           NQL FL++VS D EIR+AS N++  LD+  I L+ ++D+Y  F  VW             
Sbjct: 95  NQLTFLQHVSSDKEIRDASVNSSMKLDELNIDLSLRHDIYLQFARVWQD--AQSKSDSIE 152

Query: 128 XXLYRYMEKDADGYRRSGMKVPVENRKRLDEVKSKIAAAELEFSSNLGEEVEYIAFTKEE 187
              ++Y+EK    Y  SG+++   NR ++ ++K KI+   + FS NLGE+ EYI FTKE+
Sbjct: 153 RETFKYIEKSYKDYIHSGLELDESNRLKIKDIKKKISVNSINFSKNLGEQKEYITFTKEQ 212

Query: 188 LEGVPDTVLNQFEKIIEGGVEK---FKVTFKYPDIGPVLRLASNPETRRRASMADENRVA 244
           LEGVPD+VL QFE I          +KVTFKYPDI PV++LAS+ +TR+ A +AD+N+V 
Sbjct: 213 LEGVPDSVLAQFETIKSDKDRNETLYKVTFKYPDIFPVMKLASSAQTRKEAFLADQNKVP 272

Query: 245 ANXXXXXXXXXXXXXXADLLGFKNFAAYNLDDKMAKNEETVLKFLNDLVEKLLPVGKNDL 304
            N              A LLG+  +A YNL DKMAK+  TV+ FLNDL +KL+P+GK +L
Sbjct: 273 ENEAILLDTLELRDKLASLLGYDTYANYNLYDKMAKDSTTVMDFLNDLKDKLIPLGKKEL 332

Query: 305 EILKKKKAEDYKSKNLTFDGEFYSWDTGYYTNKILRERYNVNPDDLAQYFPVESAIEGML 364
           E+L++ K++D K  N   D  +Y WD  YY NK L E +NV+ + +++YFP+E+ I GML
Sbjct: 333 ELLQEMKSKDVKKLNQDEDPNYYIWDHRYYDNKYLLENFNVDLEKISEYFPLETTITGML 392

Query: 365 NIYTTLFRLKFVEITDECEKSVWHEDVKQFAVWNIDDEDNPKFQGWLYFDLHPRDGKYGH 424
            IY TLF LKF+EI D   KSVWH+DVKQ AVWN+DD  +PKF GW+YFDLHPRDGKYGH
Sbjct: 393 QIYETLFNLKFIEIKDGQSKSVWHDDVKQLAVWNMDDPKSPKFVGWIYFDLHPRDGKYGH 452

Query: 425 AANFGMVSAYRKRDGSKSYPVTILVTNFSKPTPTRPALLKLGELTTFFHELGHGIHDLVG 484
           AANFG+ S++   D  +SYPVT LV NFSK T  +P+LLK  E+ TFFHELGHGIHDLVG
Sbjct: 453 AANFGLSSSFMTNDSVRSYPVTALVCNFSKSTKDKPSLLKHNEIVTFFHELGHGIHDLVG 512

Query: 485 SNDLESLNGPGSVPWDFVEAPSQMLEYWTARRDVLTMLSKHYETGEKIPKSLLDAWFSVG 544
            N     NGPGSVPWDFVEAPSQMLE+WT  ++ L  LS HYETGEKIP+SL+D+     
Sbjct: 513 QNKESRFNGPGSVPWDFVEAPSQMLEFWTWNKNELIDLSSHYETGEKIPESLIDSLIKTK 572

Query: 545 GLNSGLANLGQLKLGLFDMYVHT-RDYKGAEVRKLWNDLTREIGLMNLKNYTSTGYDSFG 603
            +N  L  L QL  GLFDM VHT +D +   + + WN L ++I L++     S GYDSFG
Sbjct: 573 HVNGALFTLRQLHFGLFDMKVHTCKDLQNLSICETWNQLRQDISLISNGGTLSKGYDSFG 632

Query: 604 HIMXXXXXX-XXXXLWSQVFAADMYDTKFKPNPFNATVGVEYRDTILATGGLYDMTDNLR 662
           HIM           LW++VFA DMY TKF  +P N   G++YRD +LA GGL D+ D+L+
Sbjct: 633 HIMSDSYSAGYYGYLWAEVFATDMYHTKFAKDPLNTKNGIQYRDIVLARGGLNDIGDDLK 692

Query: 663 KFLGRDPNNKAFLRGLGLK 681
           KFLGR+P+  AFL+ LGL+
Sbjct: 693 KFLGREPSKDAFLKELGLQ 711

>YCL057W Chr3 (24768..26906) [2139 bp, 712 aa] {ON}  PRD1Zinc
           metalloendopeptidase, found in the cytoplasm and
           intermembrane space of mitochondria; with Cym1p,
           involved in degradation of mitochondrial proteins and of
           presequence peptides cleaved from imported proteins
          Length = 712

 Score =  656 bits (1693), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 330/679 (48%), Positives = 451/679 (66%), Gaps = 7/679 (1%)

Query: 8   VPPQAAPSWNFSAQDVISLSHQLINQTEAVYHNVLQEKPPTIDNYIMPLIYHEEETDLLW 67
           + PQA P+W+F+  D+   ++++IN +   Y ++ + + P++ N++ P +  E E   + 
Sbjct: 35  IAPQAPPNWSFTPSDISGKTNEIINNSNNFYDSMSKVESPSVSNFVEPFMKFENELGPII 94

Query: 68  NQLVFLRNVSPDPEIREASKNATSMLDDWIIGLTSKYDLYQHFDEVWAQYXXXXXXXXXX 127
           NQL FL++VS D EIR+AS N++  LD+  I L+ ++D++  F  VW             
Sbjct: 95  NQLTFLQHVSSDKEIRDASVNSSMKLDELNIDLSLRHDIFLQFARVWQDVQSKADSVERE 154

Query: 128 XXLYRYMEKDADGYRRSGMKVPVENRKRLDEVKSKIAAAELEFSSNLGEEVEYIAFTKEE 187
              ++Y+EK    Y  SG+++   NR ++ E+K KI+   + FS NLGE+ EYI FTKE+
Sbjct: 155 T--FKYVEKSYKDYIHSGLELDEGNRLKIKEIKKKISVNSINFSKNLGEQKEYITFTKEQ 212

Query: 188 LEGVPDTVLNQFEKII---EGGVEKFKVTFKYPDIGPVLRLASNPETRRRASMADENRVA 244
           LEGVPD++L QFE I    +     +KVTFKYPDI PV++LAS+ +TR++A +AD+N+V 
Sbjct: 213 LEGVPDSILTQFETIKSDKDSNETLYKVTFKYPDIFPVMKLASSAQTRKQAFLADQNKVP 272

Query: 245 ANXXXXXXXXXXXXXXADLLGFKNFAAYNLDDKMAKNEETVLKFLNDLVEKLLPVGKNDL 304
            N              A LLG+  +A YNL DKMA++  TV+ FLNDL +KL+P+G+ +L
Sbjct: 273 ENEAILLDTLKLRDELASLLGYDTYANYNLYDKMAEDSTTVMNFLNDLKDKLIPLGRKEL 332

Query: 305 EILKKKKAEDYKSKNLTFDGEFYSWDTGYYTNKILRERYNVNPDDLAQYFPVESAIEGML 364
           ++L+  KAED K  N   D  +Y WD  YY NK L E +NV+ + +++YFP+E+ I GML
Sbjct: 333 QVLQDMKAEDVKKLNQGADPNYYIWDHRYYDNKYLLENFNVDLEKISEYFPLEATITGML 392

Query: 365 NIYTTLFRLKFVEITDECEKSVWHEDVKQFAVWNIDDEDNPKFQGWLYFDLHPRDGKYGH 424
            IY TLF LKF+E  D   KSVWH+DVKQ AVWN+DD  +P F GW+YFDLHPRDGKYGH
Sbjct: 393 EIYETLFNLKFIETKDSQNKSVWHDDVKQIAVWNMDDPKSPNFVGWIYFDLHPRDGKYGH 452

Query: 425 AANFGMVSAYRKRDGSKSYPVTILVTNFSKPTPTRPALLKLGELTTFFHELGHGIHDLVG 484
           AANFG+ S++   D ++SYPVT LV NFSK T  +P+LLK  E+ TFFHELGHGIHDLVG
Sbjct: 453 AANFGLSSSFMIDDTTRSYPVTALVCNFSKSTKDKPSLLKHNEIVTFFHELGHGIHDLVG 512

Query: 485 SNDLESLNGPGSVPWDFVEAPSQMLEYWTARRDVLTMLSKHYETGEKIPKSLLDAWFSVG 544
            N     NGPGSVPWDFVEAPSQMLE+WT  ++ L  LS HY+TGEKIP+SL+++     
Sbjct: 513 QNKESRFNGPGSVPWDFVEAPSQMLEFWTWNKNELINLSSHYKTGEKIPESLINSLIKTK 572

Query: 545 GLNSGLANLGQLKLGLFDMYVHT-RDYKGAEVRKLWNDLTREIGLMNLKNYTSTGYDSFG 603
            +N  L  L QL  GLFDM VHT +D +   +   WN L ++I L++     S GYDSFG
Sbjct: 573 HVNGALFTLRQLHFGLFDMKVHTCKDLQNLSICDTWNQLRQDISLISNGGTLSKGYDSFG 632

Query: 604 HIMXXXXXX-XXXXLWSQVFAADMYDTKFKPNPFNATVGVEYRDTILATGGLYDMTDNLR 662
           HIM           LW++VFA DMY TKF  +P NA  G++YRD +LA GGLYD+ DNL+
Sbjct: 633 HIMSDSYSAGYYGYLWAEVFATDMYHTKFAKDPLNAKNGIQYRDIVLARGGLYDINDNLK 692

Query: 663 KFLGRDPNNKAFLRGLGLK 681
           +FLGR+P+  AFL+ LGL+
Sbjct: 693 EFLGREPSKDAFLKELGLQ 711

>NDAI0A00180 Chr1 (14692..16914) [2223 bp, 740 aa] {ON} Anc_1.9
          Length = 740

 Score =  655 bits (1690), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 336/680 (49%), Positives = 463/680 (68%), Gaps = 9/680 (1%)

Query: 7   LVPPQAAPSWNFSAQDVISLSHQLINQTEAVYHNVLQEKPPTIDNYIMPLIYHEEETDLL 66
           + P    P W ++ + ++  +   I +T   Y+++ + + P+I+N I+P + +E +  LL
Sbjct: 64  IAPANTVPDWTWTPKQILDETKSYIEKTNKYYNSISEIESPSIENLIIPYMNYENKMGLL 123

Query: 67  WNQLVFLRNVSPDPEIREASKNATSMLDDWIIGLTSKYDLYQHFDEVWAQYXXXXXXXXX 126
            NQL FL++VS D +IR+AS  AT +L+D  I  + ++++++ F++VW            
Sbjct: 124 INQLTFLQHVSADKKIRDASLEATRLLEDHDILTSLRWEIWEQFEKVWETVQNDDDFLKN 183

Query: 127 XX-XLYRYMEKDADGYRRSGMKVPVENRKRLDEVKSKIAAAELEFSSNLGEEVEYIAFTK 185
                Y+++EK      R+G+K   E   +L  +K KI+A  L FSSNLGE+ EY++FTK
Sbjct: 184 HQFETYKFIEKIHKDSLRNGLKS--ERNYQLKYIKGKISADALTFSSNLGEQNEYVSFTK 241

Query: 186 EELEGVPDTVLNQFEKIIEGGV--EKFKVTFKYPDIGPVLRLASNPETRRRASMADENRV 243
           EEL+GV +TV++QFEK I+     +K+KVTFKYPDI PVL+ A NP+TR+ A + D+N+V
Sbjct: 242 EELDGVSETVMDQFEKFIDPKTNEKKYKVTFKYPDIFPVLKTAKNPKTRKIAFLGDQNKV 301

Query: 244 AANXXXXXXXXXXXXXXADLLGFKNFAAYNLDDKMAKNEETVLKFLNDLVEKLLPVGKND 303
             N              A+ LG+  +A YNLD KMAKN+ETVLKFLNDL EKL P+ + +
Sbjct: 302 PENEKLLCNVLKLRKELANTLGYSTYANYNLDIKMAKNQETVLKFLNDLKEKLKPLAEKE 361

Query: 304 LEILKKKKAEDYKSKNLTFDGEFYSWDTGYYTNKILRERYNVNPDDLAQYFPVESAIEGM 363
           ++ILK  K ++ +   + +DG +Y WD  YY NK L++ +NV+ + +++Y+P+ES I+GM
Sbjct: 362 IKILKDLKKKECEELGIPYDGHYYIWDHRYYDNKYLKDNFNVDIEKISEYYPLESTIDGM 421

Query: 364 LNIYTTLFRLKFVEITDECEKSVWHEDVKQFAVWNIDDEDNPKFQGWLYFDLHPRDGKYG 423
           L IY T+  LKF+E TD   K+VWH DVKQ +VWN+DD  NP F GW+YFDL+PRDGKYG
Sbjct: 422 LKIYETVLNLKFIEETDPLAKNVWHPDVKQLSVWNMDDRANPAFVGWIYFDLYPRDGKYG 481

Query: 424 HAANFGMVSAYRKRDGSKSYPVTILVTNFSKPTPTRPALLKLGELTTFFHELGHGIHDLV 483
           HAANFG+ S+Y   +  +SYPVT LV NFSKPT  +PALLK  E+TTFFHELGHGIHDLV
Sbjct: 482 HAANFGIASSYITEENKRSYPVTALVCNFSKPTKNKPALLKHSEITTFFHELGHGIHDLV 541

Query: 484 GSNDLESLNGPGSVPWDFVEAPSQMLEYWTARRDVLTMLSKHYETGEKIPKSLLDAWFSV 543
           G N     NGPGSVPWDFVEAPSQMLE+WT  ++ L  LSKHY+TGEKIP+ LLD+  S 
Sbjct: 542 GQNKAARFNGPGSVPWDFVEAPSQMLEFWTWNKNELLSLSKHYKTGEKIPEDLLDSLIST 601

Query: 544 GGLNSGLANLGQLKLGLFDMYVH-TRDYKGAEVRKLWNDLTREIGLM-NLKNYTSTGYDS 601
             +N  L  L QL  GLFDM VH T+D +  ++ KLWN+   EI L+ N +N+T  GY+S
Sbjct: 602 KHVNGALFALRQLHFGLFDMTVHTTKDIENLDLLKLWNESREEICLVENGENFTK-GYNS 660

Query: 602 FGHIMXXXXXX-XXXXLWSQVFAADMYDTKFKPNPFNATVGVEYRDTILATGGLYDMTDN 660
           FGHI+           +W++VFAADMY TKF PNP + +VG++YRD ILA GGLY++ DN
Sbjct: 661 FGHIISDSYSAGYYGYMWAEVFAADMYHTKFAPNPLDVSVGIKYRDLILAKGGLYEINDN 720

Query: 661 LRKFLGRDPNNKAFLRGLGL 680
           L +FLGR+P+NK FL+ LGL
Sbjct: 721 LLEFLGREPSNKPFLKELGL 740

>KAFR0D00180 Chr4 (18900..21071) [2172 bp, 723 aa] {ON} Anc_1.9
           YCL057W
          Length = 723

 Score =  653 bits (1685), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 338/686 (49%), Positives = 450/686 (65%), Gaps = 9/686 (1%)

Query: 4   LASLVPPQAAPSWNFSAQDVISLSHQLINQTEAVYHNVLQEKPPTIDNYIMPLIYHEEET 63
           +++ + PQAAPSWN++   ++  +  +I+ +  +Y  +   K PT++N + P + HE + 
Sbjct: 39  ISAFIAPQAAPSWNWNPSRLLFDAECVIDNSNRLYDELSSLKKPTVENLVRPYMIHENKI 98

Query: 64  DLLWNQLVFLRNVSPDPEIREASKNATSMLDDWIIGLTSKYDLYQHFDEVWAQYXXXXXX 123
             L N+L FL++VS DP+IREAS  AT +L  + I  + ++DL+  FD++W +       
Sbjct: 99  SPLINKLCFLQHVSEDPKIREASLKATELLQKFEIEASLRHDLFLQFDKIWQEISEKKDD 158

Query: 124 XXXXXXL--YRYMEKDADGYRRSGMKVPVENRKRLDEVKSKIAAAELEFSSNLGEEVEYI 181
                    ++++EK    Y RSG+ +P + R+++ E+K KI    L++S NLGE+ E I
Sbjct: 159 FVKEYDFETWKFIEKVHKDYVRSGLNLPEDKREKIKEIKIKIGNNSLQYSKNLGEQKELI 218

Query: 182 AFTKEELEGVPDTVLNQFEKII--EGGVEKFKVTFKYPDIGPVLRLASNPETRRRASMAD 239
           AFT+EEL+GV D V  QFEK I  E G EKFKVTFKYPDI PVL+ A NPETRR+A +AD
Sbjct: 219 AFTREELDGVSDAVFEQFEKFIDEETGEEKFKVTFKYPDIFPVLKTAKNPETRRKAFLAD 278

