Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
AGR405Cna 1ON71771736530.0
AGR406C1.9ON68367924300.0
SAKL0C00550g1.9ON73268017790.0
Ecym_1011na 1ON71667917500.0
Kpol_2002.121.9ON73968417080.0
ZYRO0F18392g1.9ON72568016840.0
KLLA0C00572g1.9ON71267716770.0
NDAI0A001801.9ON74068116630.0
NCAS0B090701.9ON73068016430.0
KNAG0C002601.9ON74468516310.0
Suva_3.1561.9ON71267716160.0
KAFR0D001801.9ON72368616080.0
TPHA0E039701.9ON74769016060.0
Smik_3.181.9ON71268116020.0
Skud_3.71.9ON71268315950.0
TBLA0A075601.9ON74168815950.0
YCL057W (PRD1)1.9ON71268115890.0
CAGL0B00418g1.9ON74368315820.0
ABR185WsingletonON4574149691e-123
Kpol_297.82.432ON7876464972e-52
KAFR0D029502.432ON7776284646e-48
ZYRO0G20130g2.432ON7866754611e-47
TPHA0G023902.432ON7956274602e-47
SAKL0E03938g2.432ON7676494565e-47
KNAG0A062002.432ON7894974532e-46
CAGL0D02112g2.432ON7616214503e-46
Skud_11.932.432ON7726274479e-46
Suva_11.912.432ON7756264415e-45
Ecym_60992.432ON7736734362e-44
NDAI0E020102.432ON7786234301e-43
Kwal_26.76162.432ON7706704273e-43
Smik_11.1022.432ON7726564071e-40
AFR198W2.432ON7766424043e-40
KLTH0D04730g2.432ON7725044034e-40
YKL134C (OCT1)2.432ON7725024016e-40
TBLA0I007102.432ON7735043991e-39
TDEL0A020802.432ON7876333991e-39
KLLA0B12397g2.432ON7795023858e-38
NCAS0A042802.432ON7736333794e-37
CAGL0C02585g4.259ON77163840.22
YLR397C (AFG2)4.259ON78063830.25
Smik_12.4844.259ON78063830.28
KNAG0B061604.259ON77263820.38
Skud_12.4824.259ON77763800.61
Suva_10.5144.259ON78063771.3
AAR080Wna 2ON57149761.4
KAFR0D009908.38ON47135708.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AGR405C
         (717 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AGR405C Chr7 complement(1469769..1471922) [2154 bp, 717 aa] {ON}...  1411   0.0  
AGR406C Chr7 complement(1472496..1474547) [2052 bp, 683 aa] {ON}...   940   0.0  
SAKL0C00550g Chr3 (48410..50608) [2199 bp, 732 aa] {ON} highly s...   689   0.0  
Ecym_1011 Chr1 (19924..22074) [2151 bp, 716 aa] {ON} similar to ...   678   0.0  
Kpol_2002.12 s2002 (21544..23763) [2220 bp, 739 aa] {ON} (21544....   662   0.0  
ZYRO0F18392g Chr6 complement(1518902..1521079) [2178 bp, 725 aa]...   653   0.0  
KLLA0C00572g Chr3 (42069..44207) [2139 bp, 712 aa] {ON} similar ...   650   0.0  
NDAI0A00180 Chr1 (14692..16914) [2223 bp, 740 aa] {ON} Anc_1.9        645   0.0  
NCAS0B09070 Chr2 complement(1741718..1743910) [2193 bp, 730 aa] ...   637   0.0  
KNAG0C00260 Chr3 (39428..41662) [2235 bp, 744 aa] {ON} Anc_1.9 Y...   632   0.0  
Suva_3.156 Chr3 (234520..236658) [2139 bp, 712 aa] {ON} YCL057W ...   627   0.0  
KAFR0D00180 Chr4 (18900..21071) [2172 bp, 723 aa] {ON} Anc_1.9 Y...   624   0.0  
TPHA0E03970 Chr5 complement(834023..836266) [2244 bp, 747 aa] {O...   623   0.0  
Smik_3.18 Chr3 (26213..28351) [2139 bp, 712 aa] {ON} YCL057W (REAL)   621   0.0  
Skud_3.7 Chr3 (12763..14901) [2139 bp, 712 aa] {ON} YCL057W (REAL)    619   0.0  
TBLA0A07560 Chr1 complement(1871629..1873854) [2226 bp, 741 aa] ...   619   0.0  
YCL057W Chr3 (24768..26906) [2139 bp, 712 aa] {ON}  PRD1Zinc met...   616   0.0  
CAGL0B00418g Chr2 (26584..28815) [2232 bp, 743 aa] {ON} similar ...   613   0.0  
ABR185W Chr2 (758126..758380,758380..758709,758709..759029,75903...   377   e-123
Kpol_297.8 s297 complement(11648..14011) [2364 bp, 787 aa] {ON} ...   196   2e-52
KAFR0D02950 Chr4 complement(581305..583638) [2334 bp, 777 aa] {O...   183   6e-48
ZYRO0G20130g Chr7 (1666665..1669025) [2361 bp, 786 aa] {ON} simi...   182   1e-47
TPHA0G02390 Chr7 complement(486025..488412) [2388 bp, 795 aa] {O...   181   2e-47
SAKL0E03938g Chr5 (317017..319320) [2304 bp, 767 aa] {ON} simila...   180   5e-47
KNAG0A06200 Chr1 complement(937577..939946) [2370 bp, 789 aa] {O...   179   2e-46
CAGL0D02112g Chr4 complement(216204..218489) [2286 bp, 761 aa] {...   177   3e-46
Skud_11.93 Chr11 complement(175243..177561) [2319 bp, 772 aa] {O...   176   9e-46
Suva_11.91 Chr11 complement(175327..177654) [2328 bp, 775 aa] {O...   174   5e-45
Ecym_6099 Chr6 complement(186647..188968) [2322 bp, 773 aa] {ON}...   172   2e-44
NDAI0E02010 Chr5 complement(404579..406915) [2337 bp, 778 aa] {O...   170   1e-43
Kwal_26.7616 s26 (444266..446578) [2313 bp, 770 aa] {ON} YKL134C...   169   3e-43
Smik_11.102 Chr11 complement(175013..177331) [2319 bp, 772 aa] {...   161   1e-40
AFR198W Chr6 (797448..799778) [2331 bp, 776 aa] {ON} Syntenic ho...   160   3e-40
KLTH0D04730g Chr4 (432572..434890) [2319 bp, 772 aa] {ON} simila...   159   4e-40
YKL134C Chr11 complement(189124..191442) [2319 bp, 772 aa] {ON} ...   159   6e-40
TBLA0I00710 Chr9 (128272..130593) [2322 bp, 773 aa] {ON} Anc_2.4...   158   1e-39
TDEL0A02080 Chr1 complement(373425..375788) [2364 bp, 787 aa] {O...   158   1e-39
KLLA0B12397g Chr2 complement(1084129..1086468) [2340 bp, 779 aa]...   152   8e-38
NCAS0A04280 Chr1 complement(864327..866648) [2322 bp, 773 aa] {O...   150   4e-37
CAGL0C02585g Chr3 (263270..265585) [2316 bp, 771 aa] {ON} highly...    37   0.22 
YLR397C Chr12 complement(912550..914892) [2343 bp, 780 aa] {ON} ...    37   0.25 
Smik_12.484 Chr12 complement(851231..853573) [2343 bp, 780 aa] {...    37   0.28 
KNAG0B06160 Chr2 complement(1209738..1212056) [2319 bp, 772 aa] ...    36   0.38 
Skud_12.482 Chr12 complement(852748..855081) [2334 bp, 777 aa] {...    35   0.61 
Suva_10.514 Chr10 complement(878137..880479) [2343 bp, 780 aa] {...    34   1.3  
AAR080W Chr1 (487099..488814) [1716 bp, 571 aa] {ON} NOHBY110; N...    34   1.4  
KAFR0D00990 Chr4 (205107..206522) [1416 bp, 471 aa] {ON} Anc_8.3...    32   8.6  

>AGR405C Chr7 complement(1469769..1471922) [2154 bp, 717 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YCL057W
           (PRD1); Tandem gene duplication in this genome
          Length = 717

 Score = 1411 bits (3653), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 685/717 (95%), Positives = 685/717 (95%)

Query: 1   MTKDLLGYWESLVPPQPPPVWNYTATEVIDLAYGLAQKSDAVYESVFSQKDEFTLDNYIW 60
           MTKDLLGYWESLVPPQPPPVWNYTATEVIDLAYGLAQKSDAVYESVFSQKDEFTLDNYIW
Sbjct: 1   MTKDLLGYWESLVPPQPPPVWNYTATEVIDLAYGLAQKSDAVYESVFSQKDEFTLDNYIW 60

Query: 61  PLLYNDQETDLLWNQLIFLRNVSPDPKVREASLSTGKILDQWVANISSKYDLYTNFEHIW 120
           PLLYNDQETDLLWNQLIFLRNVSPDPKVREASLSTGKILDQWVANISSKYDLYTNFEHIW
Sbjct: 61  PLLYNDQETDLLWNQLIFLRNVSPDPKVREASLSTGKILDQWVANISSKYDLYTNFEHIW 120

Query: 121 TQYKDDEEFKVTNYELYKYMEKDASYYNRNKRNLTNAESIELGQVTRKISVDTLQFSINL 180
           TQYKDDEEFKVTNYELYKYMEKDASYYNRNKRNLTNAESIELGQVTRKISVDTLQFSINL
Sbjct: 121 TQYKDDEEFKVTNYELYKYMEKDASYYNRNKRNLTNAESIELGQVTRKISVDTLQFSINL 180

Query: 181 GXXXXXXXXXXXXXXGVSPLVLDQFERIIEGGVKKLKVTFKYPDIGPVLRTATNPETRRK 240
           G              GVSPLVLDQFERIIEGGVKKLKVTFKYPDIGPVLRTATNPETRRK
Sbjct: 181 GEETEYITFTEEELEGVSPLVLDQFERIIEGGVKKLKVTFKYPDIGPVLRTATNPETRRK 240

Query: 241 AYVADQNRVAANEQLLFETLDLRRRMAQLRGYKNYAEYNLRDKMAKNEETVIPFLTDLVE 300
           AYVADQNRVAANEQLLFETLDLRRRMAQLRGYKNYAEYNLRDKMAKNEETVIPFLTDLVE
Sbjct: 241 AYVADQNRVAANEQLLFETLDLRRRMAQLRGYKNYAEYNLRDKMAKNEETVIPFLTDLVE 300

Query: 301 RLLPVGEKDREILKSKKAEDYKSKNLTFDGEIYAWDNAYYNNKILQEKYQIDPEDMAQYF 360
           RLLPVGEKDREILKSKKAEDYKSKNLTFDGEIYAWDNAYYNNKILQEKYQIDPEDMAQYF
Sbjct: 301 RLLPVGEKDREILKSKKAEDYKSKNLTFDGEIYAWDNAYYNNKILQEKYQIDPEDMAQYF 360

Query: 361 PIESVIEGMLDTYQTLFRLKFVEVTDPSQKNVWHEDVKQFAVWNIDDEDCPEFQGWIYFD 420
           PIESVIEGMLDTYQTLFRLKFVEVTDPSQKNVWHEDVKQFAVWNIDDEDCPEFQGWIYFD
Sbjct: 361 PIESVIEGMLDTYQTLFRLKFVEVTDPSQKNVWHEDVKQFAVWNIDDEDCPEFQGWIYFD 420

Query: 421 LYPRDGKYSHAANFGMASAFRKKDGSQSYPVTVLVCNLTKPTPTRTAILRPGEITTLFHE 480
           LYPRDGKYSHAANFGMASAFRKKDGSQSYPVTVLVCNLTKPTPTRTAILRPGEITTLFHE
Sbjct: 421 LYPRDGKYSHAANFGMASAFRKKDGSQSYPVTVLVCNLTKPTPTRTAILRPGEITTLFHE 480

Query: 481 LGHGIHHLVANNKLAAHNSLGSVPWDFVEAPSQMLEYWTGRRDVLTMLSKHYETGEKIPP 540
           LGHGIHHLVANNKLAAHNSLGSVPWDFVEAPSQMLEYWTGRRDVLTMLSKHYETGEKIPP
Sbjct: 481 LGHGIHHLVANNKLAAHNSLGSVPWDFVEAPSQMLEYWTGRRDVLTMLSKHYETGEKIPP 540

Query: 541 SLLDAWFNXXXXXXXXXXXXXXXXXXFDMYVHTREYHGLEVRKLWNDMRREISLINSQNY 600
           SLLDAWFN                  FDMYVHTREYHGLEVRKLWNDMRREISLINSQNY
Sbjct: 541 SLLDAWFNSSGLGSGLYYLGQLRLGLFDMYVHTREYHGLEVRKLWNDMRREISLINSQNY 600

Query: 601 TSTGYNTFGHIMTGSYSAGYYGYLWSQVFAADMYQTKFKSNPFNSTVGRQYRDTILAPGG 660
           TSTGYNTFGHIMTGSYSAGYYGYLWSQVFAADMYQTKFKSNPFNSTVGRQYRDTILAPGG
Sbjct: 601 TSTGYNTFGHIMTGSYSAGYYGYLWSQVFAADMYQTKFKSNPFNSTVGRQYRDTILAPGG 660

Query: 661 LYDMNDNLRKFLGREPNNRAFLRGLGFNATSLSRLLQVESAESVLLPRSDLRELFTI 717
           LYDMNDNLRKFLGREPNNRAFLRGLGFNATSLSRLLQVESAESVLLPRSDLRELFTI
Sbjct: 661 LYDMNDNLRKFLGREPNNRAFLRGLGFNATSLSRLLQVESAESVLLPRSDLRELFTI 717

>AGR406C Chr7 complement(1472496..1474547) [2052 bp, 683 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YCL057W
           (PRD1); Tandem gene duplication in this genome
          Length = 683

 Score =  940 bits (2430), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 456/679 (67%), Positives = 541/679 (79%), Gaps = 2/679 (0%)

Query: 11  SLVPPQPPPVWNYTATEVIDLAYGLAQKSDAVYESVFSQKDEFTLDNYIWPLLYNDQETD 70
           SLVPPQ  P WN++A +VI L++ L  +++AVY +V  +K   T+DNYI PL+Y+++ETD
Sbjct: 6   SLVPPQAAPSWNFSAQDVISLSHQLINQTEAVYHNVLQEKPP-TIDNYIMPLIYHEEETD 64

Query: 71  LLWNQLIFLRNVSPDPKVREASLSTGKILDQWVANISSKYDLYTNFEHIWTQYKDDEEFK 130
           LLWNQL+FLRNVSPDP++REAS +   +LD W+  ++SKYDLY +F+ +W QYKDDE+FK
Sbjct: 65  LLWNQLVFLRNVSPDPEIREASKNATSMLDDWIIGLTSKYDLYQHFDEVWAQYKDDEKFK 124

Query: 131 VTNYELYKYMEKDASYYNRNKRNLTNAESIELGQVTRKISVDTLQFSINLGXXXXXXXXX 190
             N+ELY+YMEKDA  Y R+   +       L +V  KI+   L+FS NLG         
Sbjct: 125 KENFELYRYMEKDADGYRRSGMKVPVENRKRLDEVKSKIAAAELEFSSNLGEEVEYIAFT 184

Query: 191 XXXXXGVSPLVLDQFERIIEGGVKKLKVTFKYPDIGPVLRTATNPETRRKAYVADQNRVA 250
                GV   VL+QFE+IIEGGV+K KVTFKYPDIGPVLR A+NPETRR+A +AD+NRVA
Sbjct: 185 KEELEGVPDTVLNQFEKIIEGGVEKFKVTFKYPDIGPVLRLASNPETRRRASMADENRVA 244

Query: 251 ANEQLLFETLDLRRRMAQLRGYKNYAEYNLRDKMAKNEETVIPFLTDLVERLLPVGEKDR 310
           ANE LLFETL+LRR +A L G+KN+A YNL DKMAKNEETV+ FL DLVE+LLPVG+ D 
Sbjct: 245 ANEPLLFETLELRRELADLLGFKNFAAYNLDDKMAKNEETVLKFLNDLVEKLLPVGKNDL 304

Query: 311 EILKSKKAEDYKSKNLTFDGEIYAWDNAYYNNKILQEKYQIDPEDMAQYFPIESVIEGML 370
           EILK KKAEDYKSKNLTFDGE Y+WD  YY NKIL+E+Y ++P+D+AQYFP+ES IEGML
Sbjct: 305 EILKKKKAEDYKSKNLTFDGEFYSWDTGYYTNKILRERYNVNPDDLAQYFPVESAIEGML 364

Query: 371 DTYQTLFRLKFVEVTDPSQKNVWHEDVKQFAVWNIDDEDCPEFQGWIYFDLYPRDGKYSH 430
           + Y TLFRLKFVE+TD  +K+VWHEDVKQFAVWNIDDED P+FQGW+YFDL+PRDGKY H
Sbjct: 365 NIYTTLFRLKFVEITDECEKSVWHEDVKQFAVWNIDDEDNPKFQGWLYFDLHPRDGKYGH 424

Query: 431 AANFGMASAFRKKDGSQSYPVTVLVCNLTKPTPTRTAILRPGEITTLFHELGHGIHHLVA 490
           AANFGM SA+RK+DGS+SYPVT+LV N +KPTPTR A+L+ GE+TT FHELGHGIH LV 
Sbjct: 425 AANFGMVSAYRKRDGSKSYPVTILVTNFSKPTPTRPALLKLGELTTFFHELGHGIHDLVG 484

Query: 491 NNKLAAHNSLGSVPWDFVEAPSQMLEYWTGRRDVLTMLSKHYETGEKIPPSLLDAWFNXX 550
           +N L + N  GSVPWDFVEAPSQMLEYWT RRDVLTMLSKHYETGEKIP SLLDAWF+  
Sbjct: 485 SNDLESLNGPGSVPWDFVEAPSQMLEYWTARRDVLTMLSKHYETGEKIPKSLLDAWFSVG 544

Query: 551 XXXXXXXXXXXXXXXXFDMYVHTREYHGLEVRKLWNDMRREISLINSQNYTSTGYNTFGH 610
                           FDMYVHTR+Y G EVRKLWND+ REI L+N +NYTSTGY++FGH
Sbjct: 545 GLNSGLANLGQLKLGLFDMYVHTRDYKGAEVRKLWNDLTREIGLMNLKNYTSTGYDSFGH 604

Query: 611 IMTGSYSAGYYGYLWSQVFAADMYQTKFKSNPFNSTVGRQYRDTILAPGGLYDMNDNLRK 670
           IM   Y+AGYYGYLWSQVFAADMY TKFK NPFN+TVG +YRDTILA GGLYDM DNLRK
Sbjct: 605 IMA-GYAAGYYGYLWSQVFAADMYDTKFKPNPFNATVGVEYRDTILATGGLYDMTDNLRK 663

Query: 671 FLGREPNNRAFLRGLGFNA 689
           FLGR+PNN+AFLRGLG  A
Sbjct: 664 FLGRDPNNKAFLRGLGLKA 682

>SAKL0C00550g Chr3 (48410..50608) [2199 bp, 732 aa] {ON} highly
           similar to gnl|GLV|KLLA0C00572g Kluyveromyces lactis
           KLLA0C00572g and similar to YCL057W uniprot|P25375
           Saccharomyces cerevisiae YCL057W PRD1 Zinc
           metalloendopeptidase found in the cytoplasm and
           intermembrane space of mitochondria
          Length = 732

 Score =  689 bits (1779), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 335/680 (49%), Positives = 458/680 (67%), Gaps = 4/680 (0%)

Query: 11  SLVPPQPPPVWNYTATEVIDLAYGLAQKSDAVYESVFSQKDEFTLDNYIWPLLYNDQETD 70
           +LVPPQ  P W Y+  +++ L       + A+++++   ++  T+++ + P L ++  T 
Sbjct: 55  TLVPPQAAPSWKYSPEDILQLTNETIASTSALHDALAGVENP-TVESLVKPFLEHENTTQ 113

Query: 71  LLWNQLIFLRNVSPDPKVREASLSTGKILDQWVANISSKYDLYTNFEHIWTQYKDDEEFK 130
            L NQL FL++VS D +VR+AS    ++L  +    S ++DL+  F+ +W   KDD +FK
Sbjct: 114 PLINQLTFLQHVSADKEVRDASTKATELLQDFEIEASLRHDLFVQFDKVWQACKDDAKFK 173

Query: 131 VTNYELYKYMEKDASYYNRNKRNLTNAESIELGQVTRKISVDTLQFSINLGXXXXXXXXX 190
             ++ELYK++EK    Y R   NL   +  E+ ++ +KIS ++LQFS NLG         
Sbjct: 174 KEHFELYKFVEKCHKDYVRAGLNLPEEKRNEVKELQKKISNNSLQFSKNLGEQKEFVAFT 233

Query: 191 XXXXXGVSPLVLDQFERIIE-GGVKKLKVTFKYPDIGPVLRTATNPETRRKAYVADQNRV 249
                GVS  V+DQFE+  +  GV+K KV+FKYPDI PVL+TA NPETR++A+  DQN+V
Sbjct: 234 TEELDGVSASVMDQFEKFTDTDGVEKHKVSFKYPDILPVLKTAKNPETRKRAFGGDQNKV 293

Query: 250 AANEQLLFETLDLRRRMAQLRGYKNYAEYNLRDKMAKNEETVIPFLTDLVERLLPVGEKD 309
             NE L  ETL LR  +A L GY  YA YNL  KMAK +ETV+ FL DL  +L P+G K+
Sbjct: 294 PQNEVLFLETLRLRDELAGLLGYSTYANYNLDIKMAKKQETVLAFLEDLKNKLKPLGVKE 353

Query: 310 REILKSKKAEDYKSKNLTFDGEIYAWDNAYYNNKILQEKYQIDPEDMAQYFPIESVIEGM 369
            E LKS K +D K   + FD   Y WDN YY+NK L+E Y +D E +++YFP+E  I GM
Sbjct: 354 IEALKSLKEKDCKELAIPFDNHYYIWDNRYYDNKYLKENYNVDEEKISEYFPLEPTIGGM 413

Query: 370 LDTYQTLFRLKFVEVTDPSQKNVWHEDVKQFAVWNIDDEDCPEFQGWIYFDLYPRDGKYS 429
           L  Y+T+ +LKFVE TD  +K VWHEDVKQ AVW +D  + PEF GWIYFDL+PRDGKY 
Sbjct: 414 LKIYETVLKLKFVEETDAEKKQVWHEDVKQLAVWKVDKAESPEFVGWIYFDLHPRDGKYG 473

Query: 430 HAANFGMASAFRKKDGSQSYPVTVLVCNLTKPTPTRTAILRPGEITTLFHELGHGIHHLV 489
           HAANFG+AS++  +DG++S+PVT LVCN +KP+  + A+L+  EITT FHELGHGIH LV
Sbjct: 474 HAANFGIASSYV-RDGARSHPVTALVCNFSKPSAKKPALLKHSEITTFFHELGHGIHDLV 532

Query: 490 ANNKLAAHNSLGSVPWDFVEAPSQMLEYWTGRRDVLTMLSKHYETGEKIPPSLLDAWFNX 549
             N +   N  G+ PWDFVEAPSQMLE+WT  ++ L+ LS+HYETGEKIP  LLD+    
Sbjct: 533 GGNHIGRFNGPGATPWDFVEAPSQMLEFWTWNKNELSTLSQHYETGEKIPEQLLDSLIAT 592

Query: 550 XXXXXXXXXXXXXXXXXFDMYVHT-REYHGLEVRKLWNDMRREISLINSQNYTSTGYNTF 608
                            FDM VHT ++   L+V  LWND+R+E+SL+ + +  + G+N+F
Sbjct: 593 KHVNGALFALRQLTFGLFDMTVHTCKDLESLDVTSLWNDLRQEVSLVENGDQVTKGFNSF 652

Query: 609 GHIMTGSYSAGYYGYLWSQVFAADMYQTKFKSNPFNSTVGRQYRDTILAPGGLYDMNDNL 668
           GHIM+G+YSAGYYGY+W++VFAADMY TKF ++P N  VG +YRD +L+ GGLY+++DNL
Sbjct: 653 GHIMSGAYSAGYYGYMWAEVFAADMYHTKFAADPLNGDVGVRYRDIVLSRGGLYEIDDNL 712

Query: 669 RKFLGREPNNRAFLRGLGFN 688
           R+FLGREPNN AFL+ LG +
Sbjct: 713 REFLGREPNNEAFLKELGLS 732

>Ecym_1011 Chr1 (19924..22074) [2151 bp, 716 aa] {ON} similar to
           Ashbya gossypii AGR406C/ AGR405C
          Length = 716

 Score =  678 bits (1750), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 333/679 (49%), Positives = 456/679 (67%), Gaps = 6/679 (0%)

Query: 11  SLVPPQPPPVWNYTATEVIDLAYGLAQKSDAVYESVFSQKDEFTLDNYIWPLLYNDQETD 70
           SL+ P+  P W++ A E++ LA     +    Y+SV S +    L+N++  ++ ++ ETD
Sbjct: 42  SLLSPKLAPSWDFAADEIVSLAQKAIDEGTKFYDSVASLETP-DLENFVVAVIDHEDETD 100

Query: 71  LLWNQLIFLRNVSPDPKVREASLSTGKILDQWVANISSKYDLYTNFEHIWTQYKDDEEFK 130
              +QL FL++VS D +VR+AS+   K++ +W    SS+YDLY+ F  +W QYKDDE  K
Sbjct: 101 GYMSQLTFLQHVSADKEVRDASIEATKLIQEWGIETSSRYDLYSQFSKVWEQYKDDENLK 160

Query: 131 VTNYELYKYMEKDASYYNRNKRNLTNAESIELGQVTRKISVDTLQFSINLGXXXXXXXXX 190
             + ELY YME     Y      L      ++ ++ +K++ ++L FS NLG         
Sbjct: 161 KNDPELYWYMENVNKDYIHAGMGLPEESRNKIKEIKKKLANNSLAFSNNLGEQNDYIAFT 220

Query: 191 XXXXXGVSPLVLDQFERIIEGGVKKLKVTFKYPDIGPVLRTATNPETRRKAYVADQNRVA 250
                GVS   L QFE++IE GV+K K+TFKYPDI PVL TA NPETR++AY+ DQN+V 
Sbjct: 221 KDELVGVSETTLGQFEKVIEDGVEKYKMTFKYPDIHPVLNTAKNPETRKRAYIGDQNKVP 280

Query: 251 ANEQLLFETLDLRRRMAQLRGYKNYAEYNLRDKMAKNEETVIPFLTDLVERLLPVGEKDR 310
            NEQ+L ETL LR  +A++ G+  YA Y L  KMAK +ETV  FL DL ++LLP G+KD 
Sbjct: 281 QNEQILIETLKLRNELAEIHGHPTYASYQLEMKMAKKQETVFNFLYDLKDKLLPGGKKDL 340

Query: 311 EILKSKKAEDYKSKNLTFDGEIYAWDNAYYNNKILQEKYQIDPEDMAQYFPIESVIEGML 370
           E LKS K ++YK   L ++G   +WD  YY++K L+E + +D E++A+YFP++  I+GML
Sbjct: 341 ENLKSLKEQEYKELGLPYNGSFNSWDYRYYDDKYLKENFDVDEEELAKYFPLQHTIDGML 400

Query: 371 DTYQTLFRLKFVEVTDPSQKNVWHEDVKQFAVWNIDDEDC-PEFQGWIYFDLYPRDGKYS 429
           + YQ LF LKFVE T    KNVWHEDVKQFAVW++D   C PEF GWIYFDL+PR+GKY 
Sbjct: 401 NIYQKLFNLKFVEETRECGKNVWHEDVKQFAVWDLD--KCNPEFVGWIYFDLHPREGKYG 458

Query: 430 HAANFGMASAFRKKDGSQSYPVTVLVCNLTKPTPTRTAILRPGEITTLFHELGHGIHHLV 489
           HAANFG+ S +  ++G++ YPVTVLVCN +KP+ TR A+L+ GE+ T FHELGHGIH LV
Sbjct: 459 HAANFGLYSPYVTEEGTRHYPVTVLVCNFSKPSSTRPALLKHGEVVTFFHELGHGIHALV 518