Query: 240 ENRVAANXXXXXXXXXXXXXXADLLGFKNFAAYNLDDKMAKNEETVLKFLNDLVEKLLPV 299
           +N+V  N              A  L +  +A YNL++KMAK +ETVL FLNDL  +L P+
Sbjct: 279 QNKVPQNEDLFVETLKLRNELATTLNYSTYANYNLEEKMAKRQETVLDFLNDLKYRLKPL 338

Query: 300 GKNDLEILKKKKAEDYKSKNLTFDGEFYSWDTGYYTNKILRERYNVNPDDLAQYFPVESA 359
              ++ ILK  K ++ K  N  +D  +Y +D  YY NK L++ +NV+ + +++Y+P+E  
Sbjct: 339 AMKEISILKDIKQKECKELNREYDSHYYIYDHRYYDNKYLKDNFNVDLEAISEYYPLEHT 398

Query: 360 IEGMLNIYTTLFRLKFVEITDECEKSVWHEDVKQFAVWNIDDEDNPKFQGWLYFDLHPRD 419
           I GML IY  LF+LKF E T    KSVWHEDVKQ AVW +D+ + P+F GW+YFDLHPRD
Sbjct: 399 INGMLKIYEELFKLKFNEETK--NKSVWHEDVKQLAVWKMDNPEKPEFVGWIYFDLHPRD 456

Query: 420 GKYGHAANFGMVSAYRK-RDGSKSYPVTILVTNFSKPTPTRPALLKLGELTTFFHELGHG 478
           GKYGHAANFG+ S+Y     G +SYPVT LV NFSK T TRP+LLK  E+TTFFHELGHG
Sbjct: 457 GKYGHAANFGISSSYVDIETGKRSYPVTALVCNFSKSTATRPSLLKHNEITTFFHELGHG 516

Query: 479 IHDLVGSNDLESLNGPGSVPWDFVEAPSQMLEYWTARRDVLTMLSKHYETGEKIPKSLLD 538
           IHDLVG N L   NGPG+ PWDFVEAPSQMLE+WT   + L  LS HYE+ EKIP  LL 
Sbjct: 517 IHDLVGKNKLSRFNGPGATPWDFVEAPSQMLEFWTWNANELKSLSCHYESNEKIPDDLLT 576

Query: 539 AWFSVGGLNSGLANLGQLKLGLFDMYVH-TRDYKGAEVRKLWNDLTREIGLMNLKNYTST 597
           +      +N  L  L QL  GLFDM VH T + +   + KLWN+L  EI L+   +  S 
Sbjct: 577 SLIKTKHVNGALFALRQLHFGLFDMTVHTTNNVESLNLLKLWNELREEICLVETGHELSK 636

Query: 598 GYDSFGHIMXXXXXX-XXXXLWSQVFAADMYDTKFKPNPFNATVGVEYRDTILATGGLYD 656
           GYDSFGHIM           +W++VFAADMY TKF PNP ++ VGV+YRD +LA GGLY+
Sbjct: 637 GYDSFGHIMSDSYSAGYYGYMWAEVFAADMYHTKFSPNPLDSEVGVQYRDIVLANGGLYE 696

Query: 657 MTDNLRKFLGRDPNNKAFLRGLGLKA 682
           + DNLR FLGR+P+  AFL+ LGL A
Sbjct: 697 IADNLRDFLGREPSKNAFLKELGLDA 722

>CAGL0B00418g Chr2 (26584..28815) [2232 bp, 743 aa] {ON} similar to
           uniprot|P25375 Saccharomyces cerevisiae YCL057w PRD1
           proteinase yscD
          Length = 743

 Score =  653 bits (1685), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 336/684 (49%), Positives = 459/684 (67%), Gaps = 9/684 (1%)

Query: 3   DLASLVPPQAAPSWNFSAQDVISLSHQLINQTEAVYHNVLQEKPPTIDNYIMPLIYHEEE 62
           ++ SL PPQ  PSW F  +D++S + + I  T+  Y +++    PTI+N I+P I HE E
Sbjct: 62  NMPSLTPPQYPPSWEFKPEDILSQTKEFIANTKLFYDDLVAIDNPTIENLIVPYINHENE 121

Query: 63  TDLLWNQLVFLRNVSPDPEIREASKNATSMLDDWIIGLTSKYDLYQHFDEVWAQYXXXXX 122
            +LL NQL FL++VS D  IR+AS  AT +L D+ I   S+ DL++ FD +W Q      
Sbjct: 122 NELLINQLTFLQHVSEDKTIRDASMEATMLLQDFEIESGSRVDLFKQFDLIWNQ-IKDKK 180

Query: 123 XXXXXXXLYRYMEKDADGYRRSGMKVPVENRKRLDEVKSKIAAAELEFSSNLGEEVEYIA 182
                  ++R++EK    Y R+G+ +P +  +++ E+K KIA   L+FS NLGE+ EYI 
Sbjct: 181 DEFEDFEIWRFVEKCHKDYVRAGLNLPADKLEKVKEIKKKIADNCLKFSKNLGEQKEYIL 240

Query: 183 FTKEELEGVPDTVLNQFEKII-EGGVEKFKVTFKYPDIGPVLRLASNPETRRRASMADEN 241
           FT EEL+GVP++V+ QFEK+  E G++K KVT+KYPDI PVL+ A NPETR +A M D+N
Sbjct: 241 FTAEELKGVPESVIEQFEKVNDEFGIQKLKVTYKYPDIFPVLKNAQNPETRMKAFMGDQN 300

Query: 242 RVAANXXXXXXXXXXXXXXADLLGFKNFAAYNLDDKMAKNEETVLKFLNDLVEKLLPVGK 301
           +V  N              A +LG+  +A YNLD KMAKN +TVL F+NDL+ KL    K
Sbjct: 301 KVPENEHLFKDTLKLRNELALVLGYDTYANYNLDIKMAKNADTVLSFVNDLIVKLQDPAK 360

Query: 302 NDLEILKKKKAEDYKSK-NLTFDGEFYSWDTGYYTNKILRERYNVNPDDLAQYFPVESAI 360
            +L+ILK  K ++++++ N+ +DG++Y WD  YY NK L+E +NV+ + +A+Y+P+ES I
Sbjct: 361 KELDILKNLKKQEFENEFNMVYDGDYYIWDHRYYDNKYLKENFNVDEEKIAEYYPLESTI 420

Query: 361 EGMLNIYTTLFRLKFVEITDECEKSVWHEDVKQFAVWNIDDEDNPKFQGWLYFDLHPRDG 420
           +GML IY TL +LKFVE+ +   K  WH+DVKQ AVW +D  +NP+F GW++FDLHPRDG
Sbjct: 421 DGMLKIYETLLKLKFVEVKEN--KKTWHDDVKQLAVWKLDTPENPEFVGWIFFDLHPRDG 478

Query: 421 KYGHAANFGMVSAYRKRDGSKSYPVTILVTNFSKPTPTRPALLKLGELTTFFHELGHGIH 480
           KYGHAANFG+ S+Y   +G++SYP+T LV NFSK T  +P+LLK  E+TTFFHELGHGIH
Sbjct: 479 KYGHAANFGLSSSYISANGTRSYPITALVCNFSKSTKDKPSLLKHSEITTFFHELGHGIH 538

Query: 481 DLVGSNDLESLNGPGSVPWDFVEAPSQMLEYWTARRDVLTMLSKHYETGEKIPKSLLDAW 540
           DLVG+N +   NGPG+VPWDFVEAPSQMLE+WT     L  LS++Y+   KI   LL++ 
Sbjct: 539 DLVGNNRIGRFNGPGAVPWDFVEAPSQMLEFWTWNTKELLSLSQNYKDNAKIDTKLLESL 598

Query: 541 FSVGGLNSGLANLGQLKLGLFDMYVH---TRDYKGAEVRKLWNDLTREIGLMNLKNYTST 597
                +N  L  L QL  GLFDM VH     +    +++KLWNDL  +I L++  +  +T
Sbjct: 599 IKTKHVNGALFALRQLHFGLFDMKVHMMSAEELDKLDIKKLWNDLREKICLISNGDQPTT 658

Query: 598 GYDSFGHIMX-XXXXXXXXXLWSQVFAADMYDTKFKPNPFNATVGVEYRDTILATGGLYD 656
           GY+SFGHIM           +W++VFA DMY TKFK +P N  VGV+YRD +LA GGLY+
Sbjct: 659 GYNSFGHIMSGSYSAGYYGYMWAEVFATDMYYTKFKADPLNPEVGVKYRDIVLARGGLYE 718

Query: 657 MTDNLRKFLGRDPNNKAFLRGLGL 680
           + DNL +FLGR P   AFL  LGL
Sbjct: 719 IDDNLEEFLGRKPAKDAFLEELGL 742

>TBLA0A07560 Chr1 complement(1871629..1873854) [2226 bp, 741 aa]
           {ON} Anc_1.9 YCL057W
          Length = 741

 Score =  652 bits (1681), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 331/685 (48%), Positives = 460/685 (67%), Gaps = 8/685 (1%)

Query: 4   LASLVPPQAAPSWNFSAQDVISLSHQLINQTEAVYHNVLQEKPPTIDNYIMPLIYHEEET 63
             +L  PQAAP+WN++   ++  +  LI+Q+   Y  +   K P  +N+++P + +E + 
Sbjct: 56  CVNLNAPQAAPTWNWTPSQLVKDAEDLIDQSNHFYDALTNLKSPDFNNFLVPYMNYENKV 115

Query: 64  DLLWNQLVFLRNVSPDPEIREASKNATSMLDDWIIGLTSKYDLYQHFDEVWAQYXXXXXX 123
             L NQL FL++VS + +IR+AS  AT +L ++ I  + +Y L+  FD++W Q       
Sbjct: 116 GSLINQLTFLQHVSSEKDIRDASFKATDLLQNFEIETSLRYGLFLQFDKIWNQIKDSKDK 175

Query: 124 XXXX---XXLYRYMEKDADGYRRSGMKVPVENRKRLDEVKSKIAAAELEFSSNLGEEVEY 180
                     Y ++ K    + R+G+ +    R+++ E+K  IA   L+F++NLGE+ E+
Sbjct: 176 YEKDPKDLENYEFVRKVHRDFVRAGLNLDESKREKIKEIKKAIANNSLKFATNLGEQTEF 235

Query: 181 IAFTKEELEGVPDTVLNQFEKIIE--GGVEKFKVTFKYPDIGPVLRLASNPETRRRASMA 238
           +AFTKEEL+GV D+V+ QFEK  +   G E +KVTFKYPDI PVL+ A NPETR++A   
Sbjct: 236 VAFTKEELDGVSDSVMEQFEKFNDEKTGKEMYKVTFKYPDIFPVLKTARNPETRKKAFAG 295

Query: 239 DENRVAANXXXXXXXXXXXXXXADLLGFKNFAAYNLDDKMAKNEETVLKFLNDLVEKLLP 298
           D+N+V+ N              AD+LG+  +A YNL+ KMAK +++V KFL DL+++L P
Sbjct: 296 DQNKVSENTVLFTNTLKLRNQLADILGYSTYANYNLELKMAKAQDSVFKFLEDLIDRLKP 355

Query: 299 VGKNDLEILKKKKAEDYKSKNLTFDGEFYSWDTGYYTNKILRERYNVNPDDLAQYFPVES 358
           +G  ++EILK  K +++K  NL FD  +Y WD  YY NK L++ YNV+ + +++Y+P++S
Sbjct: 356 LGSKEIEILKSIKEKEFKELNLPFDNHYYVWDHRYYDNKYLKDNYNVDLEKISEYYPLDS 415

Query: 359 AIEGMLNIYTTLFRLKFVEITDECE-KSVWHEDVKQFAVWNIDDEDNPKFQGWLYFDLHP 417
            IEGMLNIY TL  LKF+E  D+ + K+VWH++VKQ AVW +D+ +NP+F GW+YFDLHP
Sbjct: 416 TIEGMLNIYETLLNLKFIEEKDDSKNKNVWHKEVKQLAVWKMDNPENPEFVGWIYFDLHP 475

Query: 418 RDGKYGHAANFGMVSAYRKRDGSKSYPVTILVTNFSKPTPTRPALLKLGELTTFFHELGH 477
           RDGKYGHAANFG+ S+Y K +  +SYPVT LV NFSK T  +PALLK  E+TTFFHELGH
Sbjct: 476 RDGKYGHAANFGISSSYIKPNNERSYPVTALVCNFSKVTADKPALLKHNEITTFFHELGH 535

Query: 478 GIHDLVGSNDLESLNGPGSVPWDFVEAPSQMLEYWTARRDVLTMLSKHYETGEKIPKSLL 537
           GIHDLVG N+    NGPG+VPWDFVEAPSQMLE+WT  ++ L  LSKHY+TGEKIP  LL
Sbjct: 536 GIHDLVGKNNNSRFNGPGAVPWDFVEAPSQMLEFWTWNKNELLSLSKHYKTGEKIPTELL 595

Query: 538 DAWFSVGGLNSGLANLGQLKLGLFDMYVHT-RDYKGAEVRKLWNDLTREIGLMNLKNYTS 596
           ++  +   +N  L  L QL  GLFDM VHT +D +  +  KLWN+L  E+ L+   +  +
Sbjct: 596 NSLVATKHVNGALFALRQLHFGLFDMKVHTSKDLENLDFLKLWNELREEVSLVENGDLFT 655

Query: 597 TGYDSFGHIMXXXXXX-XXXXLWSQVFAADMYDTKFKPNPFNATVGVEYRDTILATGGLY 655
            GYDSFGHIM           +W++VFA DMY TKF  NP    VGVEYRD +LA GGLY
Sbjct: 656 KGYDSFGHIMSDSYSAGYYGYMWAEVFATDMYYTKFAANPLETKVGVEYRDWVLARGGLY 715

Query: 656 DMTDNLRKFLGRDPNNKAFLRGLGL 680
           ++ DNL +FLGR P+N+AFL+ LGL
Sbjct: 716 EIEDNLIQFLGRKPSNEAFLKELGL 740

>TPHA0E03970 Chr5 complement(834023..836266) [2244 bp, 747 aa] {ON}
           Anc_1.9 YCL057W
          Length = 747

 Score =  651 bits (1679), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 324/691 (46%), Positives = 456/691 (65%), Gaps = 14/691 (2%)

Query: 5   ASLVPPQAAPSWNFSAQDVISLSHQLINQTEAVYHNVLQEKPPTIDNYIMPLIYHEEETD 64
           A+ + PQ +P W+FS + ++S + ++I+ +   Y+ ++  + P+I+N+++P I  E E  
Sbjct: 57  AAFIAPQLSPKWDFSPERILSDAKKIIDTSNDFYNAMVAIENPSIENFVIPSINFENENS 116

Query: 65  LLWNQLVFLRNVSPDPEIREASKNATSMLDDWIIGLTSKYDLYQHFDEVW------AQYX 118
           L  NQL FL++VS D  IR+AS  AT ++ ++ I ++ +YD+++ FD+++       +Y 
Sbjct: 117 LAINQLTFLQHVSKDKLIRDASLEATELITNFDIEISLRYDMFKQFDKIFNDLKDNKKYN 176

Query: 119 XXXXXXXXXXXLYRYMEKDADGYRRSGMKVPVENRKRLDEVKSKIAAAELEFSSNLGEEV 178
                      +++Y+EK    Y RSG+ +  E R  + E+K +IA   L+FS NLGE+ 
Sbjct: 177 DLKTATPKDYEIFKYVEKCHKDYVRSGLNLSEEKRNEIKEIKKRIALNSLQFSKNLGEQN 236

Query: 179 EYIAFTKEELEGVPDTVLNQFEKII--EGGVEKFKVTFKYPDIGPVLRLASNPETRRRAS 236
           E++AFTKEELEGV D V+ QFE     + G +KFKVTFKYPDI PVL+ A NP TR+ A 
Sbjct: 237 EFVAFTKEELEGVSDDVMKQFETYTDEQTGEQKFKVTFKYPDIFPVLKTAKNPNTRKIAF 296

Query: 237 MADENRVAANXXXXXXXXXXXXXXADLLGFKNFAAYNLDDKMAKNEETVLKFLNDLVEKL 296
            AD+N+V  N                +LG+  +A YNLD KMAKN+ETV++FL DL +KL
Sbjct: 297 NADQNKVPENEKLFIDTLKLRYQLGKILGYDTYANYNLDIKMAKNQETVMEFLVDLKDKL 356

Query: 297 LPVGKNDLEILKKKKAEDYKSKNLTFDGEFYSWDTGYYTNKILRERYNVNPDDLAQYFPV 356
            P+ + ++E+LK  K  + +  N+ +D  +Y WD  YY NK L++++NV+ + +++Y+PV
Sbjct: 357 KPLAEKEIEVLKAIKKTEAQELNMAYDDHYYIWDHRYYDNKYLKDKFNVDLEKISEYYPV 416

Query: 357 ESAIEGMLNIYTTLFRLKFVEITDECEKSVWH-EDVKQFAVWNIDDEDNPKFQGWLYFDL 415
           ES I+GML IY T+  LKF+E TD+  KS W  +DVKQ AVW +DD   P+F GW+YFDL
Sbjct: 417 ESTIQGMLKIYETVMNLKFIEETDKDLKSTWAGDDVKQLAVWKMDDPSKPEFVGWIYFDL 476