Query: 490 ANNKLAAHNSLGSVPWDFVEAPSQMLEYWTGRRDVLTMLSKHYETGEKIPPSLLDAWFNX 549
             +++   N   S+PWDFVEAPSQMLE+W   +D +  LSKHYETGE+IP  L+D+    
Sbjct: 519 GKSRIGHLNGPSSIPWDFVEAPSQMLEFWPWNKDQILKLSKHYETGEQIPDELVDSLIKT 578

Query: 550 XXXXXXXXXXXXXXXXXFDMYVHT-REYHGLEVRKLWNDMRREISLINSQNYTSTGYNTF 608
                            FDM VHT +E   L+++ LWN++R E++LI++ +  + GY++F
Sbjct: 579 KHVNAGLSNLRQLHFSLFDMTVHTDKELDKLDIKSLWNNLREEVTLISNGDVLTKGYDSF 638

Query: 609 GHIMTGSYSAGYYGYLWSQVFAADMYQTKFKSNPFNSTVGRQYRDTILAPGGLYDMNDNL 668
            HIM+G YSAGYYGY+WS+VFAADMY T F  NP +++VG +YRD ILA GGL D+ D+L
Sbjct: 639 SHIMSG-YSAGYYGYMWSEVFAADMYHTMFAPNPLDTSVGTRYRDIILAKGGLRDIEDSL 697

Query: 669 RKFLGREPNNRAFLRGLGF 687
            +FLGREPNN+AFL+ LG 
Sbjct: 698 EEFLGREPNNKAFLKELGL 716

>Kpol_2002.12 s2002 (21544..23763) [2220 bp, 739 aa] {ON}
           (21544..23763) [2220 nt, 740 aa]
          Length = 739

 Score =  662 bits (1708), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 323/684 (47%), Positives = 457/684 (66%), Gaps = 8/684 (1%)

Query: 12  LVPPQPPPVWNYTATEVIDLAYGLAQKSDAVYESVFSQKDEFTLDNYIWPLLYNDQETDL 71
           L+ PQP P WN+T   ++  A  L + S+ +++++ +     T++N+I P + ++ +   
Sbjct: 57  LIAPQPAPTWNWTPEGIVKDAESLIKDSNRIFDNLAAISSP-TVENFIVPYMNHENKVSP 115

Query: 72  LWNQLIFLRNVSPDPKVREASLSTGKILDQWVANISSKYDLYTNFEHIWTQYKDDEEFK- 130
           L NQL FL++VS D  +R++S+   +++  +    S + DL+  F+ IWT  KD+ EF  
Sbjct: 116 LINQLTFLQHVSADKDIRDSSMKATELIQNFEIEASLRKDLFIQFDKIWTDVKDNSEFNE 175

Query: 131 ---VTNYELYKYMEKDASYYNRNKRNLTNAESIELGQVTRKISVDTLQFSINLGXXXXXX 187
                NYE Y+++EK    + R+  NL++ +   +  + +KI+ ++L FS NLG      
Sbjct: 176 KSDSKNYESYRFIEKCHKDFIRSGLNLSDEKREIVKDIQKKIASNSLNFSKNLGEQKEFI 235

Query: 188 XXXXXXXXGVSPLVLDQFERIIE--GGVKKLKVTFKYPDIGPVLRTATNPETRRKAYVAD 245
                   GVS  V++QFE+  +   G +K KVTFKYPDI PVL++A NP TR+ A+ AD
Sbjct: 236 AFTKEELDGVSDAVMEQFEKFKDEKTGEEKFKVTFKYPDILPVLKSAKNPNTRKLAFNAD 295

Query: 246 QNRVAANEQLLFETLDLRRRMAQLRGYKNYAEYNLRDKMAKNEETVIPFLTDLVERLLPV 305
           QN+V  NE L  +TL LR  ++ +  Y NYA YNL  KMAKNEETV  FL DL  +L P+
Sbjct: 296 QNKVPENEALFVDTLKLRNDLSTVLDYSNYANYNLEMKMAKNEETVFNFLDDLKTKLRPL 355

Query: 306 GEKDREILKSKKAEDYKSKNLTFDGEIYAWDNAYYNNKILQEKYQIDPEDMAQYFPIESV 365
           G K+ EILK  K +D K  NL +D   Y WD+ YY+NK L++ + +D E +++Y+PIES 
Sbjct: 356 GLKEIEILKQLKEKDMKELNLPYDNHYYIWDHRYYDNKYLKDNFNVDLEKISEYYPIESS 415

Query: 366 IEGMLDTYQTLFRLKFVEVTDPSQKNVWHEDVKQFAVWNIDDEDCPEFQGWIYFDLYPRD 425
           I+GML  Y+T+ +LKFVE TDP+++NVWHEDVKQ +VW +D+ D PEF GWIYFDL+PRD
Sbjct: 416 IDGMLKIYETVMKLKFVEETDPAKRNVWHEDVKQLSVWKMDNPDAPEFIGWIYFDLHPRD 475

Query: 426 GKYSHAANFGMASAFRKKDGSQSYPVTVLVCNLTKPTPTRTAILRPGEITTLFHELGHGI 485
           GKY HAANFG++S++  ++  +SYPVT LVCN +KPT  + ++L+  E+TT FHELGHGI
Sbjct: 476 GKYGHAANFGISSSYVDENDKRSYPVTALVCNFSKPTSDKPSLLKHNELTTFFHELGHGI 535

Query: 486 HHLVANNKLAAHNSLGSVPWDFVEAPSQMLEYWTGRRDVLTMLSKHYETGEKIPPSLLDA 545
           H LV  N+ +  N  GSVPWDFVEAPSQMLE+WT  ++ L  LSKHY+TGEKIP SL+++
Sbjct: 536 HDLVGANRCSRLNGPGSVPWDFVEAPSQMLEFWTWNKNELISLSKHYKTGEKIPESLIES 595

Query: 546 WFNXXXXXXXXXXXXXXXXXXFDMYVHTRE-YHGLEVRKLWNDMRREISLINSQNYTSTG 604
             +                  FDM VHT E    L + +LWN +R +I L+ + +  S G
Sbjct: 596 LVSTKHVNGALFALRQLHFSTFDMEVHTAEDVSKLNLLELWNGLREQICLVENGDEMSKG 655

Query: 605 YNTFGHIMTGSYSAGYYGYLWSQVFAADMYQTKFKSNPFNSTVGRQYRDTILAPGGLYDM 664
           Y++FGHIM+G+YSAGYYGY+W++VFA DMY TKF ++P NS  G +YRD IL+ GG+Y++
Sbjct: 656 YDSFGHIMSGAYSAGYYGYMWAEVFATDMYYTKFAADPLNSKSGVEYRDIILSRGGIYEV 715

Query: 665 NDNLRKFLGREPNNRAFLRGLGFN 688
           NDNL +FLGREPNN AFL+ +G N
Sbjct: 716 NDNLEEFLGREPNNSAFLKEMGLN 739

>ZYRO0F18392g Chr6 complement(1518902..1521079) [2178 bp, 725 aa]
           {ON} similar to uniprot|P25375 Saccharomyces cerevisiae
           YCL057W PRD1 Zinc metalloendopeptidase found in the
           cytoplasm and intermembrane space of mitochondria
          Length = 725

 Score =  653 bits (1684), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 321/680 (47%), Positives = 447/680 (65%), Gaps = 4/680 (0%)

Query: 12  LVPPQPPPVWNYTATEVIDLAYGLAQKSDAVYESVFSQKDEFTLDNYIWPLLYNDQETDL 71
            + PQ  P W +T   ++D  + L + S   Y+S+ +Q    T++N + P ++++    L
Sbjct: 47  FIAPQSAPSWAFTPQSLLDETHRLIESSKQFYDSL-AQLSNPTVENLVKPYMHHENGVGL 105

Query: 72  LWNQLIFLRNVSPDPKVREASLSTGKILDQWVANISSKYDLYTNFEHIWTQYKDDE-EFK 130
           + +QL F + VS D ++R+AS+   + L  +    S ++DL+  F+ IW + KD   E  
Sbjct: 106 IESQLTFPQQVSADKEIRDASVQATEFLQNFGIEQSLRHDLFLQFDKIWNELKDKSFEQG 165

Query: 131 VTNYELYKYMEKDASYYNRNKRNLTNAESIELGQVTRKISVDTLQFSINLGXXXXXXXXX 190
              YE+YKY+EK    Y R+   L   +  ++ Q+  KI+ ++L+FS NLG         
Sbjct: 166 SQEYEIYKYVEKIHRDYTRDGLQLPEDKRDKVKQLKIKIAANSLEFSKNLGEQKEFVAFT 225

Query: 191 XXXXXGVSPLVLDQFERII-EGGVKKLKVTFKYPDIGPVLRTATNPETRRKAYVADQNRV 249
                GVS  V+DQFE+   E G  K KVTFKYPDI PVL+TA NP+TR+ A+  DQ++V
Sbjct: 226 KEELDGVSESVMDQFEQFKDENGTTKYKVTFKYPDIFPVLKTAKNPKTRKLAFARDQDKV 285

Query: 250 AANEQLLFETLDLRRRMAQLRGYKNYAEYNLRDKMAKNEETVIPFLTDLVERLLPVGEKD 309
             NE+L  ETL LR  +A + GY  YA YNL  KMAKN++ V  FL +L ++L P+G K+
Sbjct: 286 PQNEKLFVETLQLRNELADILGYSTYANYNLELKMAKNQDNVWKFLNELKDKLKPLGLKE 345

Query: 310 REILKSKKAEDYKSKNLTFDGEIYAWDNAYYNNKILQEKYQIDPEDMAQYFPIESVIEGM 369
            E LK  K ++ +S  L +DG  Y WD+ YY+NK L++ Y +D E +++Y+PIES I GM
Sbjct: 346 AENLKQIKQKECESLGLPYDGHYYVWDHRYYDNKYLKDNYNVDLEKISEYYPIESTISGM 405

Query: 370 LDTYQTLFRLKFVEVTDPSQKNVWHEDVKQFAVWNIDDEDCPEFQGWIYFDLYPRDGKYS 429
           L  Y+TL +LKFVE TDP +++VWHEDVKQ AVW +D+   PEF GWIYFDL+PRDGKY 
Sbjct: 406 LSIYETLLKLKFVEETDPEKRSVWHEDVKQLAVWKMDNPSKPEFVGWIYFDLHPRDGKYG 465

Query: 430 HAANFGMASAFRKKDGSQSYPVTVLVCNLTKPTPTRTAILRPGEITTLFHELGHGIHHLV 489
           HAANFG+++++ K+DG++SYPVT LVCN +KP+  + ++L+  EI+T FHELGHGIH LV
Sbjct: 466 HAANFGISASYVKEDGTRSYPVTALVCNFSKPSAKKPSLLKHNEISTFFHELGHGIHDLV 525

Query: 490 ANNKLAAHNSLGSVPWDFVEAPSQMLEYWTGRRDVLTMLSKHYETGEKIPPSLLDAWFNX 549
             N+L   N  G+VPWDFVEAPSQMLE+WT     L  LS HYE+GEKIP  LL +  + 
Sbjct: 526 GENRLTTFNGPGAVPWDFVEAPSQMLEFWTWNERELHELSSHYESGEKIPKDLLQSLIST 585

Query: 550 XXXXXXXXXXXXXXXXXFDMYVHT-REYHGLEVRKLWNDMRREISLINSQNYTSTGYNTF 608
                            FDMYVHT +    L++ KLWN++R E+SL+ + +  + GY++F
Sbjct: 586 KHVDGALFALRQLHFGLFDMYVHTSKNVAKLDLLKLWNELREEVSLVENGDTFTKGYDSF 645

Query: 609 GHIMTGSYSAGYYGYLWSQVFAADMYQTKFKSNPFNSTVGRQYRDTILAPGGLYDMNDNL 668
           GHIM+ SYSAGYYGY+W++VFAADMY T+F ++P +S  G QYRD +L  GGLY+ NDNL
Sbjct: 646 GHIMSDSYSAGYYGYMWAEVFAADMYHTRFAADPLDSKAGVQYRDIVLGRGGLYETNDNL 705

Query: 669 RKFLGREPNNRAFLRGLGFN 688
           R+FLGREP+  AFL+ LG N
Sbjct: 706 REFLGREPSEEAFLKELGLN 725

>KLLA0C00572g Chr3 (42069..44207) [2139 bp, 712 aa] {ON} similar to
           uniprot|P25375 Saccharomyces cerevisiae YCL057W PRD1
           Zinc metalloendopeptidase found in the cytoplasm and
           intermembrane space of mitochondria
          Length = 712

 Score =  650 bits (1677), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 321/677 (47%), Positives = 446/677 (65%), Gaps = 6/677 (0%)

Query: 12  LVPPQPPPVWNYTATEVIDLAYGLAQKSDAVYESVFSQKDEFTLDNYIWPLLYNDQETDL 71
            V PQ  P WNYT  E++   +     S+ + +S+ S  +  +++N++ P L+++     
Sbjct: 41  FVVPQAAPSWNYTTEELLKQTHEAIDSSNELLDSLESISNP-SVENFVTPYLHHENTISP 99

Query: 72  LWNQLIFLRNVSPDPKVREASLSTGKILDQWVANISSKYDLYTNFEHIWTQYKDDEEFKV 131
           L+NQL FL++VS D ++R+ S    ++++ +    S ++ L+  F+ +W Q KDD +FK 
Sbjct: 100 LFNQLTFLQHVSSDKELRDTSTKVTELIENFGIESSLRFKLFRQFDIVWNQLKDDAQFKK 159

Query: 132 TNYELYKYMEKDASYYNRNKRNLTNAESIELGQVTRKISVDTLQFSINLGXXXXXXXXXX 191
            ++E+YK++EK    + R+  NL   +  ++ ++ +KIS ++LQFS NLG          
Sbjct: 160 DHFEIYKFVEKCHKDFLRSGLNLPEEQRDKVKEIKKKISNNSLQFSKNLGEQNEFITFTK 219