Query: 416 HPRDGKYGHAANFGMVSAYRKRDGSKSYPVTILVTNFSKPTPTRPALLKLGELTTFFHEL 475
           HPR+GKYGHAANFGM  +Y  +D  + YPVT LV NFS  T  +PALLK  E+TTFFHEL
Sbjct: 477 HPREGKYGHAANFGMAPSYIDKDSKRIYPVTALVCNFSAATADKPALLKHNEITTFFHEL 536

Query: 476 GHGIHDLVGSNDLESLNGPGSVPWDFVEAPSQMLEYWTARRDVLTMLSKHYETGEKIPKS 535
           GHGIHDLVG+N +   NGPG+VPWDFVEAPSQMLE+WT  ++ L  LSKHY+TGEKIP+S
Sbjct: 537 GHGIHDLVGNNGIGRFNGPGAVPWDFVEAPSQMLEFWTWNKNELLSLSKHYKTGEKIPES 596

Query: 536 LLDAWFSVGGLNSGLANLGQLKLGLFDMYVHT----RDYKGAEVRKLWNDLTREIGLMNL 591
           LL++  +   +N  L  L QL  GLFDM VHT          ++ +LWN L  EI L+  
Sbjct: 597 LLESLIATKHVNGALFALRQLHFGLFDMKVHTTTDDNQIDNMDLVQLWNGLREEISLVEN 656

Query: 592 KNYTSTGYDSFGHIMXXXXXX-XXXXLWSQVFAADMYDTKFKPNPFNATVGVEYRDTILA 650
            +  + GYDSFGHIM           +W++VFA DMY +KF  +P N   G+EYRD ILA
Sbjct: 657 GDEMNKGYDSFGHIMSDSYSAGYYGYMWAEVFATDMYYSKFAKDPLNTKSGIEYRDIILA 716

Query: 651 TGGLYDMTDNLRKFLGRDPNNKAFLRGLGLK 681
            GG+ +  DNL++FLGR+P+ +AFL+ LGL+
Sbjct: 717 RGGIRETNDNLKEFLGREPSKEAFLKELGLQ 747

>Skud_3.7 Chr3 (12763..14901) [2139 bp, 712 aa] {ON} YCL057W (REAL)
          Length = 712

 Score =  647 bits (1669), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 333/688 (48%), Positives = 453/688 (65%), Gaps = 8/688 (1%)

Query: 1   MKDLASL-VPPQAAPSWNFSAQDVISLSHQLINQTEAVYHNVLQEKPPTIDNYIMPLIYH 59
           M + AS  + PQA P+W+F+  D+   + ++I+++   Y  + Q + P++ N+I P +  
Sbjct: 27  MTNAASFPIAPQAPPTWSFTPTDIGGKTTEIIDKSNKFYELMSQVESPSVTNFIEPFMKF 86

Query: 60  EEETDLLWNQLVFLRNVSPDPEIREASKNATSMLDDWIIGLTSKYDLYQHFDEVWAQYXX 119
           E E   + N+L FL++VS D EIR+AS +++  LD+  I L+ ++D++  F  VW     
Sbjct: 87  ENELGPIINRLTFLQHVSSDKEIRDASVDSSMKLDELNIDLSLRHDIFLQFARVWQD--A 144

Query: 120 XXXXXXXXXXLYRYMEKDADGYRRSGMKVPVENRKRLDEVKSKIAAAELEFSSNLGEEVE 179
                      ++Y+EK    +  SG+++   NR ++ E+K KI+   + FS NLGE+ E
Sbjct: 145 QPKADSLKKETFKYIEKSYKDFIHSGLELDEANRLKIKEIKKKISMNSINFSKNLGEQKE 204

Query: 180 YIAFTKEELEGVPDTVLNQFE--KIIEGGVEK-FKVTFKYPDIGPVLRLASNPETRRRAS 236
           YI FTKE+LEGVPD++L QFE  K  +GG +  +KVTFKYPDI PV++LAS+ +TR++A 
Sbjct: 205 YITFTKEQLEGVPDSILAQFETTKSEKGGEDTLYKVTFKYPDIFPVMKLASSAQTRKQAF 264

Query: 237 MADENRVAANXXXXXXXXXXXXXXADLLGFKNFAAYNLDDKMAKNEETVLKFLNDLVEKL 296
           +AD+N+V  N              A LLG+  +A YNL DKMAK+  TV+ FLNDL  KL
Sbjct: 265 LADQNKVPENEAILLDTLKLRDELASLLGYNTYADYNLYDKMAKDSRTVMDFLNDLKGKL 324

Query: 297 LPVGKNDLEILKKKKAEDYKSKNLTFDGEFYSWDTGYYTNKILRERYNVNPDDLAQYFPV 356
           +P+GK +L++L+  K +D +      D  +Y WD  YY NK L E +NV+ + +++YFP+
Sbjct: 325 IPLGKKELQVLQDMKVKDVERSKKDEDPNYYIWDHRYYDNKHLLENFNVDLEKISEYFPL 384

Query: 357 ESAIEGMLNIYTTLFRLKFVEITDECEKSVWHEDVKQFAVWNIDDEDNPKFQGWLYFDLH 416
           E+ I GML IY TLF LKF+E  +   KSVWHEDVKQ AVWN+DD  +P+F GW+YFDLH
Sbjct: 385 ETTITGMLQIYETLFNLKFIETKEPQNKSVWHEDVKQLAVWNMDDPKSPRFIGWIYFDLH 444

Query: 417 PRDGKYGHAANFGMVSAYRKRDGSKSYPVTILVTNFSKPTPTRPALLKLGELTTFFHELG 476
           PRDGKYGHAANFG+ S++   D  +SYPVT LV NFSK T  +P+LLK  E+ TFFHELG
Sbjct: 445 PRDGKYGHAANFGLSSSFMINDSKRSYPVTALVCNFSKSTKDKPSLLKHNEIVTFFHELG 504

Query: 477 HGIHDLVGSNDLESLNGPGSVPWDFVEAPSQMLEYWTARRDVLTMLSKHYETGEKIPKSL 536
           HGIHDLVG N     NGPGSVPWDFVEAPSQMLE+WT  ++ L  LS HY+TGE+IP+SL
Sbjct: 505 HGIHDLVGQNKESRFNGPGSVPWDFVEAPSQMLEFWTWNKNELVSLSSHYKTGERIPESL 564

Query: 537 LDAWFSVGGLNSGLANLGQLKLGLFDMYVHT-RDYKGAEVRKLWNDLTREIGLMNLKNYT 595
           +D+      +N  L  L QL  GLFDM VHT +D +   +   WN L +EI LM      
Sbjct: 565 IDSLIKTKHVNGALFTLRQLHFGLFDMKVHTCKDLENLSICHTWNQLRQEISLMPNGGTL 624

Query: 596 STGYDSFGHIMXXXXXX-XXXXLWSQVFAADMYDTKFKPNPFNATVGVEYRDTILATGGL 654
           S GYDSFGHIM           LW++VFA DMY TKF  +P N   GV+YRD +LA GGL
Sbjct: 625 SKGYDSFGHIMSDSYSAGYYGYLWAEVFATDMYHTKFAKDPLNTKNGVQYRDIVLARGGL 684

Query: 655 YDMTDNLRKFLGRDPNNKAFLRGLGLKA 682
           YD+ DNL++FLGR+P+  AFL+ LGL++
Sbjct: 685 YDINDNLKEFLGREPSKDAFLKELGLQS 712

>ABR185W Chr2
           (758126..758380,758380..758709,758709..759029,
           759033..759122,759122..759499) [1374 bp, 457 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YCL057W
           (PRD1); 3-intron; artificial frameshift
          Length = 457

 Score =  379 bits (974), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 205/414 (49%), Positives = 267/414 (64%), Gaps = 9/414 (2%)

Query: 270 AAYNLDDKMAKNEETVLKFLNDLVEKLLPVGKNDLEILKKKKAEDYKSKNLTFDGEFYSW 329
           AAY L+ K AKN + V  FLNDL EKL P   ++   LKK K ++ K     +DGE YS 
Sbjct: 49  AAYVLEVKTAKNVDNVNSFLNDLREKLKPASADNWRPLKKLKEQECKELGNFYDGELYSQ 108

Query: 330 DTGYYTNKILRERYNVNPDDLAQYFPVESAIEGMLNIYTTLFRLKFVEITDECEKSVWHE 389
           D  YY  K+LR+ ++V+ ++ AQYFP+E  I+ ML+ Y TLFR  FVE T+   ++VWHE
Sbjct: 109 DLCYYEQKLLRDNFSVDEEETAQYFPLEHTIKFMLDTYNTLFRHNFVEETEPATRNVWHE 168

Query: 390 DVKQFAVWNIDDEDNPKFQGWLYFDLHPRDGKYGHAANFGMVSAYRKRDGSKSYPVTILV 449
           D KQ++VW +DD D P+F GWLYFDLHPRDGK+GH A F  V      +GS+ YPVT LV
Sbjct: 169 DDKQYSVWKMDDWDAPQFTGWLYFDLHPRDGKFGHLACFDNVYTDMSEEGSRVYPVTSLV 228

Query: 450 TNFSKPTPTRPALLKLGELTTFFHELGHGIHDLVGSNDLESLNGPGSVPWDFVEAPSQML 509
            NFS P+  +PALLK  E+  FFHELGHG H L+ + +L        VP DF+EAPSQML
Sbjct: 229 CNFSNPSKEKPALLKHYEVQAFFHELGHGSHKLLCAPEL--CCSSSWVPRDFIEAPSQML 286

Query: 510 EYWTARRDVLTMLSKHYETGEKIPKSLLDAWFSVGGLNSGLANLGQLKLGLFDMYVHTR- 568
           EYW  R+DV+T LSKH ETGE+IP+SL+D        N+ + NL Q+ L L DM VH   
Sbjct: 287 EYWIWRKDVITDLSKH-ETGERIPESLVDCMVKSKRANAAIDNLIQV-LALLDMAVHKHV 344

Query: 569 -DYKGAEVRKLWNDLTREIGLMNLKNYTST-GYDSFGHIMXXXXXXXXXXLWSQVFAADM 626
             Y+  ++  LWN+L  ++ L  +KN   T  Y SF HI+           WS+VFAADM
Sbjct: 345 GSYETLDLNALWNNLCEDVIL--IKNPEPTRAYCSFSHIVEGYAAGYYGYQWSKVFAADM 402

Query: 627 YDTKFKPNPFNATVGVEYRDTILATGGLYDMTDNLRKFLGRDPNNKAFLRGLGL 680
           Y ++F+    + T+G  Y DTI+A GGLY+M DNL +FL R+PNN+A+LR  GL
Sbjct: 403 YFSRFEKAHLDPTLGKLYGDTIIARGGLYEMEDNLGEFLDREPNNEAYLRDQGL 456

>KNAG0A06200 Chr1 complement(937577..939946) [2370 bp, 789 aa] {ON}
           Anc_2.432 YKL134C
          Length = 789

 Score =  173 bits (438), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 141/550 (25%), Positives = 234/550 (42%), Gaps = 48/550 (8%)

Query: 141 YRRSGMKVPVENRKRLDEVKSKIAAAELEFSSNLG-EEVEYIAFTKEELE--GVPDTVLN 197
           + +SG+ +  + R R  E+   I+    +F +N      E+I    EEL+  GV   +L 
Sbjct: 223 FEKSGIYMSTDTRDRFIEMSQDISLVGQDFINNTNWLRSEFIEIASEELDNSGVSPILLR 282

Query: 198 QFEKIIEGGVEKFKVTFKYPDIGPVLRLASNPETRRRASMADENRVAANXXXXXXXXXXX 257
           Q    + G   K       P I  +LR   N   R+    A  +                
Sbjct: 283 QLTTTVRGTHYKVPAYGTAPYI--ILRSCKNENARKAVWTALHSCPDKQINRLTHMVKMR 340

Query: 258 XXXADLLGFKNFAAYNLDDKMAKNEETVLKFLNDLVEKLLPVGKNDLEILKKKKAEDYKS 317
              ++++G   FA Y L  KMAK+ E VL F+  L+E   P+   +L++L   K  D   
Sbjct: 341 SVLSNIMGKVGFAVYQLQGKMAKSPENVLNFITRLMEHTKPMAAEELKLLANMKLNDLGL 400

Query: 318 KNLTFDGEFYS----WDTGYYTNKILRERYN----VNPDDLAQYFPVESAIEGMLNIYTT 369
                + E       WD  YY  K  + R       N + +  YF + S +EG+ N++ +
Sbjct: 401 PEANSEKEILETVRPWDRDYYVAKSQQTRKAKNQLTNHEPINAYFTLGSVLEGLSNLFKS 460

Query: 370 LFRLKFVEITDECEKSVWHEDVKQFAVWNIDDEDNPKFQGWLYFDLHPRDGKYGHAANFG 429
           ++ +  +E+        W  +V++    N+  E+N    G +Y DL  R  K    A+F 
Sbjct: 461 IYGIS-LEVVASIPGETWSSEVRRV---NVKTENN-NIIGVVYCDLFERKAKTSSPAHFT 515

Query: 430 MV----------------SAYRKRDGSKSYPVTILVTNFSKPTPTRPALLKLGELTTFFH 473
           +                 S    R      P+  LV NF++ +     LL+L E+ T FH
Sbjct: 516 VCCSRELYAEENDPSILQSGVNSRGEKFQLPIISLVCNFARTSDNELCLLQLSEIETLFH 575

Query: 474 ELGHGIHDLVGSNDLESLNGPGSVPWDFVEAPSQMLEYWTARRDVLTMLSKHYETGEKIP 533
           E+GH +H ++G   L++++G      DFVE PS ++E++     VL  + +HY T EK+P
Sbjct: 576 EMGHAMHSMLGQTKLQNISGTRCTT-DFVELPSIIMEHFARDPRVLKGIGRHYITKEKVP 634

Query: 534 KSLLDAWFSVGGLNSGLANLGQLKLGLFD-------MYVHTRDYKGAEVRKLWNDLTREI 586
           + LL    +            Q K+ + D       +  H RD    +V +L++DL R +
Sbjct: 635 EDLLAEELNSTRYLQNCETFAQAKMAMLDQRLYDNNIIFHVRDL---DVVELYHDLERNL 691

Query: 587 GLMNLKNYTSTGYDSFGHIMXXXXXXXXXXLWSQVFAADMYDTKFKPNPFNATVGVEYRD 646
            ++        G   FGH+           L  +  AA ++D  F  +PF+ T G  +++
Sbjct: 692 EVLVDDQTNWCG--KFGHLF-GYGATYYSYLLDRAIAAKIWDCLFVNDPFSRTGGENFKN 748

Query: 647 TILATGGLYD 656
            +L  GGL D
Sbjct: 749 AVLKWGGLRD 758

>KAFR0D02950 Chr4 complement(581305..583638) [2334 bp, 777 aa] {ON}
           Anc_2.432 YKL134C
          Length = 777

 Score =  170 bits (430), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 153/622 (24%), Positives = 273/622 (43%), Gaps = 55/622 (8%)

Query: 72  FLRNVSPDPEIREASKNATSMLDDWIIGLTSKYDLYQHFDEVWAQYXXXXXXXXXXXXLY 131
           F+R+V PD E   A++     + +++  L +  +L      +                + 
Sbjct: 143 FIRSVHPDKEFLSAAQQCHEEMFEFMNTLNTDVELCDKLKTLLHDNEILSKLSEEEIKVG 202

Query: 132 RYMEKDADGYRRSGMKVPVENRKRLDEVKSKIAAAELEFSSNLGE-EVEYIAFTKEELE- 189
           R + +D   + +SG+ +    R++  E+  +I+    +F +N  + +  YI     +LE 
Sbjct: 203 RILLED---FEKSGIYMNPRIREQFIELSQEISLIGQDFINNANQPKTNYIKVNASKLES 259

Query: 190 -GVPDTVLNQFEKIIEGGVEKFKVTFKYPDIGP----VLRLASNPETRRRASMADENRVA 244
            G+   +LN  +K      +  +  +K P  GP    VL+   N E R     A  +  +
Sbjct: 260 AGLNRLLLNSLKK------DAIRENYKIPTYGPTPYAVLKDCKNEEVRADIWTALHSCSS 313

Query: 245 ANXXXXXXXXXXXXXXADLLGFKNFAAYNLDDKMAKNEETVLKFLNDLVEKLLPVGKNDL 304
                           A+L+G ++F+ Y L  K+AK  + V  F+  L++ + P  + +L
Sbjct: 314 EQILRLSHLVKLRAMLANLMGAESFSQYQLKGKLAKAPKDVKNFIETLIKYVRPNTEKEL 373

Query: 305 EILKKKKAEDYKSKNL-TFDGEFYS---WDTGYYTNKILRERYNVN---PDDLAQYFPVE 357
           + +   K ED    N    DG   +   WD  YY++   + +        + L+ YF + 
Sbjct: 374 KFIADLKREDQGKINCGEMDGVLSTVRPWDRDYYSSIYFKGKEKTEHEFTEPLSSYFTLG 433

Query: 358 SAIEGMLNIYTTLFRLKFVEITDECEKSVWHEDVKQFAVWNIDDEDNPKFQGWLYFDLHP 417
              EG+ ++ T ++ +K +E         W  DV++  V  I +E+     G +YFDL  
Sbjct: 434 GVFEGLSDLLTQIYGIK-LEPAIPVSGETWFNDVRKINV--ISEEEG--IIGIIYFDLFE 488