Query: 192 XXXXGVSPLVLDQFERIIEGGVKKLKVTFKYPDIGPVLRTATNPETRRKAYVADQNRVAA 251
               GVS  V+ QFE + E G+ K KVTFKYPDI PVL++A N ETR++A++ DQN+V  
Sbjct: 220 EELIGVSENVMKQFETVDEDGITKYKVTFKYPDIFPVLKSAKNAETRKRAFIGDQNKVPQ 279

Query: 252 NEQLLFETLDLRRRMAQLRGYKNYAEYNLRDKMAKNEETVIPFLTDLVERLLPVGEKDRE 311
           NE L  ETL LR  +A+L  Y +YA+YNL  KMAK EE V+ FL DL  +L P+GEK+  
Sbjct: 280 NEALFLETLQLRNDLAELLNYDSYADYNLDIKMAKKEEAVLTFLNDLKNKLKPLGEKELT 339

Query: 312 ILKSKKAEDYKSKNLTFDGEIYAWDNAYYNNKILQEKYQIDPEDMAQYFPIESVIEGMLD 371
            LK+ K E+ K  N  +D   Y WDN YY+N+ L++ +QID E +A+YFP+ES I+GML 
Sbjct: 340 KLKNLKEEECKELNTPYDRRYYIWDNRYYDNQYLKKNFQIDEEKIAEYFPLESTIKGMLQ 399

Query: 372 TYQTLFRLKFVEVTDPSQKNVWHEDVKQFAVWNIDDEDCPEFQGWIYFDLYPRDGKYSHA 431
            Y+T+ +LKF+E       + WH DVK+ +VW +DD + P F GWIYFDL+PR+GKY HA
Sbjct: 400 IYETVLKLKFIE---EDNGDTWHPDVKKLSVWKMDD-NFPSFVGWIYFDLHPREGKYGHA 455

Query: 432 ANFGMASAFRKKDGSQSYPVTVLVCNLTKPTPTRTAILRPGEITTLFHELGHGIHHLVAN 491
           ANFG++S+F K DGS+SYPVT LVCN +KPT  + A+L+  E+TT FHELGHGIH LV  
Sbjct: 456 ANFGISSSFLKSDGSRSYPVTALVCNFSKPTKDKPALLKHSELTTFFHELGHGIHDLVGG 515

Query: 492 NKLAAHNSLGSVPWDFVEAPSQMLEYWTGRRDVLTMLSKHYETGEKIPPSLLDAWFNXXX 551
           N +   N   + PWDFVEAPSQMLE+WT  +  L  LSKHY+T EKIP SLLD+      
Sbjct: 516 NDIGRFNGPSATPWDFVEAPSQMLEFWTWNKKELKSLSKHYQTEEKIPDSLLDSLVRTKH 575

Query: 552 XXXXXXXXXXXXXXXFDMYVH-TREYHGLEVRKLWNDMRREISLINSQNYTSTGYNTFGH 610
                          FDM VH T++   L V +LWN +R EI LI++ +  + G+N+FGH
Sbjct: 576 INGALFALRQLHFGLFDMKVHTTKDISKLNVTELWNSLREEICLIDNGDIQTKGFNSFGH 635

Query: 611 IMTGSYSAGYYGYLWSQVFAADMYQTKFKSNPFNSTVGRQYRDTILAPGGLYDMNDNLRK 670
           IM+ SYSAGYYGY+W+ VFA+DMY TKF  +P NS VG QYRD ILA GGLY++ DNL +
Sbjct: 636 IMSDSYSAGYYGYMWADVFASDMYYTKFLEDPLNSDVGVQYRDIILARGGLYEIEDNLTE 695

Query: 671 FLGREPNNRAFLRGLGF 687
           FLGR+PNN+AFL+ LG 
Sbjct: 696 FLGRKPNNKAFLKELGL 712

>NDAI0A00180 Chr1 (14692..16914) [2223 bp, 740 aa] {ON} Anc_1.9
          Length = 740

 Score =  645 bits (1663), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 331/681 (48%), Positives = 451/681 (66%), Gaps = 9/681 (1%)

Query: 12  LVPPQPPPVWNYTATEVIDLAYGLAQKSDAVYESVFSQKDEFTLDNYIWPLLYNDQETDL 71
           + P    P W +T  +++D      +K++  Y S+ S+ +  +++N I P +  + +  L
Sbjct: 64  IAPANTVPDWTWTPKQILDETKSYIEKTNKYYNSI-SEIESPSIENLIIPYMNYENKMGL 122

Query: 72  LWNQLIFLRNVSPDPKVREASLSTGKILDQWVANISSKYDLYTNFEHIWTQYKDDEEF-K 130
           L NQL FL++VS D K+R+ASL   ++L+      S +++++  FE +W   ++D++F K
Sbjct: 123 LINQLTFLQHVSADKKIRDASLEATRLLEDHDILTSLRWEIWEQFEKVWETVQNDDDFLK 182

Query: 131 VTNYELYKYMEKDASYYNRNKRNLTNAESIELGQVTRKISVDTLQFSINLGXXXXXXXXX 190
              +E YK++EK      RN   L +  + +L  +  KIS D L FS NLG         
Sbjct: 183 NHQFETYKFIEKIHKDSLRN--GLKSERNYQLKYIKGKISADALTFSSNLGEQNEYVSFT 240

Query: 191 XXXXXGVSPLVLDQFERIIEGGV--KKLKVTFKYPDIGPVLRTATNPETRRKAYVADQNR 248
                GVS  V+DQFE+ I+     KK KVTFKYPDI PVL+TA NP+TR+ A++ DQN+
Sbjct: 241 KEELDGVSETVMDQFEKFIDPKTNEKKYKVTFKYPDIFPVLKTAKNPKTRKIAFLGDQNK 300

Query: 249 VAANEQLLFETLDLRRRMAQLRGYKNYAEYNLRDKMAKNEETVIPFLTDLVERLLPVGEK 308
           V  NE+LL   L LR+ +A   GY  YA YNL  KMAKN+ETV+ FL DL E+L P+ EK
Sbjct: 301 VPENEKLLCNVLKLRKELANTLGYSTYANYNLDIKMAKNQETVLKFLNDLKEKLKPLAEK 360

Query: 309 DREILKSKKAEDYKSKNLTFDGEIYAWDNAYYNNKILQEKYQIDPEDMAQYFPIESVIEG 368
           + +ILK  K ++ +   + +DG  Y WD+ YY+NK L++ + +D E +++Y+P+ES I+G
Sbjct: 361 EIKILKDLKKKECEELGIPYDGHYYIWDHRYYDNKYLKDNFNVDIEKISEYYPLESTIDG 420

Query: 369 MLDTYQTLFRLKFVEVTDPSQKNVWHEDVKQFAVWNIDDEDCPEFQGWIYFDLYPRDGKY 428
           ML  Y+T+  LKF+E TDP  KNVWH DVKQ +VWN+DD   P F GWIYFDLYPRDGKY
Sbjct: 421 MLKIYETVLNLKFIEETDPLAKNVWHPDVKQLSVWNMDDRANPAFVGWIYFDLYPRDGKY 480

Query: 429 SHAANFGMASAFRKKDGSQSYPVTVLVCNLTKPTPTRTAILRPGEITTLFHELGHGIHHL 488
            HAANFG+AS++  ++  +SYPVT LVCN +KPT  + A+L+  EITT FHELGHGIH L
Sbjct: 481 GHAANFGIASSYITEENKRSYPVTALVCNFSKPTKNKPALLKHSEITTFFHELGHGIHDL 540

Query: 489 VANNKLAAHNSLGSVPWDFVEAPSQMLEYWTGRRDVLTMLSKHYETGEKIPPSLLDAWFN 548
           V  NK A  N  GSVPWDFVEAPSQMLE+WT  ++ L  LSKHY+TGEKIP  LLD+  +
Sbjct: 541 VGQNKAARFNGPGSVPWDFVEAPSQMLEFWTWNKNELLSLSKHYKTGEKIPEDLLDSLIS 600

Query: 549 XXXXXXXXXXXXXXXXXXFDMYVH-TREYHGLEVRKLWNDMRREISLI-NSQNYTSTGYN 606
                             FDM VH T++   L++ KLWN+ R EI L+ N +N+T  GYN
Sbjct: 601 TKHVNGALFALRQLHFGLFDMTVHTTKDIENLDLLKLWNESREEICLVENGENFTK-GYN 659

Query: 607 TFGHIMTGSYSAGYYGYLWSQVFAADMYQTKFKSNPFNSTVGRQYRDTILAPGGLYDMND 666
           +FGHI++ SYSAGYYGY+W++VFAADMY TKF  NP + +VG +YRD ILA GGLY++ND
Sbjct: 660 SFGHIISDSYSAGYYGYMWAEVFAADMYHTKFAPNPLDVSVGIKYRDLILAKGGLYEIND 719

Query: 667 NLRKFLGREPNNRAFLRGLGF 687
           NL +FLGREP+N+ FL+ LG 
Sbjct: 720 NLLEFLGREPSNKPFLKELGL 740

>NCAS0B09070 Chr2 complement(1741718..1743910) [2193 bp, 730 aa]
           {ON} Anc_1.9
          Length = 730

 Score =  637 bits (1643), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 317/680 (46%), Positives = 449/680 (66%), Gaps = 4/680 (0%)

Query: 12  LVPPQPPPVWNYTATEVIDLAYGLAQKSDAVYESVFSQKDEFTLDNYIWPLLYNDQETDL 71
           + P    P W ++   ++     +   +  +Y+S+ +  +E ++++ + P ++ + +  L
Sbjct: 51  VAPTGTAPTWKWSPESILAKTKEVIDNATNLYDSL-AAIEEPSVESLVKPYMHYENDEGL 109

Query: 72  LWNQLIFLRNVSPDPKVREASLSTGKILDQWVANISSKYDLYTNFEHIWTQYKDDEEFKV 131
           + NQL FL++VS D  +R+AS+   ++L  +    S + DL+  F+ IW Q KDD++ K 
Sbjct: 110 IVNQLTFLQHVSADKLIRDASVEATELLQDFSIEASMRLDLFQQFDKIWNQVKDDDDLKS 169

Query: 132 TNYELYKYMEKDASYYNRNKRNLTNAESIELGQVTRKISVDTLQFSINLGXXXXXXXXXX 191
            ++E YK++EK    Y RN  NL   +  ++  + +KI+ ++L +S NLG          
Sbjct: 170 KDFETYKFIEKVHKDYVRNGLNLPEEKRNQVKDIKKKIASNSLNYSKNLGEQKEYVSFTK 229

Query: 192 XXXXGVSPLVLDQFERIIEGGV--KKLKVTFKYPDIGPVLRTATNPETRRKAYVADQNRV 249
               GVS  V++QFE+ ++     +K KVTFKYPDI PVL+TA  P+TR+ AY++DQN+V
Sbjct: 230 EQLKGVSESVMEQFEKFVDPKTNEEKYKVTFKYPDIFPVLKTAQVPKTRKLAYISDQNKV 289

Query: 250 AANEQLLFETLDLRRRMAQLRGYKNYAEYNLRDKMAKNEETVIPFLTDLVERLLPVGEKD 309
             NE L  ETL LR ++AQL GY  YA YNL  KMAKN+ETV  F+ +L ++L P+G+K+
Sbjct: 290 PQNEALFVETLKLRNQLAQLLGYSTYANYNLDIKMAKNQETVFDFVNNLKDKLKPLGQKE 349

Query: 310 REILKSKKAEDYKSKNLTFDGEIYAWDNAYYNNKILQEKYQIDPEDMAQYFPIESVIEGM 369
            E LK+ K +D +   L +D   Y WD+ YY+NK L++ Y +D E +++Y+P+ES I+GM
Sbjct: 350 IETLKTLKKKDCEELGLAYDDHYYIWDHRYYDNKFLKDNYNVDLEQISEYYPLESTIKGM 409

Query: 370 LDTYQTLFRLKFVEVTDPSQKNVWHEDVKQFAVWNIDDEDCPEFQGWIYFDLYPRDGKYS 429
           L  Y+TL +LKFV+ T+P  K+VWHEDVKQ AVW +DDE  PEF GWIYFDL+PRDGKYS
Sbjct: 410 LGIYETLLKLKFVDETNPKIKDVWHEDVKQLAVWKMDDEKNPEFIGWIYFDLHPRDGKYS 469

Query: 430 HAANFGMASAFRKKDGSQSYPVTVLVCNLTKPTPTRTAILRPGEITTLFHELGHGIHHLV 489
           HAANFG++S++  +DG +S+PVT LVCN +K T  + ++L+  EITT FHELGHGIH LV
Sbjct: 470 HAANFGISSSYITQDGDRSFPVTALVCNFSKSTDKKPSLLKHNEITTFFHELGHGIHDLV 529

Query: 490 ANNKLAAHNSLGSVPWDFVEAPSQMLEYWTGRRDVLTMLSKHYETGEKIPPSLLDAWFNX 549
             NK A  N  G+ PWDFVEAPSQMLE+WT  ++ L  LS HY+TGEKI   LLD+    
Sbjct: 530 GKNKCARFNGPGATPWDFVEAPSQMLEFWTWNKNELLSLSGHYQTGEKISEDLLDSLIAT 589

Query: 550 XXXXXXXXXXXXXXXXXFDMYVH-TREYHGLEVRKLWNDMRREISLINSQNYTSTGYNTF 608
                            FDM VH T+    L + KLWN++R +I L+ + N  + GY++F
Sbjct: 590 KHVNGALFALRQLHFGLFDMTVHTTKNVEDLNLLKLWNELREKICLVENGNELTKGYDSF 649

Query: 609 GHIMTGSYSAGYYGYLWSQVFAADMYQTKFKSNPFNSTVGRQYRDTILAPGGLYDMNDNL 668
           GHIM+ SYSAGYYGY+W++VFAADMY TKF S+P NS  G QYRD +LA GGLY++ D L
Sbjct: 650 GHIMSDSYSAGYYGYMWAEVFAADMYYTKFASDPLNSQAGVQYRDIVLANGGLYEIADKL 709