Query: 418 RDGKYGHAANFGMVSAYR---------------KRDGSK-SYPVTILVTNFSKPT---PT 458
           R GK  + A+F +  +                 K+DG+    P+  LV NFS+ T     
Sbjct: 489 RYGKTSNPAHFTVCCSREMYPEENADSIIQLGSKKDGTIFQLPIISLVCNFSRRTFQSDK 548

Query: 459 RPALLKLGELTTFFHELGHGIHDLVGSNDLESLNGPGSVPWDFVEAPSQMLEYWTARRDV 518
              LL L E+ T FHE+GH IH ++G   L++++G      DFVE PS ++E++ +   V
Sbjct: 549 TICLLTLSEIETLFHEMGHAIHSMLGRTTLQNVSGTRCAT-DFVELPSILMEHFASDTRV 607

Query: 519 LTMLSKHYETGEKIPKSLLDAWFSVGGLNSGLANLGQLKLGLFDMYVHT----RDYKGAE 574
           L  +S HYETGEKI +  L      G          Q K+ + D  +H+     +     
Sbjct: 608 LKKMSCHYETGEKIAEKKLQFHLKEGEFLRSCETFSQAKMAMLDQELHSDKIIHNLDNLN 667

Query: 575 VRKLWNDLTREIGLMNLKNYTSTGYDSFGHIMXXXXXXXXXXLWSQVFAADMYDTKFKPN 634
           V +++ +L R + +  L +  S     FGH+           L+ +  A  +++  F  +
Sbjct: 668 VVEIYQNLERRLQV--LVDDRSNWCGKFGHLF-GYGATYYSYLFDRAIARKVWNHLFAND 724

Query: 635 PFNATVGVEYRDTILATGGLYD 656
           PFN T G ++++++L  GG  D
Sbjct: 725 PFNKTNGEKFKESLLKWGGSKD 746

>Kpol_297.8 s297 complement(11648..14011) [2364 bp, 787 aa] {ON}
           complement(11648..14011) [2364 nt, 788 aa]
          Length = 787

 Score =  167 bits (424), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 155/623 (24%), Positives = 276/623 (44%), Gaps = 57/623 (9%)

Query: 72  FLRNVSPDPEIREASKNATSMLDDWIIGLTSKYDLYQHFDEVWAQYXXXXXXXXXXXXLY 131
           F+R+  PD +  EA+++    + +++  L +  +L      V                + 
Sbjct: 153 FIRSSHPDYKFVEAAQDCYEEMFEFMNMLNTDVNLCFTLKHVLENKEIASKLSEEELRVG 212

Query: 132 RYMEKDADGYRRSGMKVPVENRKRLDEVKSKIAAAELEFSSN---LGEEVEYIAFTKEEL 188
           R + +D   + +SG+ +  E R++   +   I+    EF SN   + +    ++  + + 
Sbjct: 213 RILLED---FEKSGIYMKPEVREQFITLSQSISVIGQEFISNTDFVKDNNVVVSCNQLDS 269

Query: 189 EGVPDTVLNQFEKIIEGGVEKFKVTFKYPDIG--PVLRLASNP--ETRRRASMADENRVA 244
            G+   +L+Q EK I G        +K P  G  P   L S P  E R +  +A  N   
Sbjct: 270 LGIDPELLSQIEKDIAGK------NYKIPTYGYIPFALLKSCPSEEIREKIWVAVHNCSN 323

Query: 245 ANXXXXXXXXXXXXXXADLLGFKNFAAYNLDDKMAKNEETVLKFLNDLVEKLLPVGKNDL 304
                           + LLG K++A Y L+ KMAKN + V++F+  L++   P+   +L
Sbjct: 324 EQIKRLTDLVKLRAVLSQLLGKKSYAEYQLEGKMAKNPKEVIEFIKTLMDFTKPMAAKEL 383

Query: 305 E-ILKKKKAEDYKSKNLTFDGEFYS---WDTGYYTNKILRERYNVN----PDDLAQYFPV 356
           + I +KK        NL+      +   WD  YY+  I RE+ +       +++ +YF +
Sbjct: 384 DGIAEKKLTIKSNGSNLSVCDILKTVRPWDRDYYS-AIEREQTSAKNLYGSEEVLKYFTL 442

Query: 357 ESAIEGMLNIYTTLFRLKFVEITDECEKSVWHEDVKQFAVWNIDDEDNPKFQGWLYFDLH 416
            + ++G+ N++  ++ +K +E+        W  +V++  V + D+       G +Y DL 
Sbjct: 443 GNVMQGLSNLFQKIYGIK-LELDVPKIGETWSPEVRKINVISEDE----GLIGIIYCDLF 497

Query: 417 PRDGKYGHAANFGM-----VSAYRKRDGSKSY-----------PVTILVTNFSKPTPTRP 460
            R GK  +AA+F +     +S Y   D +              P+  LV NFSK   +  
Sbjct: 498 ERSGKTSNAAHFTICCSRDISPYETEDSTTQIAIDSKGTRFQLPIISLVCNFSKTMISET 557

Query: 461 ---ALLKLGELTTFFHELGHGIHDLVGSNDLESLNGPGSVPWDFVEAPSQMLEYWTARRD 517
                L L E+ T FHE+GH +H ++G   L++++G      DFVE PS ++EY+     
Sbjct: 558 DSVCFLHLPEVETLFHEMGHAMHSMLGRTKLQNISGTRCAT-DFVELPSILMEYFARDPR 616

Query: 518 VLTMLSKHYETGEKIPKSLLDAWFSVGGLNSGLANLGQLKLGLFDMYVHTRDYKG----A 573
           VL  + KHY T E + + +L+                Q K+ + D  +H           
Sbjct: 617 VLETIGKHYLTKETVKREMLEPHLQDLKYLQHCETYSQAKMAMLDQTLHGETISSHLDHL 676

Query: 574 EVRKLWNDLTREIGLMNLKNYTSTGYDSFGHIMXXXXXXXXXXLWSQVFAADMYDTKFKP 633
           +V KL+ DL R++G+  L +  S     FGH+           L+ +  A+ ++   F+ 
Sbjct: 677 DVVKLYQDLERQLGV--LVDDKSNWCGKFGHLF-GYSAVYYSYLFDRAIASKIWGALFER 733

Query: 634 NPFNATVGVEYRDTILATGGLYD 656
           NPF+   G +YR+++L  GG  D
Sbjct: 734 NPFSRASGDKYRNSVLQWGGSRD 756

>SAKL0E03938g Chr5 (317017..319320) [2304 bp, 767 aa] {ON} similar
           to uniprot|P35999 Saccharomyces cerevisiae YKL134C OCT1
           Mitochondrial intermediate peptidase cleaves N-terminal
           residues of a subset of proteins upon import after their
           cleavage by mitochondrial processing peptidase
           (Mas1p-Mas2p) may contribute to mitochondrial iron
           homeostasis
          Length = 767

 Score =  166 bits (421), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 161/674 (23%), Positives = 288/674 (42%), Gaps = 72/674 (10%)

Query: 28  HQLINQTEAVYHNVLQEKPPTIDNYIMPLIYHEEETDLLWNQL---VFLRNVSPDPEIRE 84
           H L    E V        P    NYI  L   +  +D+L   +    F+R   PDP   +
Sbjct: 90  HSLTQANELVETMRHDRSPKGYANYIANL---DRLSDILCRVIDLAEFIRASHPDPHFVQ 146

Query: 85  ASKNATSMLDDWIIGLTSKYDLYQHFDEVWAQYXXXXXXXXXXXXLYRYMEKDADGYRRS 144
           A+++    + + +  L +   L      V                + + + +D   + +S
Sbjct: 147 AAQDCHEEMFEIMNVLNTDVALCDILKHVLTDPTILSELSPEEIKVGKILLED---FEKS 203

Query: 145 GMKVPVENRKRLDEVKSKIAAAELEFSSNLGEEVE--YIAFTKEEL--EGVPDTVLNQFE 200
           G+ +  E R++   +  +I+    +F +N  E V   YI    EEL   G+   VLNQ  
Sbjct: 204 GIHMNPEVREQFIALSQQISVVGQDFINN-TEYVRSNYIKVEVEELNKSGINKIVLNQLS 262

Query: 201 KIIEGGVEKFKVTFKYPDIG----PVLRLASNPETRRRASMADENRVAANXXXXXXXXXX 256
           K I+G        +K P  G     +LR   +   R +   A  +               
Sbjct: 263 KDIKGR------HYKIPTFGYIPYSILRSCPDDNIRMKVWSALHSCSEKQIARLDQLIKL 316

Query: 257 XXXXADLLGFKNFAAYNLDDKMAKNEETVLKFLNDLVEKLLPVGKNDLEILKKKKAEDYK 316
               A+++G K+FA Y L+ KMAK  E V  F+  L++   P    +L+ +      D K
Sbjct: 317 RSVLANIMGKKSFAHYQLEGKMAKTPEYVRGFMQSLIDATKPKAAEELKFIA-----DLK 371

Query: 317 SKNLTFDGEFYS----------WDTGYYTN-KILRERYNVNPDDLAQYFPVESAIEGMLN 365
           +K++  +    S          WD  +Y +   L++R   N + ++ YF +   I+G+ N
Sbjct: 372 AKHVPGNKPAESMHEILEMVKPWDRDFYGSVHALQQRRPFNNEQISSYFSLGVVIQGLSN 431

Query: 366 IYTTLFRLKFVEITDECEKSVWHEDVKQFAVWNIDDEDNPKFQGWLYFDLHPRDGKYGHA 425
           ++  ++ + ++E         W  +V++  V +    +     G +Y DL  R GK  + 
Sbjct: 432 LFKQIYGI-YLEPVVPKTGETWSPEVRRINVVS----EKEGVIGVVYCDLFERQGKTANP 486

Query: 426 ANFGMVSAYRKRDGSK----------------SYPVTILVTNFSKPTPTRP---ALLKLG 466
           A+F +  + +  DG                    PV  LV NFS  T ++     LL+L 
Sbjct: 487 AHFTVCCSRQIYDGETDLSTIQVGQNSKGEQFQLPVISLVCNFSPTTISQEQSICLLQLS 546

Query: 467 ELTTFFHELGHGIHDLVGSNDLESLNGPGSVPWDFVEAPSQMLEYWTARRDVLTMLSKHY 526
           E+ T FHE+GH +H ++G   L++++G      DFVE PS ++E++     VL  ++ HY
Sbjct: 547 EIETLFHEMGHAMHSMLGRTKLQNISGTRCAT-DFVELPSILMEHFARDHRVLQRMASHY 605

Query: 527 ETGEKIPKSLLDAWFSVGGLNSGLANLGQLKLGLFDMYVH----TRDYKGAEVRKLWNDL 582
            TGE IP+ LL ++ S            Q K+ + D  +H     ++ +  ++ KL+++L
Sbjct: 606 STGESIPEQLLFSYQSEVKFLQHAEAFSQAKMAILDQELHGESIMKEMQYLDIVKLYHNL 665

Query: 583 TREIGLMNLKNYTSTGYDSFGHIMXXXXXXXXXXLWSQVFAADMYDTKFKPNPFNATVGV 642
            R++ +  L +  S     FGH+           L+ +  A+ ++   F  +PF    G 
Sbjct: 666 ERQLEV--LSDDKSNWCGRFGHLF-GYGATYYSYLFDRAIASKIWQHLFANDPFCRRSGE 722

Query: 643 EYRDTILATGGLYD 656
           ++++++L  GG  D
Sbjct: 723 KFKNSVLKWGGSRD 736

>ZYRO0G20130g Chr7 (1666665..1669025) [2361 bp, 786 aa] {ON} similar
           to uniprot|P35999 Saccharomyces cerevisiae YKL134C OCT1
           Mitochondrial intermediate peptidase cleaves N-terminal
           residues of a subset of proteins upon import after their
           cleavage by mitochondrial processing peptidase
           (Mas1p-Mas2p) may contribute to mitochondrial iron
           homeostasis
          Length = 786

 Score =  162 bits (411), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 155/670 (23%), Positives = 296/670 (44%), Gaps = 57/670 (8%)

Query: 26  LSHQLINQTEAVYHNVLQ-EKPPTIDNYIMPLIYHEEETDLLWNQLVFLRNVSPDPEIRE 84
            S Q +NQ   +  ++   E P  + NYI+ L    +    + +   F+R+  PD    +
Sbjct: 104 FSRQSLNQAYELLEDMKNDETPQGLQNYILRLDQLSDTLCRVIDLCEFIRSSHPDSHFVD 163

Query: 85  ASKNATSMLDDWIIGLTSKYDLYQHFDEVWAQYXXXXXXXXXXXXLYRYMEKDADGYRRS 144
           A+++    + +++  L +  +L      V                + + + +D   + +S
Sbjct: 164 AAQDCHEEMFEFMNVLNTDVNLCNKLRTVLNTPEVVCKLSSEEVKVGKILLED---FEKS 220

Query: 145 GMKVPVENRKRLDEVKSKIAAAELEFSSNLG-EEVEYIAFTKEELE--GVPDTVLNQFEK 201
           G+ +  E R++   +  +I+    +F +N       YI    E +   G+   +L+Q  K
Sbjct: 221 GIYMNPEIREQFIALSQEISIVGQDFINNTDFVRTNYITVDCETIHNSGINQLILSQLSK 280

Query: 202 IIEGGVEKFKVTFKYPDIG----PVLRLASNPETRRRASMADENRVAANXXXXXXXXXXX 257
            I+G        +K P  G     VLR   +   R++   A  +                
Sbjct: 281 DIKGK------HYKIPTHGYIAYSVLRACPDEIVRKKLWTAMHSCPDKQIVRLDQLVRLR 334

Query: 258 XXXADLLGFKNFAAYNLDDKMAKNEETVLKFLNDLVEKLLPVGKNDLEILK--KKKAEDY 315
              A L+G K++A Y L+ KMAK+ E V  F++ L++   P  K +L  +   K+K  D 
Sbjct: 335 AVLAFLMGKKSYAEYQLEGKMAKSPEEVTDFIDSLIKVTQPKAKQELGFISDLKRKHMDL 394

Query: 316 ---KSKNLTFDGEFYSWDTGYY-TNKILRERYNVNPDD--LAQYFPVESAIEGMLNIYTT 369
              ++ NL        WD  +Y T   +++R     DD  ++ YF + + ++G+ +++  
Sbjct: 395 PPSETSNLDTLDIVRPWDRDFYHTIYSIQQRRQSPIDDQQISMYFTLGNVMQGLSDLFHQ 454

Query: 370 LFRLKFVEITDECEKSVWHEDVKQFAVWNIDDEDNPKFQGWLYFDLHPRDGKYGHAANFG 429
           ++ ++   +  + +   W  +V++  V  + DE+     G +Y DL  RDGK  + ++F 
Sbjct: 455 IYGIRLEPVIAQ-KGETWSPEVRRLNV--VSDEEG--VIGVVYCDLFERDGKTSNPSHFT 509

Query: 430 MVSAYR---------------KRDGSK-SYPVTILVTNFSKPTPT---RPALLKLGELTT 470
           +  + +                +DG+K   P+  LV NF+    +      LL + E+ T
Sbjct: 510 VCCSRQIYPKENDLSTIQIGTNKDGTKFQLPIISLVCNFASSVVSFGQSLCLLHISEIET 569

Query: 471 FFHELGHGIHDLVGSNDLESLNGPGSVPWDFVEAPSQMLEYWTARRDVLTMLSKHYETGE 530
            FHE+GH +H ++G   L++L+G      DFVE PS ++E++     VL  + KH  TGE
Sbjct: 570 LFHEMGHAMHSMLGRTRLQNLSGT-RCATDFVELPSILMEHFARDTRVLRQIGKHCNTGE 628

Query: 531 KIPKSLLDAWFSVGGLNSGLANLGQLKLGLFDMYVHTRDYKGA----EVRKLWNDLTREI 586
            +P+SLL  +              Q K+ + D  +H ++        +V  L+ +L RE+
Sbjct: 629 PVPESLLTNYLQDLQYMQYCETFSQAKMAMLDQRLHGKEIITGMDTLDVVALYQNLEREL 688

Query: 587 GLMNLKNYTSTGYDSFGHIMXXXXXXXXXXLWSQVFAADMYDTKFKPNPFNATVGVEYRD 646
            +  L +  ST    FGH+           L+ +  A+ ++++ F+ +PF+   G  +++
Sbjct: 689 RV--LVDDQSTWCGRFGHLF-GYGATYYSYLFDRAIASKVWESLFQEDPFSRAGGQRFKE 745

Query: 647 TILATGGLYD 656
            +L  GG  D
Sbjct: 746 YVLKWGGAKD 755

>CAGL0D02112g Chr4 complement(216204..218489) [2286 bp, 761 aa] {ON}
           similar to uniprot|P35999 Saccharomyces cerevisiae
           YKL134c MIP1
          Length = 761

 Score =  160 bits (406), Expect = 9e-41,   Method: Compositional matrix adjust.
 Identities = 151/636 (23%), Positives = 273/636 (42%), Gaps = 47/636 (7%)

Query: 51  NYIMPLIYHEEETDLLWNQLVFLRNVSPDPEIREASKNATSMLDDWIIGLTSKYDLYQHF 110
           +YIM L    +    + +   FLR+  PD    EA++     + +++  L +   L    
Sbjct: 108 HYIMNLDQLSDTLCRVIDLCEFLRSAHPDQSYVEAAQMCHEEMFEFMNVLNTDVVLCNKL 167

Query: 111 DEVWAQYXXXXXXXXXXXXLYRYMEKDADGYRRSGMKVPVENRKRLDEVKSKIAAAELEF 170
            EV                +   +    D + +SG+ +    R++  E+  +I+    EF
Sbjct: 168 KEVLEDPEILKVLSEEERKVGEIL---LDDFEKSGIYMKAGIREQFIELSQQISVIGQEF 224

Query: 171 SSNLGEEV-EYIAFTKEELE--GVPDTVLNQFEKIIEGGVEKFKVTFKYPDIGPVLRLAS 227
            +N      E+I   ++E++  G+   +  +  + + G   K     + P    +L+   
Sbjct: 225 INNTDYVAKEFIKVKRDEMDKSGISPLLTARLNRDLTGKYYKIPTYGQIP--LQILKSCP 282

Query: 228 NPETRRRASMADENRVAANXXXXXXXXXXXXXXADLLGFKNFAAYNLDDKMAKNEETVLK 287
           + + R+    A  N   A               ++LLG ++++ Y LD+KMA + E V  
Sbjct: 283 DEDIRKEVWAALHNCPKAQIQRLNQLVRLRVILSNLLGKQSYSDYQLDNKMAGSPENVKG 342

Query: 288 FLNDLVEKLLPVGKNDLEILKKKKAEDYKSKNLTFDGEFYS----WDTGYYTNKIL--RE 341
           F+  L+    P+   +LE + + K     S++++ D E  S    WD  Y+++K     E
Sbjct: 343 FIKTLMNVTKPLAARELEFIARDKLNAPDSRHMS-DNEILSIVKPWDKNYFSSKYDSDNE 401

Query: 342 RYNVNPDDLAQYFPVESAIEGMLNIYTTLFRLKFVEITDECEKSVWHEDVKQFAVWNIDD 401
              +  + L  YF + + I G+  ++  ++ +       E     W  DV++  V  I +
Sbjct: 402 MAMIRDEQLRYYFSLGNVINGLSELFKRIYGITLQPSRTE-NGETWSPDVRRLDV--ISE 458

Query: 402 EDNPKFQGWLYFDLHPRDGKYGHAANFGMVSAYR---------------KRDGSK-SYPV 445
           E+     G +Y DL  R GK  + A+F +  + +                 DG+    PV
Sbjct: 459 EEG--LVGVIYCDLFERVGKISNPAHFTVCCSRQVYPDENDFTTIQTGQNSDGTVFQLPV 516

Query: 446 TILVTNFSK---PTPTRPALLKLGELTTFFHELGHGIHDLVGSNDLESLNGPGSVPWDFV 502
             LV NFS    P   R   L + E+ T FHE+GH +H ++G   L++++G      DFV
Sbjct: 517 ISLVCNFSTVALPNGNRTCFLHMNEIETLFHEMGHAMHSMLGRTRLQNISGTRCAT-DFV 575

Query: 503 EAPSQMLEYWTARRDVLTMLSKHYETGEKIPKSLLDAWFSVGGLNSGLANLGQLKLGLFD 562
           E PS ++E++     VL  +  HYET E  P++LL+ +              Q K+ + D
Sbjct: 576 ELPSILMEHFARDIRVLRTIGSHYETSEPAPEALLNDYLDKTQFLQHCETYSQAKMAMLD 635

Query: 563 MYVH----TRDYKGAEVRKLWNDLTREIGLMNLKNYTSTGYDSFGHIMXXXXXXXXXXLW 618
             +H      D +  +  K++  L  E  L  L +  S     FGH+           L+
Sbjct: 636 QKLHGSFSLSDIERIDSAKIYQKL--ETRLQVLADDESNWCGRFGHLF-GYGATYYSYLF 692

Query: 619 SQVFAADMYDTKFKPNPFNATVGVEYRDTILATGGL 654
            +  A+ ++D+ FK +PFN T G ++++ +L  GGL
Sbjct: 693 DRAIASKVWDSLFKDDPFNRTGGEKFKERVLKWGGL 728

>NDAI0E02010 Chr5 complement(404579..406915) [2337 bp, 778 aa] {ON}
           Anc_1.9 YCL057W
          Length = 778

 Score =  159 bits (402), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 142/618 (22%), Positives = 278/618 (44%), Gaps = 52/618 (8%)

Query: 72  FLRNVSPDPEIREASKNATSMLDDWIIGLTSKYDLYQHFDEVWAQYXXXXXXXXXXXXLY 131
           F+R+  P+    EA+++    L +++  L +  +L +  +E                 + 
Sbjct: 145 FIRSAHPEEGFIEAAQDCHEKLFEFMNVLNTDRELCELLNETLQDEQVLSKLSEEEKKVG 204

Query: 132 RYMEKDADGYRRSGMKVPVENRKRLDEVKSKIAAAELEFSSNLGEEVE-YIAFTKEELE- 189
             + +D   + +SG+ +    + +   +   I+    E+ +N+ +    +I   + EL+ 
Sbjct: 205 YILLQD---FIKSGIYMDSGKKDQFITLSQDISVIGQEYINNINQLARNHIKVKRSELDN 261

Query: 190 -GVPDTVLNQFEKIIEGGVEKFKVTFKYPDIGPVLRLASNPETRRRASMADENRVAANXX 248
            G+   V  Q  K I G   K       P +  +L+  ++PE R++  +A  +       
Sbjct: 262 AGIEFDVACQLGKDITGKYYKIPTYGHLPFL--ILKACTDPEIRKKIWVAMHDCSKQQIE 319

Query: 249 XXXXXXXXXXXXADLLGFKNFAAYNLDDKMAKNEETVLKFLNDLVEKLLPVGKNDLEIL- 307
                       A  +G + +AAY +D KMAKN + V +FL  L++ L P    +L+ + 
Sbjct: 320 RLTNLVKIRAFLAHTMGRECYAAYAIDGKMAKNPKDVDEFLKSLMDFLKPKAAKELKFIS 379

Query: 308 ------KKKKAEDYKSKNLTFDGEFYSWDTGYYTNKILRERYNVNPDDLA--QYFPVESA 359
                 K +K  D   + LT       WD  YYT     ++ ++  DD A   Y+P+ + 
Sbjct: 380 DLIHNEKGEKPSDDVDEILT---AVRPWDREYYTAIHRNKQKHLLLDDYALDVYYPLGNV 436

Query: 360 IEGMLNIYTTLFRLKFVEITDECEKSVWHEDVKQFAVWNIDDEDNPKFQGWLYFDLHPRD 419
           I+G+ +I+ +++ ++F E     +   W  DV++  V +    +     G +Y DL  R 
Sbjct: 437 IQGLSDIFESIYGIRF-EPAVAGKGETWSSDVRRLNVVS----EKEGLIGIIYCDLFRRQ 491

Query: 420 GKYGHAANFGMVSAYR---------------KRDGSK-SYPVTILVTNFSKPTPTRP--- 460
           GK  +AA+F +  + +                 DG+K   P+  L+ NF+          
Sbjct: 492 GKTNNAAHFTICCSRQIYPHEDDFSTIQLGTNVDGTKFQLPIISLLCNFNTRCLNSGETI 551

Query: 461 ALLKLGELTTFFHELGHGIHDLVGSNDLESLNGPGSVPWDFVEAPSQMLEYWTARRDVLT 520
            LL L E+ T FHE+GH IH ++G   L++++G      DFVE PS ++E++     VL 
Sbjct: 552 CLLALNEIETLFHEMGHAIHSMLGRTRLQNVSGT-RCSTDFVELPSVLMEHFARDTRVLK 610

Query: 521 MLSKHYETGEKIPKSLLDAWFSVGGLNSGLANLGQLKLGLFDMYVH----TRDYKGAEVR 576
            +  HY+TG+++P +LL+ +              Q K+ + D  ++     ++    +V 
Sbjct: 611 RIGHHYKTGDRVPATLLNRYLEKARFLKDCETFSQAKMAMLDQRLYDKNIVQNIDSVDVV 670

Query: 577 KLWNDLTREIGLMNLKNYTSTGYDSFGHIMXXXXXXXXXXLWSQVFAADMYDTKFKPNPF 636
           K++++L +E+ +  L +  S     FGH+           L+ +  A+ ++   F+ +P+
Sbjct: 671 KIYHELEKELEV--LVDDESNWCAKFGHLF-GYGATYYCYLFDRAIASKVWKKLFEKDPY 727

Query: 637 NATVGVEYRDTILATGGL 654
           + + G ++++ +L  GGL
Sbjct: 728 SRSGGEKFKNDVLKWGGL 745

>Ecym_6099 Chr6 complement(186647..188968) [2322 bp, 773 aa] {ON}
           similar to Ashbya gossypii AFR198W
          Length = 773

 Score =  158 bits (400), Expect = 7e-40,   Method: Compositional matrix adjust.
 Identities = 134/551 (24%), Positives = 248/551 (45%), Gaps = 52/551 (9%)

Query: 139 DGYRRSGMKVPVENRKRLDEVKSKIAAAELEFSSNLGEEVEYIAFTKEELE-------GV 191
           + + +SG+ +  + R+R  E+   I+    EF +N     EY+  +  E+E       GV
Sbjct: 211 EDFEKSGIYMNPKVRERFIELSQVISIVGQEFITN----TEYVGTSFVEIETDVLEASGV 266

Query: 192 PDTVLNQFEKIIEGGVEKFKVTFKYPDIG----PVLRLASNPETRRRASMADENRVAANX 247
              VL Q  K + G   KF   +K P  G     ++R   +   R++   A  +      
Sbjct: 267 SQMVLQQLSKDLSG---KF---YKIPTYGYLPYSIIRTCPSEYIRKKVWTAMYSCPEKQI 320

Query: 248 XXXXXXXXXXXXXADLLGFKNFAAYNLDDKMAKNEETVLKFLNDLVEKLLPVGKNDLEIL 307
                        A ++G  ++A Y L+ KMAK+ + V  F+N L+E   P+   +L+ L
Sbjct: 321 KRLKKLVRLRQQLAHIMGKPDYATYQLEGKMAKSPKNVKNFMNTLIEYTKPLAMEELKPL 380

Query: 308 KKKKAEDYKSKNLTFDGEFYSWDTGYYTNKIL----RERYNVNPDDLAQYFPVESAIEGM 363
              K +++             WD  Y+ +  L    R    ++   L  YF +   I+G+
Sbjct: 381 ADMKHDNHCKDASEILSSVRPWDRDYFGSMSLLAQPRSVKTMSFQSLNCYFSLGVVIQGL 440

Query: 364 LNIYTTLFRLKFVEITDECEKSVWHEDVKQFAVWNIDDEDNPKFQGWLYFDLHPRDGKYG 423
            +++ +++ ++   +  +  ++ W  +V++  V +   E N    G +Y DL  R GK  
Sbjct: 441 SDLFQSIYGIRLEPVVAKTGET-WDPEVRKIQVIS---EANGVI-GVIYCDLFERQGKTP 495

Query: 424 HAANFGMVSAYR---------------KRDGSK-SYPVTILVTNFS--KPTPTRPALLKL 465
           + A+F +  + +                 D SK   PV  LV NFS  +       LL+L
Sbjct: 496 NPAHFTVCCSRQIYPNETDYSTIQVGSHPDKSKFQMPVISLVCNFSHTQADDDSICLLQL 555

Query: 466 GELTTFFHELGHGIHDLVGSNDLESLNGPGSVPWDFVEAPSQMLEYWTARRDVLTMLSKH 525
            E+ T FHE+GH +H ++G   L++++G      DFVE PS ++E++     VL+ +S H
Sbjct: 556 SEVETLFHEMGHAMHSMLGRTQLQNISGTRCAT-DFVELPSILMEHFAKDLRVLSRISSH 614

Query: 526 YETGEKIPKSLLDAWFSVGGLNSGLANLGQLKLGLFDMYVHTRDYKGAEVRKLWNDLTRE 585
           Y TGE++PK +L  +              Q+K+ + D  +H+      ++  +++ L +E
Sbjct: 615 YATGERVPKEMLVNYQQENRFLEHTETFSQIKMAMLDQRLHSLTDNSEDIVTVYHGLEKE 674

Query: 586 IGLMNLKNYTSTGYDSFGHIMXXXXXXXXXXLWSQVFAADMYDTKFKPNPFNATVGVEYR 645
           + +  L +  S     FGH+           L  +  AA +++  F+ +PF+   G +++
Sbjct: 675 LQV--LVDDRSNWCGRFGHLF-GYGASYYSYLMDRAIAAKVWNHLFQHDPFSRAGGEKFK 731

Query: 646 DTILATGGLYD 656
           +++L  GG  D
Sbjct: 732 NSVLKWGGSRD 742

>Skud_11.93 Chr11 complement(175243..177561) [2319 bp, 772 aa] {ON}
           YKL134C (REAL)
          Length = 772

 Score =  155 bits (391), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 150/624 (24%), Positives = 273/624 (43%), Gaps = 60/624 (9%)

Query: 72  FLRNVSPDPEIREASKNATSMLDDWIIGLTSKYDLYQHFDEVWAQYXXXXXXXXXXXXLY 131
           F+R+  PD +  +A+++    + +++  L +   L      V                + 
Sbjct: 139 FIRSTHPDDKFVKAAQDCHEQMFEFMNVLNTDVSLCNILKSVLNSPEVSSKLSDEELKVG 198

Query: 132 RYMEKDADGYRRSGMKVPVENRKRLDEVKSKIAAAELEFSSNL---GEEVEYIAFTKEEL 188
           + +    D + +SG+ +  + R++  E+  +I+    EF ++    G     I     + 
Sbjct: 199 KIL---LDDFEKSGIYMNPDVREKFIELSQEISLIGQEFINHTDYPGSNSVKIPCKDLDN 255

Query: 189 EGVPDTVLNQFEKIIEGGVEKFKV-TFKYPDIGPVLRLASNPETRRRASMADENRVAANX 247
             V   +L Q  K ++G  + +K+ TF Y     +L+     E R++   A  +      
Sbjct: 256 GNVSAFLLKQLNKDVKG--QNYKIPTFGYAAYA-LLKSCEKEEVRKKLWTALHSCSDKQI 312

Query: 248 XXXXXXXXXXXXXADLLGFKNFAAYNLDDKMAKNEETVLKFLNDLVEKLLPVGKNDLEIL 307
                        A+L+  +++A Y L+ KMAKN + V  F+  L+   +    N+L+ +
Sbjct: 313 KRLSHLIKLRAILANLMNKESYAEYQLEGKMAKNPKDVQDFILTLMNGTIDKTANELKFI 372

Query: 308 KKKKAEDYKSKNLTFDGEFYS----WDTGYYTNKILRERYNVNPDD------LAQYFPVE 357
            + K +D K    T   +       WD  YYT K L+    +NP D      ++ YF + 
Sbjct: 373 AELKTKDLKKPLATKTDDILRLVRPWDRDYYTGKYLQ----LNPSDAPNAKEISYYFTLG 428

Query: 358 SAIEGMLNIYTTLFRLKF-VEITDECEKSVWHEDVKQFAVWNIDDEDNPKFQGWLYFDLH 416
           + IEG+ +++  ++ ++   EI DE E   W  DV++  V  I +E+     G +Y DL 
Sbjct: 429 NVIEGLSDLFQHIYGIRLEPEIADEGE--TWSPDVRRLNV--ISEEEG--IIGIIYCDLF 482

Query: 417 PRDGKYGHAANFGMVSAYR---------------KRDGSK-SYPVTILVTNFSKPTPTRP 460
            R+GK  + A+F +  + +                 DGS    PV  LV NF+ P P   
Sbjct: 483 ERNGKTSNPAHFTVCCSRQIYPNETDFSTIQVGENPDGSYFQLPVISLVCNFA-PIPIAS 541

Query: 461 ----ALLKLGELTTFFHELGHGIHDLVGSNDLESLNGPGSVPWDFVEAPSQMLEYWTARR 516
                 L+L E+ T FHE+GH +H ++G   +++++G      DFVE PS ++E++    
Sbjct: 542 KKTLCFLQLSEVETLFHEMGHAMHSMLGRTHMQNISGTRCAT-DFVELPSILMEHFAKDI 600

Query: 517 DVLTMLSKHYETGEKIPKSLLDAWFSVGGLNSGLANLGQLKLGLFDMYVH----TRDYKG 572
            +LT +SKHYETGE I   +L ++              Q K+ + D   H      D   
Sbjct: 601 RILTKISKHYETGETIQAGMLQSFMRTTNFLQNCETYSQAKMAMLDQSFHDEEIISDIDN 660

Query: 573 AEVRKLWNDLTREIGLMNLKNYTSTGYDSFGHIMXXXXXXXXXXLWSQVFAADMYDTKFK 632
            ++ K +  L R + +  L +  S     FGH+           L+ +  A+ ++   F+
Sbjct: 661 FDIVKNYQALERRLKV--LVDDQSNWCGRFGHLF-GYGATYYSYLFDRTIASKIWYALFE 717