Query: 669 RKFLGREPNNRAFLRGLGFN 688
           ++FLGREP N AFL+ LG +
Sbjct: 710 KEFLGREPTNDAFLKELGLH 729

>KNAG0C00260 Chr3 (39428..41662) [2235 bp, 744 aa] {ON} Anc_1.9
           YCL057W
          Length = 744

 Score =  632 bits (1631), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 317/685 (46%), Positives = 448/685 (65%), Gaps = 8/685 (1%)

Query: 12  LVPPQPP-PVWNYTATEVIDLAYGLAQKSDAVYESVFSQKDEFTLDNYIWPLLYNDQETD 70
           LVPP    P W + + ++ + A  + + ++  Y+ +    +  ++DN + P + ++    
Sbjct: 61  LVPPAGALPRWEFPSAKIGEEATRIIESTNKFYDELVEISNP-SIDNLVKPYMNHENSIG 119

Query: 71  LLWNQLIFLRNVSPDPKVREASLSTGKILDQWVANISSKYDLYTNFEHIWTQYK-DDEEF 129
           L+ NQL FL++VS D ++REAS    ++L  +    S ++DL+  F+ IW + K   EEF
Sbjct: 120 LMVNQLCFLQHVSSDKEIREASNKATELLQNFEIETSLRHDLFLQFDKIWKELKPRKEEF 179

Query: 130 K--VTNYELYKYMEKDASYYNRNKRNLTNAESIELGQVTRKISVDTLQFSINLGXXXXXX 187
                 +E+YK++EK    + R   NL+  +  ++  +  KI+ ++L+FS NLG      
Sbjct: 180 SHDEEQFEIYKFVEKCHKDFVRAGLNLSEEDRNKVKDIKIKIASNSLEFSKNLGEQKEFL 239

Query: 188 XXXXXXXXGVSPLVLDQFERIIEGGVKKL--KVTFKYPDIGPVLRTATNPETRRKAYVAD 245
                   GVS  V++QFE++ +    +   KVTFKYPDI PVL+ A N ETR+ A+  D
Sbjct: 240 LFSKEQLDGVSDTVMEQFEQVKDETTNETNYKVTFKYPDIFPVLKMAKNAETRKTAFCGD 299

Query: 246 QNRVAANEQLLFETLDLRRRMAQLRGYKNYAEYNLRDKMAKNEETVIPFLTDLVERLLPV 305
           QN+V  NE+L   TL LR  +A L GY  YA YNL  KMAK + TV  FL DL ++L P+
Sbjct: 300 QNKVPQNEELFVATLKLRDELATLLGYDTYANYNLEIKMAKKQSTVFKFLNDLKDKLKPL 359

Query: 306 GEKDREILKSKKAEDYKSKNLTFDGEIYAWDNAYYNNKILQEKYQIDPEDMAQYFPIESV 365
           GEK+  ILKS K  + K   + FDG  Y WD+ YY+ K L++ + +D E +A+Y+PI+S 
Sbjct: 360 GEKEIGILKSIKEAECKELGVPFDGRYYIWDHRYYDTKYLKDNFNVDHEAIAEYYPIDST 419

Query: 366 IEGMLDTYQTLFRLKFVEVTDPSQKNVWHEDVKQFAVWNIDDEDCPEFQGWIYFDLYPRD 425
           IEGML  Y+T+F+LKFVE  D ++KNVW+EDVKQ AVW +D+   P F GWIYFDL+PRD
Sbjct: 420 IEGMLKIYETVFKLKFVEEKDTAKKNVWNEDVKQIAVWKMDNVKTPVFVGWIYFDLHPRD 479

Query: 426 GKYSHAANFGMASAFRKKDGSQSYPVTVLVCNLTKPTPTRTAILRPGEITTLFHELGHGI 485
           GKY HAANFG+AS++ ++DGS+SYPVT LVCN +K + T+ ++L+  EITT FHELGHGI
Sbjct: 480 GKYGHAANFGIASSYIREDGSRSYPVTALVCNFSKSSATKPSLLKHNEITTFFHELGHGI 539

Query: 486 HHLVANNKLAAHNSLGSVPWDFVEAPSQMLEYWTGRRDVLTMLSKHYETGEKIPPSLLDA 545
           H LV  N+ A  N  G+ PWDFVEAPSQMLE++T  ++ L  LSKHY+TGE+IP  LLD+
Sbjct: 540 HDLVGKNRAARFNGPGATPWDFVEAPSQMLEFYTWDKNALQSLSKHYKTGEQIPEKLLDS 599

Query: 546 WFNXXXXXXXXXXXXXXXXXXFDMYVHT-REYHGLEVRKLWNDMRREISLINSQNYTSTG 604
                                FDM VHT ++   L++ KLW D+R+EISL+ +    + G
Sbjct: 600 LIATKHVNGALFALRQLHFGLFDMTVHTSKDVASLDLLKLWGDLRQEISLVENGGQYTKG 659

Query: 605 YNTFGHIMTGSYSAGYYGYLWSQVFAADMYQTKFKSNPFNSTVGRQYRDTILAPGGLYDM 664
           Y++FGHIM+ SYSAGYYGY+W++VFA DMY+TKF  NP +S+VG +YRD +LA GGLY++
Sbjct: 660 YDSFGHIMSDSYSAGYYGYMWAEVFATDMYRTKFAPNPLDSSVGMKYRDIVLANGGLYEI 719

Query: 665 NDNLRKFLGREPNNRAFLRGLGFNA 689
           +DNL++FLGREP+  AFL+ LG  A
Sbjct: 720 DDNLKEFLGREPSKDAFLKELGLQA 744

>Suva_3.156 Chr3 (234520..236658) [2139 bp, 712 aa] {ON} YCL057W
           (REAL)
          Length = 712

 Score =  627 bits (1616), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 308/677 (45%), Positives = 438/677 (64%), Gaps = 7/677 (1%)

Query: 15  PQPPPVWNYTATEVIDLAYGLAQKSDAVYESVFSQKDEFTLDNYIWPLLYNDQETDLLWN 74
           PQ PP W++T  ++      + +KS+  Y+S+ SQ +   + N++ P +  + E   + N
Sbjct: 37  PQTPPSWSFTPNDISGRTKEIIEKSNKFYDSM-SQVESPAVTNFVEPFMKFENELGPIIN 95

Query: 75  QLIFLRNVSPDPKVREASLSTGKILDQWVANISSKYDLYTNFEHIWTQYKDDEEFKVTNY 134
           QL FL++VS D ++R+AS+ +   LD+   ++S ++D++  F  +W   +   +      
Sbjct: 96  QLTFLQHVSSDKEIRDASVDSSMKLDELNIDLSLRHDVFLQFARVWQDAQSQAD--SIER 153

Query: 135 ELYKYMEKDASYYNRNKRNLTNAESIELGQVTRKISVDTLQFSINLGXXXXXXXXXXXXX 194
           E ++Y+EK    Y  +   L   + +++ ++ +KISV+++ FS NLG             
Sbjct: 154 ETFRYIEKSYKDYIHSGLELDEPDRLKVKEIKKKISVNSINFSKNLGEQKEFITFTKEQL 213

Query: 195 XGVSPLVLDQFERIIEGGVKK---LKVTFKYPDIGPVLRTATNPETRRKAYVADQNRVAA 251
            GV   +L QFE I  G        KVTFKYPDI PV++ A++ +TR++A++ADQN+V+ 
Sbjct: 214 EGVPDSILAQFETIESGKDSNETLYKVTFKYPDIFPVMKLASSSQTRKQAFLADQNKVSE 273

Query: 252 NEQLLFETLDLRRRMAQLRGYKNYAEYNLRDKMAKNEETVIPFLTDLVERLLPVGEKDRE 311
           NE +L +TL LR  +A L GY  YA YNL DKMAK+  TV+ FL DL ++L+P+GEK+ +
Sbjct: 274 NEAILLDTLKLRDEVASLLGYDTYANYNLYDKMAKDSTTVMDFLNDLKKKLIPLGEKELQ 333

Query: 312 ILKSKKAEDYKSKNLTFDGEIYAWDNAYYNNKILQEKYQIDPEDMAQYFPIESVIEGMLD 371
           IL+  KA+D K +N   D   Y WD+ YY+NK L E + +D E ++++FP+E+ I GML 
Sbjct: 334 ILQDMKAKDVKKRNQDEDPNYYIWDHRYYDNKYLLENFNVDLEKISEFFPLETTITGMLQ 393

Query: 372 TYQTLFRLKFVEVTDPSQKNVWHEDVKQFAVWNIDDEDCPEFQGWIYFDLYPRDGKYSHA 431
            Y+TLF LKF+E  +P +K+VWHEDVKQ AVWN+DD   P F GWIYFDL+PRDGKY HA
Sbjct: 394 IYETLFNLKFIETKNPQEKSVWHEDVKQLAVWNMDDPKSPRFIGWIYFDLHPRDGKYGHA 453

Query: 432 ANFGMASAFRKKDGSQSYPVTVLVCNLTKPTPTRTAILRPGEITTLFHELGHGIHHLVAN 491
           ANFG++S+F   D ++SYPVT LVCN +K T  + ++L+  EI T FHELGHGIH LV  
Sbjct: 454 ANFGLSSSFMVNDTTRSYPVTALVCNFSKSTKDKPSLLKHNEIVTFFHELGHGIHDLVGQ 513

Query: 492 NKLAAHNSLGSVPWDFVEAPSQMLEYWTGRRDVLTMLSKHYETGEKIPPSLLDAWFNXXX 551
           NK +  N  GSVPWDFVEAPSQMLE+WT  ++ L  LS HY+TGEKIP  L+D+      
Sbjct: 514 NKESRFNGPGSVPWDFVEAPSQMLEFWTWNKNELMHLSSHYKTGEKIPEPLIDSLIKTKH 573

Query: 552 XXXXXXXXXXXXXXXFDMYVHT-REYHGLEVRKLWNDMRREISLINSQNYTSTGYNTFGH 610
                          FDM VH+ ++   L +   WN +R++ISL+++    S GY +FGH
Sbjct: 574 VNGALFTLRQLHFGLFDMKVHSCKDLQNLSICDTWNQLRQDISLMSNGGTLSKGYASFGH 633

Query: 611 IMTGSYSAGYYGYLWSQVFAADMYQTKFKSNPFNSTVGRQYRDTILAPGGLYDMNDNLRK 670
           IM+ SYSAGYYGYLW++VFA DMY TKF  +P N+  G QYRD +LA GGL D+ND+L++
Sbjct: 634 IMSDSYSAGYYGYLWAEVFATDMYHTKFAKDPLNTKNGIQYRDIVLARGGLRDINDSLKE 693

Query: 671 FLGREPNNRAFLRGLGF 687
           FLGREP+  AFL+ LG 
Sbjct: 694 FLGREPSKDAFLKELGL 710

>KAFR0D00180 Chr4 (18900..21071) [2172 bp, 723 aa] {ON} Anc_1.9
           YCL057W
          Length = 723

 Score =  624 bits (1608), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 325/686 (47%), Positives = 441/686 (64%), Gaps = 9/686 (1%)

Query: 11  SLVPPQPPPVWNYTATEVIDLAYGLAQKSDAVYESVFSQKDEFTLDNYIWPLLYNDQETD 70
           + + PQ  P WN+  + ++  A  +   S+ +Y+ + S K   T++N + P + ++ +  
Sbjct: 41  AFIAPQAAPSWNWNPSRLLFDAECVIDNSNRLYDELSSLKKP-TVENLVRPYMIHENKIS 99

Query: 71  LLWNQLIFLRNVSPDPKVREASLSTGKILDQWVANISSKYDLYTNFEHIWTQY--KDDEE 128
            L N+L FL++VS DPK+REASL   ++L ++    S ++DL+  F+ IW +   K D+ 
Sbjct: 100 PLINKLCFLQHVSEDPKIREASLKATELLQKFEIEASLRHDLFLQFDKIWQEISEKKDDF 159

Query: 129 FKVTNYELYKYMEKDASYYNRNKRNLTNAESIELGQVTRKISVDTLQFSINLGXXXXXXX 188
            K  ++E +K++EK    Y R+  NL   +  ++ ++  KI  ++LQ+S NLG       
Sbjct: 160 VKEYDFETWKFIEKVHKDYVRSGLNLPEDKREKIKEIKIKIGNNSLQYSKNLGEQKELIA 219

Query: 189 XXXXXXXGVSPLVLDQFERII--EGGVKKLKVTFKYPDIGPVLRTATNPETRRKAYVADQ 246
                  GVS  V +QFE+ I  E G +K KVTFKYPDI PVL+TA NPETRRKA++ADQ
Sbjct: 220 FTREELDGVSDAVFEQFEKFIDEETGEEKFKVTFKYPDIFPVLKTAKNPETRRKAFLADQ 279

Query: 247 NRVAANEQLLFETLDLRRRMAQLRGYKNYAEYNLRDKMAKNEETVIPFLTDLVERLLPVG 306
           N+V  NE L  ETL LR  +A    Y  YA YNL +KMAK +ETV+ FL DL  RL P+ 
Sbjct: 280 NKVPQNEDLFVETLKLRNELATTLNYSTYANYNLEEKMAKRQETVLDFLNDLKYRLKPLA 339

Query: 307 EKDREILKSKKAEDYKSKNLTFDGEIYAWDNAYYNNKILQEKYQIDPEDMAQYFPIESVI 366
            K+  ILK  K ++ K  N  +D   Y +D+ YY+NK L++ + +D E +++Y+P+E  I
Sbjct: 340 MKEISILKDIKQKECKELNREYDSHYYIYDHRYYDNKYLKDNFNVDLEAISEYYPLEHTI 399

Query: 367 EGMLDTYQTLFRLKFVEVTDPSQKNVWHEDVKQFAVWNIDDEDCPEFQGWIYFDLYPRDG 426
            GML  Y+ LF+LKF E T    K+VWHEDVKQ AVW +D+ + PEF GWIYFDL+PRDG
Sbjct: 400 NGMLKIYEELFKLKFNEET--KNKSVWHEDVKQLAVWKMDNPEKPEFVGWIYFDLHPRDG 457