Query: 633 PNPFNATVGVEYRDTILATGGLYD 656
            +P++   G +++  +L  GGL D
Sbjct: 718 DDPYSRKNGDKFKKHLLKWGGLKD 741

>TPHA0G02390 Chr7 complement(486025..488412) [2388 bp, 795 aa] {ON}
           Anc_2.432 YKL134C
          Length = 795

 Score =  152 bits (385), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 155/628 (24%), Positives = 268/628 (42%), Gaps = 69/628 (10%)

Query: 72  FLRNVSPDPEIREASKNATSMLDDWIIGLTSKYDLYQHFDEVWAQYXXXXXXXXXXXXLY 131
           F+R+  PD E  + S+    ++ +++  L +   L      +                + 
Sbjct: 160 FIRSAHPDDEYLKVSQECYELMFEFMNTLNTDVQLCYTLKHILEDEKICSKLTDEEYKVG 219

Query: 132 RYMEKDADGYRRSGMKVPVENRKRLDEVKSKIAAAELEFSSNLGEEVEYI---------- 181
           + + +D   + +SG+ +    R++  E+  +I+    EF SN     +Y+          
Sbjct: 220 KILLED---FEKSGIYMEPNTREKFIELSQEISLVGQEFISN----TDYVTKNNILIDRE 272

Query: 182 AFTKEELEGVPDTVLNQFEKIIEGGVEKFKVTFKYPDIGPV----LRLASNPETRRRASM 237
           +    ELE +P T   Q +  I G        +K P  GP+    L   SN   R++   
Sbjct: 273 SLNLSELE-LPFTY--QLKTDITGK------HYKIPTTGPIPYSILTNCSNETIRKKIWT 323

Query: 238 ADENRVAANXXXXXXXXXXXXXXADLLGFKNFAAYNLDDKMAKNEETVLKFLNDLVEKLL 297
              +                   A LL  K+FA Y L  KMAKN E V KF++ L++   
Sbjct: 324 ELHSCSQEQIERLKKMVTLRYKLAKLLKKKSFAEYQLQGKMAKNPEEVKKFISTLLDFTK 383

Query: 298 PVGKNDLEILKKKKAED----YKSKNLTFDGEFYSWDTGYYTNKILRERYNVNPDDLAQ- 352
           P+   +L  L + KA D    +K+ +         WD  YY+ KI R       +DL + 
Sbjct: 384 PLAIKELTSLAEVKAADLGLAFKNDSNFIVNLIRPWDRNYYS-KINRYENKQTMEDLNEL 442

Query: 353 --YFPVESAIEGMLNIYTTLFRLKFVEITDECEKSVWHEDVKQFAVWNIDDEDNPKFQGW 410
             YF + + I G+ N++  ++ ++F     + E++ W  +V++  V +    ++    G 
Sbjct: 443 PYYFSLGNVIAGLSNLFHNIYGIRFELAVPKLEET-WLPEVRKLNVIS----ESEGLIGI 497

Query: 411 LYFDLHPRDGKYGHAANFGMVSAYRKRDGSK---------------SYPVTILVTNFSKP 455
           +Y DL  R  K  +AA+F +  +     G                   P+  L+ NFSK 
Sbjct: 498 VYCDLFERPSKKTNAAHFTICCSREIGKGEDISTMQVGMNSKGNMFQLPIISLICNFSKS 557

Query: 456 ---TPTRPALLKLGELTTFFHELGHGIHDLVGSNDLESLNGPGSVPWDFVEAPSQMLEYW 512
                  P  L+L E+ T FHE+GH +H ++G   L++ +G      DFVE PS ++E++
Sbjct: 558 HLFEENGPCFLQLHEIETLFHEMGHAMHSVLGRTRLQNTSGTRCAT-DFVELPSILMEHF 616

Query: 513 TARRDVLTMLSKHYETGEKIPKSLLDAWFSVGGLNSGLANLGQLKLGLFDMYVHT----R 568
                V+  +S HY + E     LL  W         L    Q K+ + D  +H+     
Sbjct: 617 AKDVRVMESISSHYISQEPASPELLQTWLHSTDNLQNLELYTQAKMSMLDQILHSNEIFE 676

Query: 569 DYKGAEVRKLWNDLTREIGLMNLKNYTSTGYDSFGHIMXXXXXXXXXXLWSQVFAADMYD 628
           D K   V K +NDL +++ L +       G   FGH+           L+ +  A+ +++
Sbjct: 677 DQKDINVVKSYNDLEKKLELFSDDQSNWCG--KFGHLF-GYGASYYSYLFDRAIASKVWE 733

Query: 629 TKFKPNPFNATVGVEYRDTILATGGLYD 656
           + FK NPF+ T G++++D++L  GG  D
Sbjct: 734 SLFKQNPFSRTSGLKFKDSVLRWGGSRD 761

>AFR198W Chr6 (797448..799778) [2331 bp, 776 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YKL134C (OCT1)
          Length = 776

 Score =  152 bits (385), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 146/615 (23%), Positives = 258/615 (41%), Gaps = 49/615 (7%)

Query: 72  FLRNVSPDPEIREASKNATSMLDDWIIGLTSKYDLYQHFDEVWAQYXXXXXXXXXXXXLY 131
           FLR   PD +   A++     + + +  L +   L +   +V +              + 
Sbjct: 150 FLRAAHPDEQFVAAAQECHEQMFEIMNILNTDVVLCKRLKQVLSDENISSKLSSEEIRVG 209

Query: 132 RYMEKDADGYRRSGMKVPVENRKRLDEVKSKIAAAELEFSSNLGE-EVEYIAFTKEELE- 189
             + +D   + ++G     E RK+  ++   I+    +F +N       YI    ++LE 
Sbjct: 210 HILLED---FEKAGAYASPEVRKQFIQLSQNISIIGQDFINNTESLSSSYIKIPCKDLES 266

Query: 190 -GVPDTVLNQFEKIIEGGVEKFKVTFKYPDIG--PVLRLASNPE--TRRRASMADENRVA 244
            G    VL Q  K   G        +K P  G  P   L + P    RR+   A  +   
Sbjct: 267 SGTSHLVLRQLTKDTMGN------NYKIPTSGYAPYTLLNACPSEAIRRQVWTAMFSCSE 320

Query: 245 ANXXXXXXXXXXXXXXADLLGFKNFAAYNLDDKMAKNEETVLKFLNDLVEKLLPVGKNDL 304
                           A+++G  ++ +Y L+ KMAK+ E V  FLN LV+   P+   +L
Sbjct: 321 KQVKRLKSLLQLRRKLANIMGATDYVSYQLEGKMAKSPENVKNFLNTLVDHTKPLAAGEL 380

Query: 305 EILKKKKAEDYKSKNLTFDGEFYSWDTGYYTN---KILRERYNVNP-DDLAQYFPVESAI 360
           E L K K                 WD  YY++      R  + V+    +  YF +   +
Sbjct: 381 EELAKLKRNVENLSETNTLKLMRPWDRDYYSSLSPNFTRPNHRVDGFTSINTYFSLGVVM 440

Query: 361 EGMLNIYTTLFRLKFVEITDECEKSVWHEDVKQFAVWNIDDEDNPKFQGWLYFDLHPRDG 420
           +G+ +++  ++ +    +  +  ++ W  DV++  V +    +     G +Y DL  R G
Sbjct: 441 QGISDLFRDIYGISLKPVVAQAGET-WAPDVRKLQVIS----ETEGIIGLIYCDLLERPG 495

Query: 421 K---------------YGHAANFGMVSAYRKRDGSK-SYPVTILVTNFSKPTPTRP---A 461
           K               Y    +F  +      DGS+   PV  L+ NF      +     
Sbjct: 496 KTTSPSHFTVCCSRQIYPEENDFSTIQVGENPDGSRFQMPVISLICNFRATRHGKNKSLC 555

Query: 462 LLKLGELTTFFHELGHGIHDLVGSNDLESLNGPGSVPWDFVEAPSQMLEYWTARRDVLTM 521
           LL+L ++ T FHE+GH +H ++G   L++L+G   V  DFVE PS ++E++   R VL  
Sbjct: 556 LLELSDVETLFHEMGHALHSMLGRTQLQNLSGTRCVT-DFVELPSILMEHFAKDRRVLLR 614

Query: 522 LSKHYETGEKIPKSLLDAWFSVGGLNSGLANLGQLKLGLFDMYVHTRDYKGAEVRKLWND 581
           +S +Y TGE IP+ LL A+              Q+K+ + D  +H+   +  ++  +++ 
Sbjct: 615 ISSNYATGEPIPEELLSAFQEQNNFLKNTETFSQIKMSMLDQRLHSITDQD-DIIAVYHG 673

Query: 582 LTREIGLMNLKNYTSTGYDSFGHIMXXXXXXXXXXLWSQVFAADMYDTKFKPNPFNATVG 641
           L RE+ ++        G   FGH+           L  +  AA ++D  FK +PF+ + G
Sbjct: 674 LEREMEVLVDDQTNWCG--RFGHLF-GYGASYYSYLMDRAIAAKIWDHLFKKDPFSRSSG 730

Query: 642 VEYRDTILATGGLYD 656
            ++++ +L  GG  D
Sbjct: 731 EKFKEGVLKWGGSRD 745

>Smik_11.102 Chr11 complement(175013..177331) [2319 bp, 772 aa] {ON}
           YKL134C (REAL)
          Length = 772

 Score =  150 bits (380), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 154/644 (23%), Positives = 276/644 (42%), Gaps = 58/644 (9%)

Query: 51  NYIMPLIYHEEETDLLWNQLVFLRNVSPDPEIREASKNATSMLDDWIIGLTSKYDLYQHF 110
           +YIM L    +    + +   F+R+  P+ E  +A+++    + +++  L +   L    
Sbjct: 118 SYIMNLDRLSDTLCRVIDLCEFIRSTHPEDEFVKAAQDCHEQMFEFMNVLNTDVSLCNML 177

Query: 111 DEVWAQYXXXXXXXXXXXXLYRYMEKDADGYRRSGMKVPVENRKRLDEVKSKIAAAELEF 170
             V                + + +    D + +SG+ +    R++  ++  +I+    EF
Sbjct: 178 KSVLNNPEIAPKLSEEELKVGKIL---LDDFEKSGIYMNPGVREKFIQLSQEISLVGQEF 234

Query: 171 SSNL---GEEVEYIAFTKEELEGVPDTVLNQFEKIIEGGVEKFKV-TFKYPDIGPVLRLA 226
            +++   G     I     +   V   +L Q  K ++G  + +KV TF Y     +L+  
Sbjct: 235 INHIDYPGSNSVKIPCKDLDSSKVSTFLLKQLNKDVKG--QNYKVPTFGYAAFA-LLKSC 291

Query: 227 SNPETRRRASMADENRVAANXXXXXXXXXXXXXXADLLGFKNFAAYNLDDKMAKNEETVL 286
                R++   A  +                   A+L+   ++A Y L+ KMAKN + V 
Sbjct: 292 EIEVVRKKIWTALHSCSDKQIKRLDRLIKLRAVLANLMHKGSYAEYQLEGKMAKNPKDVQ 351

Query: 287 KFLNDLVEKLLPVGKNDLEILKKKKAEDYKSKNLTFDGEFYS----WDTGYYTNKILRER 342
            F+  L+   +    N+L+ +   KA+D K    T   E       WD  YYT K ++  
Sbjct: 352 DFILTLMNNTIDKTANELKFIADLKAKDLKKPLTTNTDEILKLVRPWDRDYYTGKYIQ-- 409

Query: 343 YNVNPD------DLAQYFPVESAIEGMLNIYTTLFRLKF-VEITDECEKSVWHEDVKQFA 395
             +NP       +++ YF + + I+G+ +++  ++ ++    I DE E   W  DV++  
Sbjct: 410 --LNPSNVPSAKEISYYFTLGNVIQGLSDLFQQIYGIRLEPAIADEGE--TWSPDVRRLN 465

Query: 396 VWNIDDEDNPKFQGWLYFDLHPRDGK---------------YGHAANFGMVSAYRKRDGS 440
           V  I +E+     G +Y DL  R+GK               Y H  +F  +      +GS
Sbjct: 466 V--ISEEEG--IIGIIYCDLFERNGKTSNPAHFTVCCSRQIYPHETDFSTIQVGENPNGS 521

Query: 441 K-SYPVTILVTNFSK-PTPTRPAL--LKLGELTTFFHELGHGIHDLVGSNDLESLNGPGS 496
               PV  LV NFS  P  ++ +L  L+L E+ T FHE+GH +H ++G   +++++G   
Sbjct: 522 YFQLPVISLVCNFSPVPIASKKSLCFLQLSEVETLFHEMGHAMHSMLGRTHMQNISGTRC 581

Query: 497 VPWDFVEAPSQMLEYWTARRDVLTMLSKHYETGEKIPKSLLDAWFSVGGLNSGLANLGQL 556
              DFVE PS ++E++     VLT + KHYETGE I K +L  +              Q 
Sbjct: 582 AT-DFVELPSILMEHFAKDIRVLTRIGKHYETGETIQKGMLQCFMKTTNFLQNCETYSQA 640

Query: 557 KLGLFDMYVH----TRDYKGAEVRKLWNDLTREIGLMNLKNYTSTGYDSFGHIMXXXXXX 612
           K+ + D   H      D     V   +  L R + +  L +  S     FGH+       
Sbjct: 641 KMAMLDQSFHDEKIMSDIDNFNVVDNYQALERHLKV--LVDDQSNWCGRFGHLF-GYGAT 697

Query: 613 XXXXLWSQVFAADMYDTKFKPNPFNATVGVEYRDTILATGGLYD 656
               L+ +  A+ ++ T F  +P++   G +++  +L  GGL D
Sbjct: 698 YYSYLFDRTIASKIWYTLFDDDPYSRNNGDKFKKHLLKWGGLKD 741

>Suva_11.91 Chr11 complement(175327..177654) [2328 bp, 775 aa] {ON}
           YKL134C (REAL)
          Length = 775

 Score =  149 bits (377), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 150/639 (23%), Positives = 279/639 (43%), Gaps = 50/639 (7%)

Query: 52  YIMPLIYHEEETDLLWNQLVFLRNVSPDPEIREASKNATSMLDDWIIGLTSKYDLYQHFD 111
           YIM L    +    + +   F+R+  PD    +A+++    + +++  L +   L     
Sbjct: 122 YIMNLDRLSDTLCRVIDLCEFIRSTHPDDAFVKAAQDCHEQMFEFMNVLNTDVSLCNMLK 181

Query: 112 EVWAQYXXXXXXXXXXXXLYRYMEKDADGYRRSGMKVPVENRKRLDEVKSKIAAAELEFS 171
            V                + + +    D + +SG+ +  + R++  ++  +I+    EF 
Sbjct: 182 TVLNSPKISSKLSEEELKVGKIL---LDDFEKSGIYMNPDVREKFIQLSQEISLVGQEFI 238

Query: 172 SNL---GEEVEYIAFTKEELEGVPDTVLNQFEKIIEGGVEKFKV-TFKYPDIGPVLRLAS 227
           ++    G     I+  + +   V   +L Q  K ++G  + +KV TF Y     +L+   
Sbjct: 239 NHTDYPGSNSVKISCRELDNSNVSAFLLKQLNKDVKG--QNYKVPTFGYAAYA-LLKSCE 295

Query: 228 NPETRRRASMADENRVAANXXXXXXXXXXXXXXADLLGFKNFAAYNLDDKMAKNEETVLK 287
             + R++   A  +                   ADL+   ++A Y L+ KMAKN + V  
Sbjct: 296 KEQVRKKIWTALHSCSDKQIKRLNHLIKLRANLADLMHKGSYAEYQLEGKMAKNPKDVQD 355

Query: 288 FLNDLVEKLLPVGKNDLEILKKKKAEDYKSKNLTFDGEFYS----WDTGYYTNKILRERY 343
           F+  L+   +     +L+ + + KA+D K    T   E       WD  YYT K L+   
Sbjct: 356 FILTLMNDTIDKTATELKFIAELKAKDLKKPLATKTDEILKLVRPWDRDYYTGKYLQLNP 415

Query: 344 NVNPD--DLAQYFPVESAIEGMLNIYTTLFRLKFV-EITDECEKSVWHEDVKQFAVWNID 400
           +  P   +++ YF + + I+G+ +++  ++ +K    I DE E   W  DV++  V  I 
Sbjct: 416 SNAPSAKEISSYFTLGNVIQGLSDLFQHIYGIKLEPAIADEGE--TWSPDVRRLNV--IS 471

Query: 401 DEDNPKFQGWLYFDLHPRDGKYGHAANFGMVSAYR---------------KRDGSK-SYP 444
           +E+     G +Y DL  R GK  + A+F +  + +                 DGS    P
Sbjct: 472 EEEG--IIGIIYCDLFERSGKTSNPAHFTVCCSRQIYPNETDFSTIQLGENADGSFFQLP 529

Query: 445 VTILVTNFSK-PTPTRPAL--LKLGELTTFFHELGHGIHDLVGSNDLESLNGPGSVPWDF 501
           V  LV NF+  P  ++ +L  L+L E+ T FHE+GH +H ++G   +++++G      DF
Sbjct: 530 VISLVCNFAPIPIASKKSLCFLQLSEVETLFHEMGHAMHSMLGRTHMQNISGTRCAT-DF 588