Query: 427 KYSHAANFGMASAFRK-KDGSQSYPVTVLVCNLTKPTPTRTAILRPGEITTLFHELGHGI 485
           KY HAANFG++S++   + G +SYPVT LVCN +K T TR ++L+  EITT FHELGHGI
Sbjct: 458 KYGHAANFGISSSYVDIETGKRSYPVTALVCNFSKSTATRPSLLKHNEITTFFHELGHGI 517

Query: 486 HHLVANNKLAAHNSLGSVPWDFVEAPSQMLEYWTGRRDVLTMLSKHYETGEKIPPSLLDA 545
           H LV  NKL+  N  G+ PWDFVEAPSQMLE+WT   + L  LS HYE+ EKIP  LL +
Sbjct: 518 HDLVGKNKLSRFNGPGATPWDFVEAPSQMLEFWTWNANELKSLSCHYESNEKIPDDLLTS 577

Query: 546 WFNXXXXXXXXXXXXXXXXXXFDMYVH-TREYHGLEVRKLWNDMRREISLINSQNYTSTG 604
                                FDM VH T     L + KLWN++R EI L+ + +  S G
Sbjct: 578 LIKTKHVNGALFALRQLHFGLFDMTVHTTNNVESLNLLKLWNELREEICLVETGHELSKG 637

Query: 605 YNTFGHIMTGSYSAGYYGYLWSQVFAADMYQTKFKSNPFNSTVGRQYRDTILAPGGLYDM 664
           Y++FGHIM+ SYSAGYYGY+W++VFAADMY TKF  NP +S VG QYRD +LA GGLY++
Sbjct: 638 YDSFGHIMSDSYSAGYYGYMWAEVFAADMYHTKFSPNPLDSEVGVQYRDIVLANGGLYEI 697

Query: 665 NDNLRKFLGREPNNRAFLRGLGFNAT 690
            DNLR FLGREP+  AFL+ LG +A 
Sbjct: 698 ADNLRDFLGREPSKNAFLKELGLDAA 723

>TPHA0E03970 Chr5 complement(834023..836266) [2244 bp, 747 aa] {ON}
           Anc_1.9 YCL057W
          Length = 747

 Score =  623 bits (1606), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 308/690 (44%), Positives = 448/690 (64%), Gaps = 14/690 (2%)

Query: 11  SLVPPQPPPVWNYTATEVIDLAYGLAQKSDAVYESVFSQKDEFTLDNYIWPLLYNDQETD 70
           + + PQ  P W+++   ++  A  +   S+  Y ++ + ++  +++N++ P +  + E  
Sbjct: 58  AFIAPQLSPKWDFSPERILSDAKKIIDTSNDFYNAMVAIENP-SIENFVIPSINFENENS 116

Query: 71  LLWNQLIFLRNVSPDPKVREASLSTGKILDQWVANISSKYDLYTNFEHIWTQYKDDEEFK 130
           L  NQL FL++VS D  +R+ASL   +++  +   IS +YD++  F+ I+   KD++++ 
Sbjct: 117 LAINQLTFLQHVSKDKLIRDASLEATELITNFDIEISLRYDMFKQFDKIFNDLKDNKKYN 176

Query: 131 ------VTNYELYKYMEKDASYYNRNKRNLTNAESIELGQVTRKISVDTLQFSINLGXXX 184
                   +YE++KY+EK    Y R+  NL+  +  E+ ++ ++I++++LQFS NLG   
Sbjct: 177 DLKTATPKDYEIFKYVEKCHKDYVRSGLNLSEEKRNEIKEIKKRIALNSLQFSKNLGEQN 236

Query: 185 XXXXXXXXXXXGVSPLVLDQFERII--EGGVKKLKVTFKYPDIGPVLRTATNPETRRKAY 242
                      GVS  V+ QFE     + G +K KVTFKYPDI PVL+TA NP TR+ A+
Sbjct: 237 EFVAFTKEELEGVSDDVMKQFETYTDEQTGEQKFKVTFKYPDIFPVLKTAKNPNTRKIAF 296

Query: 243 VADQNRVAANEQLLFETLDLRRRMAQLRGYKNYAEYNLRDKMAKNEETVIPFLTDLVERL 302
            ADQN+V  NE+L  +TL LR ++ ++ GY  YA YNL  KMAKN+ETV+ FL DL ++L
Sbjct: 297 NADQNKVPENEKLFIDTLKLRYQLGKILGYDTYANYNLDIKMAKNQETVMEFLVDLKDKL 356

Query: 303 LPVGEKDREILKSKKAEDYKSKNLTFDGEIYAWDNAYYNNKILQEKYQIDPEDMAQYFPI 362
            P+ EK+ E+LK+ K  + +  N+ +D   Y WD+ YY+NK L++K+ +D E +++Y+P+
Sbjct: 357 KPLAEKEIEVLKAIKKTEAQELNMAYDDHYYIWDHRYYDNKYLKDKFNVDLEKISEYYPV 416

Query: 363 ESVIEGMLDTYQTLFRLKFVEVTDPSQKNVWH-EDVKQFAVWNIDDEDCPEFQGWIYFDL 421
           ES I+GML  Y+T+  LKF+E TD   K+ W  +DVKQ AVW +DD   PEF GWIYFDL
Sbjct: 417 ESTIQGMLKIYETVMNLKFIEETDKDLKSTWAGDDVKQLAVWKMDDPSKPEFVGWIYFDL 476

Query: 422 YPRDGKYSHAANFGMASAFRKKDGSQSYPVTVLVCNLTKPTPTRTAILRPGEITTLFHEL 481
           +PR+GKY HAANFGMA ++  KD  + YPVT LVCN +  T  + A+L+  EITT FHEL
Sbjct: 477 HPREGKYGHAANFGMAPSYIDKDSKRIYPVTALVCNFSAATADKPALLKHNEITTFFHEL 536

Query: 482 GHGIHHLVANNKLAAHNSLGSVPWDFVEAPSQMLEYWTGRRDVLTMLSKHYETGEKIPPS 541
           GHGIH LV NN +   N  G+VPWDFVEAPSQMLE+WT  ++ L  LSKHY+TGEKIP S
Sbjct: 537 GHGIHDLVGNNGIGRFNGPGAVPWDFVEAPSQMLEFWTWNKNELLSLSKHYKTGEKIPES 596

Query: 542 LLDAWFNXXXXXXXXXXXXXXXXXXFDMYVHT----REYHGLEVRKLWNDMRREISLINS 597
           LL++                     FDM VHT     +   +++ +LWN +R EISL+ +
Sbjct: 597 LLESLIATKHVNGALFALRQLHFGLFDMKVHTTTDDNQIDNMDLVQLWNGLREEISLVEN 656

Query: 598 QNYTSTGYNTFGHIMTGSYSAGYYGYLWSQVFAADMYQTKFKSNPFNSTVGRQYRDTILA 657
            +  + GY++FGHIM+ SYSAGYYGY+W++VFA DMY +KF  +P N+  G +YRD ILA
Sbjct: 657 GDEMNKGYDSFGHIMSDSYSAGYYGYMWAEVFATDMYYSKFAKDPLNTKSGIEYRDIILA 716

Query: 658 PGGLYDMNDNLRKFLGREPNNRAFLRGLGF 687
            GG+ + NDNL++FLGREP+  AFL+ LG 
Sbjct: 717 RGGIRETNDNLKEFLGREPSKEAFLKELGL 746

>Smik_3.18 Chr3 (26213..28351) [2139 bp, 712 aa] {ON} YCL057W (REAL)
          Length = 712

 Score =  621 bits (1602), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 316/681 (46%), Positives = 439/681 (64%), Gaps = 11/681 (1%)

Query: 13  VPPQPPPVWNYTATEVIDLAYGLAQKSDAVYESVFSQKDEFTLDNYIWPLLYNDQETDLL 72
           + PQ PP W +T  ++      +  KS+  YES+ S  +  T+ N++ P +  + E   +
Sbjct: 35  IAPQAPPNWTFTPNDINGKTKEIIDKSNNFYESM-SNVETPTVTNFVEPFMKFENELGPI 93

Query: 73  WNQLIFLRNVSPDPKVREASLSTGKILDQWVANISSKYDLYTNFEHIW--TQYKDDEEFK 130
            NQL FL++VS D ++R+AS+++   LD+   ++S ++D+Y  F  +W   Q K D    
Sbjct: 94  INQLTFLQHVSSDKEIRDASVNSSMKLDELNIDLSLRHDIYLQFARVWQDAQSKSDS--- 150

Query: 131 VTNYELYKYMEKDASYYNRNKRNLTNAESIELGQVTRKISVDTLQFSINLGXXXXXXXXX 190
               E +KY+EK    Y  +   L  +  +++  + +KISV+++ FS NLG         
Sbjct: 151 -IERETFKYIEKSYKDYIHSGLELDESNRLKIKDIKKKISVNSINFSKNLGEQKEYITFT 209

Query: 191 XXXXXGVSPLVLDQFERIIEGGVKK---LKVTFKYPDIGPVLRTATNPETRRKAYVADQN 247
                GV   VL QFE I     +     KVTFKYPDI PV++ A++ +TR++A++ADQN
Sbjct: 210 KEQLEGVPDSVLAQFETIKSDKDRNETLYKVTFKYPDIFPVMKLASSAQTRKEAFLADQN 269

Query: 248 RVAANEQLLFETLDLRRRMAQLRGYKNYAEYNLRDKMAKNEETVIPFLTDLVERLLPVGE 307
           +V  NE +L +TL+LR ++A L GY  YA YNL DKMAK+  TV+ FL DL ++L+P+G+
Sbjct: 270 KVPENEAILLDTLELRDKLASLLGYDTYANYNLYDKMAKDSTTVMDFLNDLKDKLIPLGK 329

Query: 308 KDREILKSKKAEDYKSKNLTFDGEIYAWDNAYYNNKILQEKYQIDPEDMAQYFPIESVIE 367
           K+ E+L+  K++D K  N   D   Y WD+ YY+NK L E + +D E +++YFP+E+ I 
Sbjct: 330 KELELLQEMKSKDVKKLNQDEDPNYYIWDHRYYDNKYLLENFNVDLEKISEYFPLETTIT 389

Query: 368 GMLDTYQTLFRLKFVEVTDPSQKNVWHEDVKQFAVWNIDDEDCPEFQGWIYFDLYPRDGK 427
           GML  Y+TLF LKF+E+ D   K+VWH+DVKQ AVWN+DD   P+F GWIYFDL+PRDGK
Sbjct: 390 GMLQIYETLFNLKFIEIKDGQSKSVWHDDVKQLAVWNMDDPKSPKFVGWIYFDLHPRDGK 449

Query: 428 YSHAANFGMASAFRKKDGSQSYPVTVLVCNLTKPTPTRTAILRPGEITTLFHELGHGIHH 487
           Y HAANFG++S+F   D  +SYPVT LVCN +K T  + ++L+  EI T FHELGHGIH 
Sbjct: 450 YGHAANFGLSSSFMTNDSVRSYPVTALVCNFSKSTKDKPSLLKHNEIVTFFHELGHGIHD 509

Query: 488 LVANNKLAAHNSLGSVPWDFVEAPSQMLEYWTGRRDVLTMLSKHYETGEKIPPSLLDAWF 547
           LV  NK +  N  GSVPWDFVEAPSQMLE+WT  ++ L  LS HYETGEKIP SL+D+  
Sbjct: 510 LVGQNKESRFNGPGSVPWDFVEAPSQMLEFWTWNKNELIDLSSHYETGEKIPESLIDSLI 569

Query: 548 NXXXXXXXXXXXXXXXXXXFDMYVHT-REYHGLEVRKLWNDMRREISLINSQNYTSTGYN 606
                              FDM VHT ++   L + + WN +R++ISLI++    S GY+
Sbjct: 570 KTKHVNGALFTLRQLHFGLFDMKVHTCKDLQNLSICETWNQLRQDISLISNGGTLSKGYD 629

Query: 607 TFGHIMTGSYSAGYYGYLWSQVFAADMYQTKFKSNPFNSTVGRQYRDTILAPGGLYDMND 666
           +FGHIM+ SYSAGYYGYLW++VFA DMY TKF  +P N+  G QYRD +LA GGL D+ D
Sbjct: 630 SFGHIMSDSYSAGYYGYLWAEVFATDMYHTKFAKDPLNTKNGIQYRDIVLARGGLNDIGD 689

Query: 667 NLRKFLGREPNNRAFLRGLGF 687
           +L+KFLGREP+  AFL+ LG 
Sbjct: 690 DLKKFLGREPSKDAFLKELGL 710

>Skud_3.7 Chr3 (12763..14901) [2139 bp, 712 aa] {ON} YCL057W (REAL)
          Length = 712

 Score =  619 bits (1595), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/683 (45%), Positives = 441/683 (64%), Gaps = 11/683 (1%)

Query: 13  VPPQPPPVWNYTATEVIDLAYGLAQKSDAVYESVFSQKDEFTLDNYIWPLLYNDQETDLL 72
           + PQ PP W++T T++      +  KS+  YE + SQ +  ++ N+I P +  + E   +
Sbjct: 35  IAPQAPPTWSFTPTDIGGKTTEIIDKSNKFYE-LMSQVESPSVTNFIEPFMKFENELGPI 93

Query: 73  WNQLIFLRNVSPDPKVREASLSTGKILDQWVANISSKYDLYTNFEHIW--TQYKDDEEFK 130
            N+L FL++VS D ++R+AS+ +   LD+   ++S ++D++  F  +W   Q K D   K
Sbjct: 94  INRLTFLQHVSSDKEIRDASVDSSMKLDELNIDLSLRHDIFLQFARVWQDAQPKADSLKK 153

Query: 131 VTNYELYKYMEKDASYYNRNKRNLTNAESIELGQVTRKISVDTLQFSINLGXXXXXXXXX 190
               E +KY+EK    +  +   L  A  +++ ++ +KIS++++ FS NLG         
Sbjct: 154 ----ETFKYIEKSYKDFIHSGLELDEANRLKIKEIKKKISMNSINFSKNLGEQKEYITFT 209

Query: 191 XXXXXGVSPLVLDQFE--RIIEGGVKKL-KVTFKYPDIGPVLRTATNPETRRKAYVADQN 247
                GV   +L QFE  +  +GG   L KVTFKYPDI PV++ A++ +TR++A++ADQN
Sbjct: 210 KEQLEGVPDSILAQFETTKSEKGGEDTLYKVTFKYPDIFPVMKLASSAQTRKQAFLADQN 269

Query: 248 RVAANEQLLFETLDLRRRMAQLRGYKNYAEYNLRDKMAKNEETVIPFLTDLVERLLPVGE 307
           +V  NE +L +TL LR  +A L GY  YA+YNL DKMAK+  TV+ FL DL  +L+P+G+
Sbjct: 270 KVPENEAILLDTLKLRDELASLLGYNTYADYNLYDKMAKDSRTVMDFLNDLKGKLIPLGK 329

Query: 308 KDREILKSKKAEDYKSKNLTFDGEIYAWDNAYYNNKILQEKYQIDPEDMAQYFPIESVIE 367
           K+ ++L+  K +D +      D   Y WD+ YY+NK L E + +D E +++YFP+E+ I 
Sbjct: 330 KELQVLQDMKVKDVERSKKDEDPNYYIWDHRYYDNKHLLENFNVDLEKISEYFPLETTIT 389

Query: 368 GMLDTYQTLFRLKFVEVTDPSQKNVWHEDVKQFAVWNIDDEDCPEFQGWIYFDLYPRDGK 427
           GML  Y+TLF LKF+E  +P  K+VWHEDVKQ AVWN+DD   P F GWIYFDL+PRDGK
Sbjct: 390 GMLQIYETLFNLKFIETKEPQNKSVWHEDVKQLAVWNMDDPKSPRFIGWIYFDLHPRDGK 449

Query: 428 YSHAANFGMASAFRKKDGSQSYPVTVLVCNLTKPTPTRTAILRPGEITTLFHELGHGIHH 487
           Y HAANFG++S+F   D  +SYPVT LVCN +K T  + ++L+  EI T FHELGHGIH 
Sbjct: 450 YGHAANFGLSSSFMINDSKRSYPVTALVCNFSKSTKDKPSLLKHNEIVTFFHELGHGIHD 509

Query: 488 LVANNKLAAHNSLGSVPWDFVEAPSQMLEYWTGRRDVLTMLSKHYETGEKIPPSLLDAWF 547
           LV  NK +  N  GSVPWDFVEAPSQMLE+WT  ++ L  LS HY+TGE+IP SL+D+  
Sbjct: 510 LVGQNKESRFNGPGSVPWDFVEAPSQMLEFWTWNKNELVSLSSHYKTGERIPESLIDSLI 569

Query: 548 NXXXXXXXXXXXXXXXXXXFDMYVHT-REYHGLEVRKLWNDMRREISLINSQNYTSTGYN 606
                              FDM VHT ++   L +   WN +R+EISL+ +    S GY+
Sbjct: 570 KTKHVNGALFTLRQLHFGLFDMKVHTCKDLENLSICHTWNQLRQEISLMPNGGTLSKGYD 629

Query: 607 TFGHIMTGSYSAGYYGYLWSQVFAADMYQTKFKSNPFNSTVGRQYRDTILAPGGLYDMND 666
           +FGHIM+ SYSAGYYGYLW++VFA DMY TKF  +P N+  G QYRD +LA GGLYD+ND
Sbjct: 630 SFGHIMSDSYSAGYYGYLWAEVFATDMYHTKFAKDPLNTKNGVQYRDIVLARGGLYDIND 689

Query: 667 NLRKFLGREPNNRAFLRGLGFNA 689
           NL++FLGREP+  AFL+ LG  +
Sbjct: 690 NLKEFLGREPSKDAFLKELGLQS 712

>TBLA0A07560 Chr1 complement(1871629..1873854) [2226 bp, 741 aa]
           {ON} Anc_1.9 YCL057W
          Length = 741

 Score =  619 bits (1595), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/688 (45%), Positives = 449/688 (65%), Gaps = 14/688 (2%)

Query: 11  SLVPPQPPPVWNYTATEVIDLAYGLAQKSDAVYESVFSQKDEFTLDNYIWPLLYNDQETD 70
           +L  PQ  P WN+T ++++  A  L  +S+  Y+++ + K     +N++ P +  + +  
Sbjct: 58  NLNAPQAAPTWNWTPSQLVKDAEDLIDQSNHFYDALTNLKSP-DFNNFLVPYMNYENKVG 116

Query: 71  LLWNQLIFLRNVSPDPKVREASLSTGKILDQWVANISSKYDLYTNFEHIWTQYKDDEEF- 129
            L NQL FL++VS +  +R+AS     +L  +    S +Y L+  F+ IW Q KD ++  
Sbjct: 117 SLINQLTFLQHVSSEKDIRDASFKATDLLQNFEIETSLRYGLFLQFDKIWNQIKDSKDKY 176

Query: 130 -----KVTNYELYKYMEKDASYYNRNKRNLTNAESIELGQVTRKISVDTLQFSINLGXXX 184
                 + NYE  + + +D   + R   NL  ++  ++ ++ + I+ ++L+F+ NLG   
Sbjct: 177 EKDPKDLENYEFVRKVHRD---FVRAGLNLDESKREKIKEIKKAIANNSLKFATNLGEQT 233

Query: 185 XXXXXXXXXXXGVSPLVLDQFERIIE--GGVKKLKVTFKYPDIGPVLRTATNPETRRKAY 242
                      GVS  V++QFE+  +   G +  KVTFKYPDI PVL+TA NPETR+KA+
Sbjct: 234 EFVAFTKEELDGVSDSVMEQFEKFNDEKTGKEMYKVTFKYPDIFPVLKTARNPETRKKAF 293

Query: 243 VADQNRVAANEQLLFETLDLRRRMAQLRGYKNYAEYNLRDKMAKNEETVIPFLTDLVERL 302
             DQN+V+ N  L   TL LR ++A + GY  YA YNL  KMAK +++V  FL DL++RL
Sbjct: 294 AGDQNKVSENTVLFTNTLKLRNQLADILGYSTYANYNLELKMAKAQDSVFKFLEDLIDRL 353

Query: 303 LPVGEKDREILKSKKAEDYKSKNLTFDGEIYAWDNAYYNNKILQEKYQIDPEDMAQYFPI 362
            P+G K+ EILKS K +++K  NL FD   Y WD+ YY+NK L++ Y +D E +++Y+P+
Sbjct: 354 KPLGSKEIEILKSIKEKEFKELNLPFDNHYYVWDHRYYDNKYLKDNYNVDLEKISEYYPL 413

Query: 363 ESVIEGMLDTYQTLFRLKFVEVTDPSQ-KNVWHEDVKQFAVWNIDDEDCPEFQGWIYFDL 421
           +S IEGML+ Y+TL  LKF+E  D S+ KNVWH++VKQ AVW +D+ + PEF GWIYFDL
Sbjct: 414 DSTIEGMLNIYETLLNLKFIEEKDDSKNKNVWHKEVKQLAVWKMDNPENPEFVGWIYFDL 473

Query: 422 YPRDGKYSHAANFGMASAFRKKDGSQSYPVTVLVCNLTKPTPTRTAILRPGEITTLFHEL 481
           +PRDGKY HAANFG++S++ K +  +SYPVT LVCN +K T  + A+L+  EITT FHEL
Sbjct: 474 HPRDGKYGHAANFGISSSYIKPNNERSYPVTALVCNFSKVTADKPALLKHNEITTFFHEL 533

Query: 482 GHGIHHLVANNKLAAHNSLGSVPWDFVEAPSQMLEYWTGRRDVLTMLSKHYETGEKIPPS 541
           GHGIH LV  N  +  N  G+VPWDFVEAPSQMLE+WT  ++ L  LSKHY+TGEKIP  
Sbjct: 534 GHGIHDLVGKNNNSRFNGPGAVPWDFVEAPSQMLEFWTWNKNELLSLSKHYKTGEKIPTE 593

Query: 542 LLDAWFNXXXXXXXXXXXXXXXXXXFDMYVHT-REYHGLEVRKLWNDMRREISLINSQNY 600
           LL++                     FDM VHT ++   L+  KLWN++R E+SL+ + + 
Sbjct: 594 LLNSLVATKHVNGALFALRQLHFGLFDMKVHTSKDLENLDFLKLWNELREEVSLVENGDL 653

Query: 601 TSTGYNTFGHIMTGSYSAGYYGYLWSQVFAADMYQTKFKSNPFNSTVGRQYRDTILAPGG 660
            + GY++FGHIM+ SYSAGYYGY+W++VFA DMY TKF +NP  + VG +YRD +LA GG
Sbjct: 654 FTKGYDSFGHIMSDSYSAGYYGYMWAEVFATDMYYTKFAANPLETKVGVEYRDWVLARGG 713

Query: 661 LYDMNDNLRKFLGREPNNRAFLRGLGFN 688
           LY++ DNL +FLGR+P+N AFL+ LG N
Sbjct: 714 LYEIEDNLIQFLGRKPSNEAFLKELGLN 741

>YCL057W Chr3 (24768..26906) [2139 bp, 712 aa] {ON}  PRD1Zinc
           metalloendopeptidase, found in the cytoplasm and
           intermembrane space of mitochondria; with Cym1p,
           involved in degradation of mitochondrial proteins and of
           presequence peptides cleaved from imported proteins
          Length = 712

 Score =  616 bits (1589), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 311/681 (45%), Positives = 439/681 (64%), Gaps = 11/681 (1%)

Query: 13  VPPQPPPVWNYTATEVIDLAYGLAQKSDAVYESVFSQKDEFTLDNYIWPLLYNDQETDLL 72
           + PQ PP W++T +++      +   S+  Y+S+ S+ +  ++ N++ P +  + E   +
Sbjct: 35  IAPQAPPNWSFTPSDISGKTNEIINNSNNFYDSM-SKVESPSVSNFVEPFMKFENELGPI 93

Query: 73  WNQLIFLRNVSPDPKVREASLSTGKILDQWVANISSKYDLYTNFEHIW--TQYKDDEEFK 130
            NQL FL++VS D ++R+AS+++   LD+   ++S ++D++  F  +W   Q K D    
Sbjct: 94  INQLTFLQHVSSDKEIRDASVNSSMKLDELNIDLSLRHDIFLQFARVWQDVQSKADS--- 150

Query: 131 VTNYELYKYMEKDASYYNRNKRNLTNAESIELGQVTRKISVDTLQFSINLGXXXXXXXXX 190
               E +KY+EK    Y  +   L     +++ ++ +KISV+++ FS NLG         
Sbjct: 151 -VERETFKYVEKSYKDYIHSGLELDEGNRLKIKEIKKKISVNSINFSKNLGEQKEYITFT 209

Query: 191 XXXXXGVSPLVLDQFERII---EGGVKKLKVTFKYPDIGPVLRTATNPETRRKAYVADQN 247
                GV   +L QFE I    +      KVTFKYPDI PV++ A++ +TR++A++ADQN
Sbjct: 210 KEQLEGVPDSILTQFETIKSDKDSNETLYKVTFKYPDIFPVMKLASSAQTRKQAFLADQN 269

Query: 248 RVAANEQLLFETLDLRRRMAQLRGYKNYAEYNLRDKMAKNEETVIPFLTDLVERLLPVGE 307
           +V  NE +L +TL LR  +A L GY  YA YNL DKMA++  TV+ FL DL ++L+P+G 
Sbjct: 270 KVPENEAILLDTLKLRDELASLLGYDTYANYNLYDKMAEDSTTVMNFLNDLKDKLIPLGR 329

Query: 308 KDREILKSKKAEDYKSKNLTFDGEIYAWDNAYYNNKILQEKYQIDPEDMAQYFPIESVIE 367
           K+ ++L+  KAED K  N   D   Y WD+ YY+NK L E + +D E +++YFP+E+ I 
Sbjct: 330 KELQVLQDMKAEDVKKLNQGADPNYYIWDHRYYDNKYLLENFNVDLEKISEYFPLEATIT 389

Query: 368 GMLDTYQTLFRLKFVEVTDPSQKNVWHEDVKQFAVWNIDDEDCPEFQGWIYFDLYPRDGK 427
           GML+ Y+TLF LKF+E  D   K+VWH+DVKQ AVWN+DD   P F GWIYFDL+PRDGK
Sbjct: 390 GMLEIYETLFNLKFIETKDSQNKSVWHDDVKQIAVWNMDDPKSPNFVGWIYFDLHPRDGK 449

Query: 428 YSHAANFGMASAFRKKDGSQSYPVTVLVCNLTKPTPTRTAILRPGEITTLFHELGHGIHH 487
           Y HAANFG++S+F   D ++SYPVT LVCN +K T  + ++L+  EI T FHELGHGIH 
Sbjct: 450 YGHAANFGLSSSFMIDDTTRSYPVTALVCNFSKSTKDKPSLLKHNEIVTFFHELGHGIHD 509

Query: 488 LVANNKLAAHNSLGSVPWDFVEAPSQMLEYWTGRRDVLTMLSKHYETGEKIPPSLLDAWF 547
           LV  NK +  N  GSVPWDFVEAPSQMLE+WT  ++ L  LS HY+TGEKIP SL+++  
Sbjct: 510 LVGQNKESRFNGPGSVPWDFVEAPSQMLEFWTWNKNELINLSSHYKTGEKIPESLINSLI 569

Query: 548 NXXXXXXXXXXXXXXXXXXFDMYVHT-REYHGLEVRKLWNDMRREISLINSQNYTSTGYN 606
                              FDM VHT ++   L +   WN +R++ISLI++    S GY+
Sbjct: 570 KTKHVNGALFTLRQLHFGLFDMKVHTCKDLQNLSICDTWNQLRQDISLISNGGTLSKGYD 629

Query: 607 TFGHIMTGSYSAGYYGYLWSQVFAADMYQTKFKSNPFNSTVGRQYRDTILAPGGLYDMND 666
           +FGHIM+ SYSAGYYGYLW++VFA DMY TKF  +P N+  G QYRD +LA GGLYD+ND
Sbjct: 630 SFGHIMSDSYSAGYYGYLWAEVFATDMYHTKFAKDPLNAKNGIQYRDIVLARGGLYDIND 689