Query: 502 VEAPSQMLEYWTARRDVLTMLSKHYETGEKIPKSLLDAWFSVGGLNSGLANLGQLKLGLF 561
           VE PS ++E++     +LT + KHYETGE +   +L ++              Q K+ + 
Sbjct: 589 VELPSILMEHFAKDIRILTRIGKHYETGETVEPDMLQSFMRTTNFLQNCETYSQAKMAML 648

Query: 562 DMYVH----TRDYKGAEVRKLWNDLTREIGLMNLKNYTSTGYDSFGHIMXXXXXXXXXXL 617
           D   H      +    +V K +  L R + +  L +  S     FGH+           L
Sbjct: 649 DQSFHDEEVISNIDNYDVVKNYQALERRLKV--LVDDQSNWCGRFGHLF-GYGATYYSYL 705

Query: 618 WSQVFAADMYDTKFKPNPFNATVGVEYRDTILATGGLYD 656
           + +  A+ ++   F+ +P++   G +++  +L  GGL D
Sbjct: 706 FDRTIASKIWYALFEDDPYSRKNGDKFKKHLLKWGGLKD 744

>YKL134C Chr11 complement(189124..191442) [2319 bp, 772 aa] {ON}
           OCT1Mitochondrial intermediate peptidase, cleaves
           destabilizing N-terminal residues of a subset of
           proteins upon import, after their cleavage by
           mitochondrial processing peptidase (Mas1p-Mas2p); may
           contribute to mitochondrial iron homeostasis
          Length = 772

 Score =  145 bits (366), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 148/639 (23%), Positives = 274/639 (42%), Gaps = 50/639 (7%)

Query: 52  YIMPLIYHEEETDLLWNQLVFLRNVSPDPEIREASKNATSMLDDWIIGLTSKYDLYQHFD 111
           YIM L    +    + +   F+R+  PD     A+++    + +++  L +   L     
Sbjct: 119 YIMNLDRLSDTLCRVIDLCEFIRSTHPDDAFVRAAQDCHEQMFEFMNVLNTDVSLCNILK 178

Query: 112 EVWAQYXXXXXXXXXXXXLYRYMEKDADGYRRSGMKVPVENRKRLDEVKSKIAAAELEFS 171
            V                + + +    D + +SG+ +  + R++  ++  +I+    EF 
Sbjct: 179 SVLNNPEVSSKLSAEELKVGKIL---LDDFEKSGIYMNPDVREKFIQLSQEISLVGQEFI 235

Query: 172 SNL---GEEVEYIAFTKEELEGVPDTVLNQFEKIIEGGVEKFKV-TFKYPDIGPVLRLAS 227
           ++    G     I     +   V   +L Q  K ++G  + +KV TF Y     +L+   
Sbjct: 236 NHTDYPGSNSVKIPCKDLDNSKVSTFLLKQLNKDVKG--QNYKVPTFGYAAYA-LLKSCE 292

Query: 228 NPETRRRASMADENRVAANXXXXXXXXXXXXXXADLLGFKNFAAYNLDDKMAKNEETVLK 287
           N   R++   A  +                   A+L+   ++A Y L+ KMAKN + V  
Sbjct: 293 NEMVRKKLWTALHSCSDKQVKRLSHLIKLRAILANLMHKTSYAEYQLEGKMAKNPKDVQD 352

Query: 288 FLNDLVEKLLPVGKNDLEILKKKKAEDYKSKNLTFDGEFYS----WDTGYYTNKILRERY 343
           F+  L+   +    N+L+ + + KA+D K    T   E       WD  YYT K  +   
Sbjct: 353 FILTLMNNTIEKTANELKFIAELKAKDLKKPLTTNTDEILKLVRPWDRDYYTGKYFQLNP 412

Query: 344 NVNPD--DLAQYFPVESAIEGMLNIYTTLFRLKF-VEITDECEKSVWHEDVKQFAVWNID 400
           + +P+  +++ YF + + I+G+ +++  ++ ++    ITDE E   W  DV++  V  I 
Sbjct: 413 SNSPNAKEISYYFTLGNVIQGLSDLFQQIYGIRLEPAITDEGE--TWSPDVRRLNV--IS 468

Query: 401 DEDNPKFQGWLYFDLHPRDGKYGHAANFGMVSAYR---------------KRDGSK-SYP 444
           +E+     G +Y DL  R+GK  + A+F +  + +                 DG+    P
Sbjct: 469 EEEG--IIGIIYCDLFERNGKTSNPAHFTVCCSRQIYPSETDFSTIQVGENPDGTYFQLP 526

Query: 445 VTILVTNFSK---PTPTRPALLKLGELTTFFHELGHGIHDLVGSNDLESLNGPGSVPWDF 501
           V  LV NFS     +      L+L E+ T FHE+GH +H ++G   +++++G      DF
Sbjct: 527 VISLVCNFSPILIASKKSLCFLQLSEVETLFHEMGHAMHSMLGRTHMQNISGTRCAT-DF 585

Query: 502 VEAPSQMLEYWTARRDVLTMLSKHYETGEKIPKSLLDAWFSVGGLNSGLANLGQLKLGLF 561
           VE PS ++E++     +LT + KHY TGE I   +L  +              Q K+ + 
Sbjct: 586 VELPSILMEHFAKDIRILTKIGKHYGTGETIQADMLQRFMKSTNFLQNCETYSQAKMAML 645

Query: 562 DMYVH----TRDYKGAEVRKLWNDLTREIGLMNLKNYTSTGYDSFGHIMXXXXXXXXXXL 617
           D   H      D    +V + +  L R + +  L +  S     FGH+           L
Sbjct: 646 DQSFHDEKIISDIDNFDVVENYQALERRLKV--LVDDQSNWCGRFGHLF-GYGATYYSYL 702

Query: 618 WSQVFAADMYDTKFKPNPFNATVGVEYRDTILATGGLYD 656
           + +  A+ ++   F+ +P++   G +++  +L  GGL D
Sbjct: 703 FDRTIASKIWYALFEDDPYSRKNGDKFKKHLLKWGGLKD 741

>KLLA0B12397g Chr2 complement(1084129..1086468) [2340 bp, 779 aa]
           {ON} similar to uniprot|P35999 Saccharomyces cerevisiae
           YKL134C OCT1 Mitochondrial intermediate peptidase
           cleaves N-terminal residues of a subset of proteins upon
           import after their cleavage by mitochondrial processing
           peptidase (Mas1p-Mas2p) may contribute to mitochondrial
           iron homeostasis
          Length = 779

 Score =  144 bits (364), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 141/554 (25%), Positives = 248/554 (44%), Gaps = 51/554 (9%)

Query: 141 YRRSGMKVPVENRKRLDEVKSKIAAAELEFSSNLGEEVE--YIAFTKEELEG-VPDTVLN 197
           + +SG+ +  E R++  ++  +I+    +F +N  E V   YI  + E ++  V   V +
Sbjct: 207 FEKSGIYMKPEIREKFIQLSQEISVIGQDFINNT-EYVRSNYIKISCELMDAHVNKMVCS 265

Query: 198 QFEKIIEGGVEKFKV-TFKYPDIGPVLRLASNPETRRRASMADENRVAANXXXXXXXXXX 256
           Q +K I G  E +KV T+ Y     +LR  S+   R +      +   A           
Sbjct: 266 QMKKDITG--EYYKVPTYGYIP-HTLLRTCSDEVIRMKIWTEMHSCSDAQIERLTKLISL 322

Query: 257 XXXXADLLGFKNFAAYNLDDKMAKNEETVLKFLNDLVEKLLPVGKNDLEILKKKKAEDYK 316
               A LLG +NFA Y L  KMAK  E V  FL  LV        ++L+ L   K+E   
Sbjct: 323 RVELAKLLGSQNFAQYQLHGKMAKTPENVSGFLESLVHSTRIKAASELKPLAVLKSELTG 382

Query: 317 SKNLTFDGEFYS----WDTGYYTN-KILRERYNV---NPDDLAQYFPVESAIEGMLNIYT 368
           ++      E       WD  YY + + L +R +    N + ++  F +   ++G+ +++ 
Sbjct: 383 TQTPHTSEEVLELMKPWDRDYYGSIQALAQRRSSSLDNGESISSSFSLGVVMQGLSDLFE 442

Query: 369 TLFRLKFVEITDECEKSVWHEDVKQFAVWNIDDEDNPKFQGWLYFDLHPRDGKYGHAANF 428
            ++ +K V  T +  ++ W  DV++  V  +D+ D     G +Y DL  R+GK  + A+F
Sbjct: 443 KIYGIKLVPATPKTGET-WSPDVRRIDV--VDEHDG--LIGVMYCDLFEREGKTPNPAHF 497

Query: 429 GMVSAYR---------------KRDGSK-SYPVTILVTNF-------SKPTPTRPALLKL 465
            +  +                   +G K   PV  LV +F             +  LL+L
Sbjct: 498 TVCCSRNMYLNEADTSTIQVGVNSNGQKFQLPVISLVCDFRWVEVNMGDGKHQQMCLLQL 557

Query: 466 GELTTFFHELGHGIHDLVGSNDLESLNGPGSVPWDFVEAPSQMLEYWTARRDVLTMLSKH 525
            E+ T FHE+GH +H ++G   L++++G      DFVE PS ++E++     VL+ +S H
Sbjct: 558 NEIETLFHEMGHAMHSMLGRTQLQNVSGTRCAT-DFVELPSILMEHFARDTRVLSSISSH 616

Query: 526 YETGEKIPKSLLDAWFSVGGLNSGLANLGQLKLGLFDMYVHTRDYK---GAEVRKLWNDL 582
           Y+TG+ +   +L                 Q+K+   D  +H  D+      +V  +++ L
Sbjct: 617 YKTGKSLDVEVLKNHQLENQFLQNCETFSQIKMSFLDQELHNLDHTTDGSIDVIAIYHRL 676

Query: 583 TREIGLMNLKNYTSTGYDSFGHIMXXXXXXXXXXLWSQVFAADMYDTKFKPNPFNATVGV 642
            R + +  L +  S     FGH+           L+ +  A+ ++D  F+ +PFN T G 
Sbjct: 677 ERRLAV--LPDDQSNWCGKFGHLF-GYGASYYSYLFDRAIASKIWDHLFEQDPFNRTNGT 733

Query: 643 EYRDTILATGGLYD 656
           ++++ +L  GG  D
Sbjct: 734 KFKEGLLQWGGSRD 747

>Kwal_26.7616 s26 (444266..446578) [2313 bp, 770 aa] {ON} YKL134C
           (OCT1) - 1:1 [contig 55] FULL
          Length = 770

 Score =  141 bits (356), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 137/635 (21%), Positives = 272/635 (42%), Gaps = 57/635 (8%)

Query: 72  FLRNVSPDPEIREASKNATSMLDDWIIGLTSKYDLYQHFDEVWAQYXXXXXXXXXXXXLY 131
           F+R   PDP   +A++     + +++  L +   L +    V                + 
Sbjct: 139 FIRASHPDPSFVQAAQLCHEEMFEFMNVLNTDKTLCEVLKHVLRTESIVQELSDEEIRVG 198

Query: 132 RYMEKDADGYRRSGMKVPVENRKRLDEVKSKIAAAELEFSSNLG-EEVEYIAFTKEELE- 189
             + +D   + +SG+ +  +  ++   +  +I+    EF +N      +Y+    +EL+ 
Sbjct: 199 NILLED---FEKSGIDMEPKVGEQFINISQQISIVGQEFINNTDFPRSDYVKIPCKELDS 255

Query: 190 -GVPDTVLNQFEKIIEGGVEKFKVTFKYPDIG----PVLRLASNPETRRRASMADENRVA 244
            GV   +LNQ  + ++         +K P  G     +LR   N   R +   A  +   
Sbjct: 256 SGVSTLLLNQLSRDLKNQ------NYKVPAYGYAAFSILRSCPNENVRMKIWTAMHSCPE 309

Query: 245 ANXXXXXXXXXXXXXXADLLGFKNFAAYNLDDKMAKNEETVLKFLNDLVEKLLPVGKNDL 304
                           A ++G K++A Y L  KMAK+   V  F+  LV+   P+   +L
Sbjct: 310 KQISRLKQLVMLRGLLASIMGKKSYAEYQLSGKMAKSPVYVRGFVQSLVDVTKPLAAEEL 369

Query: 305 EILKKKKAEDYKSKNLTFDGEFYS----WDTGYYT--NKILRERYNVNPDDLAQYFPVES 358
            +L K K+          D +       WD  +Y+  N + ++R  +  + ++ YF + +
Sbjct: 370 RVLAKLKSGHLGVNVPQSDADVLRFVRPWDRDFYSTLNALQQQRKTLENEHISSYFSLGT 429

Query: 359 AIEGMLNIYTTLFRLKFVEITDECEKSVWHEDVKQFAVWNIDDEDNPKFQGWLYFDLHPR 418
            ++G+  ++  ++ ++   +  +  ++ W  +V++  V +    +     G +Y DL  R
Sbjct: 430 VMQGLSRLFEDIYGIRLEPVVAKAGET-WSPEVRRINVVS----EKEGIIGVVYCDLFER 484

Query: 419 DGKYGHAANFGMVSAYRKRDGSK----------------SYPVTILVTNFSKPTPTRP-- 460
            GK  + A+F +  +     G                    PV  LV +F++ + +R   
Sbjct: 485 QGKTSNPAHFTVCCSRTIYPGETDLSTIQVGQLPSGEKFQLPVISLVCSFAQNSASRQGV 544

Query: 461 ALLKLGELTTFFHELGHGIHDLVGSNDLESLNGPGSVPWDFVEAPSQMLEYWTARRDVLT 520
            LL+L ++ T FHE+GH +H ++G   L++++G      DFVE PS ++E++     VL+
Sbjct: 545 CLLQLSDVDTLFHEMGHAMHSMLGRTSLQNISGT-RCATDFVELPSILMEHFARDSRVLS 603

Query: 521 MLSKHYETGEKIPKSLLDAWFSVGGLNSGLANLGQLKLGLFDMYVHTRDY---KGAEVRK 577
            + +HY T + IP  LL    +            Q K+ + D  +H+         +V K
Sbjct: 604 RIGRHYATDQPIPTELLKLNQTEMNYLQHTETFSQAKMAMLDQELHSSKALTDGKLDVVK 663

Query: 578 LWNDLTREIGLMNLKNYTSTGYDSFGHIMXXXXXXXXXXLWSQVFAADMYDTKFKPNPFN 637
           L++ + +++ +  L +  S     FGH++          L+ +  A+ ++   F  +PFN
Sbjct: 664 LYHGVEKDMEV--LADDQSNWCGRFGHLL-GYGASYYSYLFDRAIASKIWQHLFAEDPFN 720

Query: 638 ATVGVEYRDTILATGGLYD----MTDNL-RKFLGR 667
              G ++++++L  GG  D    + D L RK L R
Sbjct: 721 RENGEKFKESVLKWGGSKDPWECVADALDRKELAR 755

>NCAS0A04280 Chr1 complement(864327..866648) [2322 bp, 773 aa] {ON}
           Anc_2.432
          Length = 773

 Score =  140 bits (353), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 141/623 (22%), Positives = 269/623 (43%), Gaps = 58/623 (9%)

Query: 72  FLRNVSPDPEIREASKNATSMLDDWIIGLTSKYDLYQHFDEVWAQYXXXXXXXXXXXXLY 131
           F+R+  PD    +A+++    + +++  L +   L      V                + 
Sbjct: 140 FIRSTHPDEAFVKAAQDCHEQMFEFMNVLNTDVVLCDILKHVLNDPNINSKLTPEEIKVG 199

Query: 132 RYMEKDADGYRRSGMKVPVENRKRLDEVKSKIAAAELEFSSNLGE-EVEYIAFTKEEL-- 188
           + + +D   + +SG+ +    RK+   +  +I+    +F +N+   +  ++     EL  
Sbjct: 200 KLLLED---FEKSGIYMDPNIRKQFISLSQEISLTGQDFINNIDLIKSNHVKIKCSELNK 256

Query: 189 EGVPDTVLNQFEKIIEGGVEKFKVTFKYPDIG--PVLRLASNPETRRRASMADENRVAAN 246
            GV   +L Q  K I G        +K P  G  P+  + S P+   RA +        N
Sbjct: 257 SGVNSLLLKQLPKDITGKY------YKIPTSGYIPISLIRSCPDATIRAKVWASLHSCPN 310

Query: 247 XXXXXXX--XXXXXXXADLLGFKNFAAYNLDDKMAKNEETVLKFLNDLVEKLLPVGKNDL 304
                           A LL   +FA Y L+ KMAK  + V  F+  L++ + P    +L
Sbjct: 311 DQIRRLTHLVKLRAILAHLLNKCSFAKYQLEGKMAKTPQNVRDFIKTLMDYMRPKAAQEL 370

Query: 305 EILKKKKAEDYK---SKNLTFDGEFYS-WDTGYYTNKILRER----YNVNPDDLAQYFPV 356
           + +   K ++     S + T   +  S WD  YYT    + +    Y  +P ++  YF +
Sbjct: 371 KFMADLKCKELNIPTSDSTTAILDLISPWDREYYTTIHSKAKDVNLYENHPINM--YFTM 428

Query: 357 ESAIEGMLNIYTTLFRLKFVEITDECEKSVWHEDVKQFAVWNIDDEDNPKFQGWLYFDLH 416
            + ++G+ +I+  ++ ++   +  E E   W  +V++  V +    +     G +Y DL 
Sbjct: 429 GNIMKGLSHIFQRIYGIRLEAVVPE-EGETWSPEVRRLNVIS----ETEGLIGVVYCDLF 483

Query: 417 PRDGKYGHAANFGMVSAYR---------------KRDGSK-SYPVTILVTNFSKPTPTRP 460
            R GK  + A+F +  + +                 DG+    PV  LV NFS    +  
Sbjct: 484 ERAGKTSNPAHFTVCCSRQIYPDENDLSTIQIGTNPDGTAFQLPVISLVCNFSSTLTSND 543

Query: 461 ---ALLKLGELTTFFHELGHGIHDLVGSNDLESLNGPGSVPWDFVEAPSQMLEYWTARRD 517
               LL+L E+ T FHE+GH +H ++G + L++++G      DFVE PS ++E++   + 
Sbjct: 544 KMICLLQLNEIETLFHEMGHAMHSMLGRSRLQNVSGTRCAT-DFVELPSILMEHFARDKR 602

Query: 518 VLTMLSKHYETGEKIPKSLLDAWFSVGGLNSGLANLGQLKLGLFDMYVHT----RDYKGA 573
           VL  +  HYET E++ + +++A               Q K+ + D  +++    +D    
Sbjct: 603 VLHEIGFHYETNERVSEYVIEAHLKKMKFLQDCETFSQGKMAMLDQELYSENIIKDLDHV 662

Query: 574 EVRKLWNDLTREIGLMNLKNYTSTGYDSFGHIMXXXXXXXXXXLWSQVFAADMYDTKFKP 633
           +V K++  L  ++ +  L +  S     FGH+           L+ +  A+ ++D  F  
Sbjct: 663 DVVKIYQTLEEDLKV--LVDNKSNWCGKFGHLF-GYGASYYSYLFDRAIASKVWDQLFAK 719

Query: 634 NPFNATVGVEYRDTILATGGLYD 656
           +PF+   G ++++ +L  GGL D
Sbjct: 720 DPFSREGGEKFKNCVLKWGGLRD 742

>TDEL0A02080 Chr1 complement(373425..375788) [2364 bp, 787 aa] {ON}
           Anc_2.432 YKL134C
          Length = 787

 Score =  139 bits (349), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 137/620 (22%), Positives = 267/620 (43%), Gaps = 56/620 (9%)

Query: 72  FLRNVSPDPEIREASKNATSMLDDWIIGLTSKYDLYQHFDEVWAQYXXXXXXXXXXXXLY 131
           F+R+  PD    EA++     + +++  L +  +L     +V                + 
Sbjct: 152 FIRSSHPDSSFIEAAQACHEEMFEFMNILNTDVELCDTLRQVLTDPEIKGKLSNEEITVG 211

Query: 132 RYMEKDADGYRRSGMKVPVENRKRLDEVKSKIAAAELEFSSNLG-EEVEYIAFTKEELE- 189
           + + +D   + +SG+ +  E R +   +  +I+    EF +N       YI    EE++ 
Sbjct: 212 KILLED---FEKSGIYMNPEVRDQFIALSQEISLVGQEFINNTDYVRSNYIKIKCEEVDN 268

Query: 190 -GVPDTVLNQFEKIIEGGVEKFKVTFKYPDIG----PVLRLASNPETRRRASMADENRVA 244
            G+   +++Q  K + G        +K P  G     +LR   + E R     A      
Sbjct: 269 SGINKLLISQLPKDVRGKY------YKIPTHGYIAYSILRSCPDEEIRMNLWTAMHRCSD 322

Query: 245 ANXXXXXXXXXXXXXXADLLGFKNFAAYNLDDKMAKNEETVLKFLNDLVEKLLPVGKNDL 304
                           A L+G ++FA Y L+ KMA+  + V  F+  LV  + P    +L
Sbjct: 323 KQINRLDQLLRLRAILAKLMGKESFAQYQLEGKMAQTPQQVRDFIGTLVNYMRPKTIEEL 382

Query: 305 EILKKKKAEDYKSKNLTFDGE------FYSWDTGYYTN--KILRERYNVNPDDLAQYFPV 356
           + + + K++  K +      E         WD  YYT+   + + R  ++ + ++ YF +
Sbjct: 383 KFIYELKSKQEKREIQPSPSEQDIASMVRPWDREYYTSMYSLQQRRDAIDDEQISSYFTL 442

Query: 357 ESAIEGMLNIYTTLFRLKFVEITDECEKSVWHEDVKQFAVWNIDDEDNPKFQGWLYFDLH 416
            + I+G+ +++ +++ ++   +  +  ++ +  +V++  V      +     G +Y DL 
Sbjct: 443 GNVIQGLSDLFESIYGIRLEPVVPKTGET-FSPEVRRLNVVC----EQEGVIGVVYCDLF 497

Query: 417 PRDGKYGHAANFGMVSA---YRK-------RDGSKS------YPVTILVTNFSKPTPTRP 460
            R GK  + ++F +  +   Y K       + G  S       PV  LV NFS  T +  
Sbjct: 498 ERAGKTSNPSHFTVCCSRQIYPKETEFSTIQTGFNSEGLMFQLPVIALVCNFSSSTDSEG 557

Query: 461 ---ALLKLGELTTFFHELGHGIHDLVGSNDLESLNGPGSVPWDFVEAPSQMLEYWTARRD 517
               LL+L E+ T FHE+GH +H ++G   L++++G      DFVE PS ++E++     
Sbjct: 558 KSICLLQLNEVETLFHEMGHAMHSMLGRTRLQNISGT-RCATDFVELPSILMEHFARDVR 616

Query: 518 VLTMLSKHYETGEKIPKSLLDAWFSVGGLNSGLANLGQLKLGLFDMYVH----TRDYKGA 573
           VL  + KH+ TG  I + LL  +              Q K+ + D  +H     +D+   
Sbjct: 617 VLERIGKHHRTGAPISEKLLLNYLEETKFMQHCETFSQAKMAMLDQDLHGEKVIKDFDHF 676

Query: 574 EVRKLWNDLTREIGLMNLKNYTSTGYDSFGHIMXXXXXXXXXXLWSQVFAADMYDTKFKP 633
           +V   +  L R++ +  L +  S     FGH+           L+ +  A+ ++D+ F  
Sbjct: 677 DVTAAYQQLERDMKV--LVDDKSNWCGKFGHLF-GYGATYYSYLFDRAIASKVWDSLFSS 733

Query: 634 NPFNATVGVEYRDTILATGG 653
           +P++   G ++++ +L  GG
Sbjct: 734 DPYSRVNGEKFKECVLKWGG 753

>TBLA0I00710 Chr9 (128272..130593) [2322 bp, 773 aa] {ON} Anc_2.432
           YKL134C
          Length = 773

 Score =  137 bits (345), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 139/636 (21%), Positives = 267/636 (41%), Gaps = 45/636 (7%)

Query: 51  NYIMPLIYHEEETDLLWNQLVFLRNVSPDPEIREASKNATSMLDDWIIGLTSKYDLYQHF 110
           NYI+ L    +    + +   F+R+  P+    +A++     +  ++  L +   L    
Sbjct: 122 NYIIRLDQLSDTLCRVIDLCEFIRSCHPEKSFVQAAQECHEHMYAFMNTLNTDIALCDRL 181

Query: 111 DEVWAQYXXXXXXXXXXXXLYRYMEKDADGYRRSGMKVPVENRKRLDEVKSKIAAAELEF 170
             V                + + + +D   + +SG+++  E R R   +   I+ A  +F
Sbjct: 182 RTVLDNKEVLKRLTDEEIKVGKLLLED---FEKSGIQMSPEIRDRFISLSQDISLAGQDF 238

Query: 171 SSNLG-EEVEYIAFTKEELEGVPD--TVLNQFEKIIEGGVEKFKVTFKYPDIGPVLRLAS 227
            +N    E +YI    +E +   D   +  +  K + G   K     K P     L    
Sbjct: 239 LNNTSYTEKDYIKIKCDEFDKACDYPALKYKLSKDLSGKYYKIPTYGKIPYTA--LLKCK 296

Query: 228 NPETRRRASMADENRVAANXXXXXXXXXXXXXXADLLGFKNFAAYNLDDKMAKNEETVLK 287
           + E R++  +A  +                   A LL   +++ Y L+ KMAK  + V  
Sbjct: 297 DEELRKKLWVAFHSCSNKQIERLTKIIKHRIELAKLLSKSSYSEYTLEGKMAKGPKEVNN 356

Query: 288 FLNDLVEKLLPVGKNDLEILKKKKA--EDY--KSKNLTFDGEFYSWDTGYYTNKILRERY 343
           FLN L++ +LP    +LE +  KK   E +  ++   +       WD  YY N I     
Sbjct: 357 FLNALLKSILPEVTKELEPISNKKCLSEGFSLETSEQSILNNIKPWDRDYY-NPIQATSE 415

Query: 344 NVNPDDLAQYFPVESAIEGMLNIYTTLFRLKFVEITDECEKSVWHEDVKQFAVWNIDDED 403
                 + +YF + + I G+ N++ +++ ++F     E +   W +DV++  V + D+  
Sbjct: 416 GAYQMLIMEYFTLGNIIHGLSNLFNSIYGIRFEPGKIE-DGETWSKDVRKLNVISEDE-- 472

Query: 404 NPKFQGWLYFDLHPRDGKYGHAANFGMVSAYR-----------------KRDGSKSYPVT 446
                G +Y DL  R+GK    +++ +  +                   K   +   P+ 
Sbjct: 473 --GLIGVIYCDLFEREGKSESPSHYTICCSREIYSEEHDLSTIQTGVNNKTGKNFQLPIV 530

Query: 447 ILVTNF---SKPTPTRPALLKLGELTTFFHELGHGIHDLVGSNDLESLNGPGSVPWDFVE 503
            LV NF   +     R   L+  E+ T FHE+GH +H ++G    ++++G   V  DFVE
Sbjct: 531 SLVCNFQVTNAKESRRICFLQHHEIETLFHEMGHAMHSMLGRTRFQTISGTRCVS-DFVE 589

Query: 504 APSQMLEYWTARRDVLTMLSKHYETGEKIPKSLLDAWFSVGGLNSGLANLGQLKLGLFDM 563
            PS ++E++     VL  +S+HY++GE I   +L+ +              Q K+ L D 
Sbjct: 590 IPSILMEFFANNPKVLIDISRHYDSGESIDIEVLNKYLENTKQFKACETYSQGKMALLDQ 649

Query: 564 YVHTRDYKG---AEVRKLWNDLTREIGLMNLKNYTSTGYDSFGHIMXXXXXXXXXXLWSQ 620
            +H  +       +V +++++L +E+ +  L +  S     FGH +          L+ +
Sbjct: 650 RLHAENANSLDNIDVVEIYHNLEKELSV--LPDTESNWCGRFGH-LYGYGALYYCYLFDR 706

Query: 621 VFAADMYDTKFKPNPFNATVGVEYRDTILATGGLYD 656
             A  ++++ F+ +PF+   G  +++ +L  GG  D
Sbjct: 707 AIATKIWESLFQNDPFSRKGGNIFKEQLLKWGGSKD 742

>KLTH0D04730g Chr4 (432572..434890) [2319 bp, 772 aa] {ON} similar
           to uniprot|P35999 Saccharomyces cerevisiae YKL134C OCT1
           Mitochondrial intermediate peptidase cleaves N-terminal
           residues of a subset of proteins upon import after their
           cleavage by mitochondrial processing peptidase
           (Mas1p-Mas2p) may contribute to mitochondrial iron
           homeostasis
          Length = 772

 Score =  135 bits (341), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 134/617 (21%), Positives = 269/617 (43%), Gaps = 47/617 (7%)

Query: 72  FLRNVSPDPEIREASKNATSMLDDWIIGLTSKYDLYQHFDEVWAQYXXXXXXXXXXXXLY 131
           F+R   PD +   A++     + +++  L +   L +    V +              + 
Sbjct: 140 FIRASHPDSQFVRAAQLCHEEMFEFMNVLNTDSTLCEILKRVLSDDLIASKLSEEELKVG 199

Query: 132 RYMEKDADGYRRSGMKVPVENRKRLDEVKSKIAAAELEFSSNLG-EEVEYIAFTKEELE- 189
           + + +D   + +SG+ +  E  ++   +  +I+    EF SN    + EY+  +  ELE 
Sbjct: 200 KILLED---FEKSGIDMAPEVGEQFINLSQQISIVGQEFISNTDFPKSEYVKVSCNELET 256

Query: 190 -GVPDTVLNQFEKIIEGGVEKFKV-TFKYPDIGPVLRLASNPETRRRASMADENRVAANX 247
            G+   +LN   +  +G  + +KV T+ Y     +LR   +   R +   A  +      
Sbjct: 257 SGISPLLLNHLSRDTKG--QNYKVPTYGYIAFS-ILRSCPSENIRMKVWTAVHSCPEKQI 313

Query: 248 XXXXXXXXXXXXXADLLGFKNFAAYNLDDKMAKNEETVLKFLNDLVEKLLPVGKNDLEIL 307
                        A ++G  +++ Y L+ KMAK+   V  F+  L E + P+   +L  L
Sbjct: 314 TRLKHLVKLRGLLAQIMGKNSYSDYQLEGKMAKSPVYVRGFVESLAEAIKPLAMRELRAL 373

Query: 308 KKKKAEDYKSKNLTFDGEFYS----WDTGYYTNKI--LRERYNVNPDDLAQYFPVESAIE 361
              K+          D E       WD  +Y+  I   ++R  +  + +  YF + + ++
Sbjct: 374 ANLKSSHLDLPIPKTDEEVLKFVRPWDRDFYSTLISLQQQRKTLENEQINSYFSLGTVMQ 433

Query: 362 GMLNIYTTLFRLKFVEITDECEKSVWHEDVKQFAVWNIDDEDNPKFQGWLYFDLHPRDGK 421
           G+ ++   ++ ++      +  ++ W  +V++  V +    D     G +Y DL  R GK
Sbjct: 434 GLSSLLEDIYGIRLEPAVAKVGET-WSPEVRRINVVS----DQEGVIGVVYCDLFERQGK 488

Query: 422 YGHAANFGMVSAYR----KRDGSK-------------SYPVTILVTNFSKPTPTRP--AL 462
             + A+F +  + +    + D S                PV  LV +FS+ + ++    L
Sbjct: 489 TSNPAHFTVCCSRQIYPEETDLSTIQVGQQPSSGQIFQLPVISLVCSFSQNSGSKKDVCL 548

Query: 463 LKLGELTTFFHELGHGIHDLVGSNDLESLNGPGSVPWDFVEAPSQMLEYWTARRDVLTML 522
           L+L E+ T FHE+GH IH ++G   L++++G      DFVE PS ++E++     VL+ +
Sbjct: 549 LQLSEVDTLFHEMGHAIHSMLGRTSLQNISGT-RCATDFVELPSILMEHFAHDSRVLSRI 607

Query: 523 SKHYETGEKIPKSLLDAWFSVGGLNSGLANLGQLKLGLFDMYVHTRDY---KGAEVRKLW 579
            KHY T E +P  LL    +            Q K+ + D  +H+         +V +++
Sbjct: 608 GKHYITNEPVPDELLHLNQNELKYLQNTETFSQAKMAMLDQEMHSPRMLTDGPVDVVEIY 667

Query: 580 NDLTREIGLMNLKNYTSTGYDSFGHIMXXXXXXXXXXLWSQVFAADMYDTKFKPNPFNAT 639
           +++ +++G+  L +  S     FGH++          L+ +  A+ ++   F  +PF+  
Sbjct: 668 HEVEKQMGV--LTDDKSNWCGRFGHLL-GYGASYYSYLFDRAIASKVWQHLFANDPFSRK 724

Query: 640 VGVEYRDTILATGGLYD 656
            G ++++++L  GG  D
Sbjct: 725 SGEKFKNSVLRWGGSRD 741

>Suva_11.123 Chr11 (235064..239644) [4581 bp, 1526 aa] {ON} YKL101W
            (REAL)
          Length = 1526

 Score = 32.3 bits (72), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 18/61 (29%), Positives = 32/61 (52%)

Query: 266  FKNFAAYNLDDKMAKNEETVLKFLNDLVEKLLPVGKNDLEILKKKKAEDYKSKNLTFDGE 325
            F+NF+++N   K++KN ET + F    +  L    KN ++   K     +  KN+ +D +
Sbjct: 1411 FQNFSSHNSGAKLSKNHETKISFDEAHILTLNEFNKNSIDYQLKNLDHKFGKKNVEYDCK 1470

Query: 326  F 326
            F
Sbjct: 1471 F 1471

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.136    0.409 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 75,689,968
Number of extensions: 3468152
Number of successful extensions: 9777
Number of sequences better than 10.0: 48
Number of HSP's gapped: 9896
Number of HSP's successfully gapped: 48
Length of query: 683
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 567
Effective length of database: 40,180,143
Effective search space: 22782141081
Effective search space used: 22782141081
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 69 (31.2 bits)