Query: 667 NLRKFLGREPNNRAFLRGLGF 687
           NL++FLGREP+  AFL+ LG 
Sbjct: 690 NLKEFLGREPSKDAFLKELGL 710

>CAGL0B00418g Chr2 (26584..28815) [2232 bp, 743 aa] {ON} similar to
           uniprot|P25375 Saccharomyces cerevisiae YCL057w PRD1
           proteinase yscD
          Length = 743

 Score =  613 bits (1582), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 309/683 (45%), Positives = 448/683 (65%), Gaps = 9/683 (1%)

Query: 11  SLVPPQPPPVWNYTATEVIDLAYGLAQKSDAVYESVFSQKDEFTLDNYIWPLLYNDQETD 70
           SL PPQ PP W +   +++         +   Y+ + +  D  T++N I P + ++ E +
Sbjct: 65  SLTPPQYPPSWEFKPEDILSQTKEFIANTKLFYDDLVAI-DNPTIENLIVPYINHENENE 123

Query: 71  LLWNQLIFLRNVSPDPKVREASLSTGKILDQWVANISSKYDLYTNFEHIWTQYKDDEEFK 130
           LL NQL FL++VS D  +R+AS+    +L  +     S+ DL+  F+ IW Q KD ++ +
Sbjct: 124 LLINQLTFLQHVSEDKTIRDASMEATMLLQDFEIESGSRVDLFKQFDLIWNQIKDKKD-E 182

Query: 131 VTNYELYKYMEKDASYYNRNKRNLTNAESIELGQVTRKISVDTLQFSINLGXXXXXXXXX 190
             ++E+++++EK    Y R   NL   +  ++ ++ +KI+ + L+FS NLG         
Sbjct: 183 FEDFEIWRFVEKCHKDYVRAGLNLPADKLEKVKEIKKKIADNCLKFSKNLGEQKEYILFT 242

Query: 191 XXXXXGVSPLVLDQFERI-IEGGVKKLKVTFKYPDIGPVLRTATNPETRRKAYVADQNRV 249
                GV   V++QFE++  E G++KLKVT+KYPDI PVL+ A NPETR KA++ DQN+V
Sbjct: 243 AEELKGVPESVIEQFEKVNDEFGIQKLKVTYKYPDIFPVLKNAQNPETRMKAFMGDQNKV 302

Query: 250 AANEQLLFETLDLRRRMAQLRGYKNYAEYNLRDKMAKNEETVIPFLTDLVERLLPVGEKD 309
             NE L  +TL LR  +A + GY  YA YNL  KMAKN +TV+ F+ DL+ +L    +K+
Sbjct: 303 PENEHLFKDTLKLRNELALVLGYDTYANYNLDIKMAKNADTVLSFVNDLIVKLQDPAKKE 362

Query: 310 REILKSKKAEDYKSK-NLTFDGEIYAWDNAYYNNKILQEKYQIDPEDMAQYFPIESVIEG 368
            +ILK+ K ++++++ N+ +DG+ Y WD+ YY+NK L+E + +D E +A+Y+P+ES I+G
Sbjct: 363 LDILKNLKKQEFENEFNMVYDGDYYIWDHRYYDNKYLKENFNVDEEKIAEYYPLESTIDG 422

Query: 369 MLDTYQTLFRLKFVEVTDPSQKNVWHEDVKQFAVWNIDDEDCPEFQGWIYFDLYPRDGKY 428
           ML  Y+TL +LKFVEV +   K  WH+DVKQ AVW +D  + PEF GWI+FDL+PRDGKY
Sbjct: 423 MLKIYETLLKLKFVEVKE--NKKTWHDDVKQLAVWKLDTPENPEFVGWIFFDLHPRDGKY 480

Query: 429 SHAANFGMASAFRKKDGSQSYPVTVLVCNLTKPTPTRTAILRPGEITTLFHELGHGIHHL 488
            HAANFG++S++   +G++SYP+T LVCN +K T  + ++L+  EITT FHELGHGIH L
Sbjct: 481 GHAANFGLSSSYISANGTRSYPITALVCNFSKSTKDKPSLLKHSEITTFFHELGHGIHDL 540

Query: 489 VANNKLAAHNSLGSVPWDFVEAPSQMLEYWTGRRDVLTMLSKHYETGEKIPPSLLDAWFN 548
           V NN++   N  G+VPWDFVEAPSQMLE+WT     L  LS++Y+   KI   LL++   
Sbjct: 541 VGNNRIGRFNGPGAVPWDFVEAPSQMLEFWTWNTKELLSLSQNYKDNAKIDTKLLESLIK 600

Query: 549 XXXXXXXXXXXXXXXXXXFDMYVH---TREYHGLEVRKLWNDMRREISLINSQNYTSTGY 605
                             FDM VH     E   L+++KLWND+R +I LI++ +  +TGY
Sbjct: 601 TKHVNGALFALRQLHFGLFDMKVHMMSAEELDKLDIKKLWNDLREKICLISNGDQPTTGY 660

Query: 606 NTFGHIMTGSYSAGYYGYLWSQVFAADMYQTKFKSNPFNSTVGRQYRDTILAPGGLYDMN 665
           N+FGHIM+GSYSAGYYGY+W++VFA DMY TKFK++P N  VG +YRD +LA GGLY+++
Sbjct: 661 NSFGHIMSGSYSAGYYGYMWAEVFATDMYYTKFKADPLNPEVGVKYRDIVLARGGLYEID 720

Query: 666 DNLRKFLGREPNNRAFLRGLGFN 688
           DNL +FLGR+P   AFL  LG +
Sbjct: 721 DNLEEFLGRKPAKDAFLEELGLH 743

>ABR185W Chr2
           (758126..758380,758380..758709,758709..759029,
           759033..759122,759122..759499) [1374 bp, 457 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YCL057W
           (PRD1); 3-intron; artificial frameshift
          Length = 457

 Score =  377 bits (969), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 196/414 (47%), Positives = 260/414 (62%), Gaps = 8/414 (1%)

Query: 276 AEYNLRDKMAKNEETVIPFLTDLVERLLPVGEKDREILKSKKAEDYKSKNLTFDGEIYAW 335
           A Y L  K AKN + V  FL DL E+L P    +   LK  K ++ K     +DGE+Y+ 
Sbjct: 49  AAYVLEVKTAKNVDNVNSFLNDLREKLKPASADNWRPLKKLKEQECKELGNFYDGELYSQ 108

Query: 336 DNAYYNNKILQEKYQIDPEDMAQYFPIESVIEGMLDTYQTLFRLKFVEVTDPSQKNVWHE 395
           D  YY  K+L++ + +D E+ AQYFP+E  I+ MLDTY TLFR  FVE T+P+ +NVWHE
Sbjct: 109 DLCYYEQKLLRDNFSVDEEETAQYFPLEHTIKFMLDTYNTLFRHNFVEETEPATRNVWHE 168

Query: 396 DVKQFAVWNIDDEDCPEFQGWIYFDLYPRDGKYSHAANFGMASAFRKKDGSQSYPVTVLV 455
           D KQ++VW +DD D P+F GW+YFDL+PRDGK+ H A F        ++GS+ YPVT LV
Sbjct: 169 DDKQYSVWKMDDWDAPQFTGWLYFDLHPRDGKFGHLACFDNVYTDMSEEGSRVYPVTSLV 228

Query: 456 CNLTKPTPTRTAILRPGEITTLFHELGHGIHHLVANNKLAAHNSLGSVPWDFVEAPSQML 515
           CN + P+  + A+L+  E+   FHELGHG H L+   +L   +S   VP DF+EAPSQML
Sbjct: 229 CNFSNPSKEKPALLKHYEVQAFFHELGHGSHKLLCAPELCCSSSW--VPRDFIEAPSQML 286

Query: 516 EYWTGRRDVLTMLSKHYETGEKIPPSLLDAWFNXXXXXXXXXXXXXXXXXXFDMYVHTR- 574
           EYW  R+DV+T LSKH ETGE+IP SL+D                       DM VH   
Sbjct: 287 EYWIWRKDVITDLSKH-ETGERIPESLVDCMVK-SKRANAAIDNLIQVLALLDMAVHKHV 344

Query: 575 -EYHGLEVRKLWNDMRREISLINSQNYTSTGYNTFGHIMTGSYSAGYYGYLWSQVFAADM 633
             Y  L++  LWN++  ++ LI +   T   Y +F HI+ G Y+AGYYGY WS+VFAADM
Sbjct: 345 GSYETLDLNALWNNLCEDVILIKNPEPTR-AYCSFSHIVEG-YAAGYYGYQWSKVFAADM 402

Query: 634 YQTKFKSNPFNSTVGRQYRDTILAPGGLYDMNDNLRKFLGREPNNRAFLRGLGF 687
           Y ++F+    + T+G+ Y DTI+A GGLY+M DNL +FL REPNN A+LR  G 
Sbjct: 403 YFSRFEKAHLDPTLGKLYGDTIIARGGLYEMEDNLGEFLDREPNNEAYLRDQGL 456

>Kpol_297.8 s297 complement(11648..14011) [2364 bp, 787 aa] {ON}
           complement(11648..14011) [2364 nt, 788 aa]
          Length = 787

 Score =  196 bits (497), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 173/646 (26%), Positives = 286/646 (44%), Gaps = 73/646 (11%)

Query: 67  QETDLLWNQLI-------FLRNVSPDPKVREASLSTGKILDQWVANISSKYDLYTNFEHI 119
           Q  DLL + L        F+R+  PD K  EA+    + + +++  +++  +L    +H+
Sbjct: 135 QNLDLLSDTLCRVIDLCEFIRSSHPDYKFVEAAQDCYEEMFEFMNMLNTDVNLCFTLKHV 194

Query: 120 WTQYK-----DDEEFKVTNYELYKYMEKDASYYNRNKRNLTNAESIELGQVTRKISVDTL 174
               +      +EE +V    L  + EK   Y     R     + I L Q    I  + +
Sbjct: 195 LENKEIASKLSEEELRVGRILLEDF-EKSGIYMKPEVRE----QFITLSQSISVIGQEFI 249

Query: 175 QFSINLGXXXXXXXXXXXXXXGVSPLVLDQFERIIEGGVKKLKVTFKYPDIG----PVLR 230
             +  +               G+ P +L Q E+ I G        +K P  G     +L+
Sbjct: 250 SNTDFVKDNNVVVSCNQLDSLGIDPELLSQIEKDIAGK------NYKIPTYGYIPFALLK 303

Query: 231 TATNPETRRKAYVADQNRVAANEQL--LFETLDLRRRMAQLRGYKNYAEYNLRDKMAKNE 288
           +  + E R K +VA  N   +NEQ+  L + + LR  ++QL G K+YAEY L  KMAKN 
Sbjct: 304 SCPSEEIREKIWVAVHN--CSNEQIKRLTDLVKLRAVLSQLLGKKSYAEYQLEGKMAKNP 361

Query: 289 ETVIPFLTDLVERLLPVGEKDREILKSKKAE-DYKSKNLTFD---GEIYAWDNAYYN--- 341
           + VI F+  L++   P+  K+ + +  KK        NL+       +  WD  YY+   
Sbjct: 362 KEVIEFIKTLMDFTKPMAAKELDGIAEKKLTIKSNGSNLSVCDILKTVRPWDRDYYSAIE 421

Query: 342 NKILQEKYQIDPEDMAQYFPIESVIEGMLDTYQTLFRLKFVEVTDPSQKNVWHEDVKQFA 401
            +    K     E++ +YF + +V++G+ + +Q ++ +K +E+  P     W  +V++  
Sbjct: 422 REQTSAKNLYGSEEVLKYFTLGNVMQGLSNLFQKIYGIK-LELDVPKIGETWSPEVRKIN 480

Query: 402 VWNIDDEDCPEFQGWIYFDLYPRDGKYSHAANFGMAS----------------AFRKKDG 445
           V + D+       G IY DL+ R GK S+AA+F +                  A   K  
Sbjct: 481 VISEDE----GLIGIIYCDLFERSGKTSNAAHFTICCSRDISPYETEDSTTQIAIDSKGT 536

Query: 446 SQSYPVTVLVCNLTKPTPTRT---AILRPGEITTLFHELGHGIHHLVANNKLAAHNSLGS 502
               P+  LVCN +K   + T     L   E+ TLFHE+GH +H ++   KL   N  G+
Sbjct: 537 RFQLPIISLVCNFSKTMISETDSVCFLHLPEVETLFHEMGHAMHSMLGRTKL--QNISGT 594

Query: 503 -VPWDFVEAPSQMLEYWTGRRDVLTMLSKHYETGEKIPPSLLDAWFNXXXXXXXXXXXXX 561
               DFVE PS ++EY+     VL  + KHY T E +   +L+                 
Sbjct: 595 RCATDFVELPSILMEYFARDPRVLETIGKHYLTKETVKREMLEPHLQDLKYLQHCETYSQ 654

Query: 562 XXXXXFDMYVH----TREYHGLEVRKLWNDMRREISLINSQNYTSTGYNTFGHIMTGSYS 617
                 D  +H    +     L+V KL+ D+ R++ ++        G   FGH+    YS
Sbjct: 655 AKMAMLDQTLHGETISSHLDHLDVVKLYQDLERQLGVLVDDKSNWCG--KFGHLF--GYS 710

Query: 618 AGYYGYLWSQVFAADMYQTKFKSNPFNSTVGRQYRDTILAPGGLYD 663
           A YY YL+ +  A+ ++   F+ NPF+   G +YR+++L  GG  D
Sbjct: 711 AVYYSYLFDRAIASKIWGALFERNPFSRASGDKYRNSVLQWGGSRD 756

>KAFR0D02950 Chr4 complement(581305..583638) [2334 bp, 777 aa] {ON}
           Anc_2.432 YKL134C
          Length = 777

 Score =  183 bits (464), Expect = 6e-48,   Method: Compositional matrix adjust.
 Identities = 165/628 (26%), Positives = 280/628 (44%), Gaps = 66/628 (10%)

Query: 78  FLRNVSPDPKVREASLSTGKILDQWVANISSKYDLYTNFEHIWTQYK-----DDEEFKVT 132
           F+R+V PD +   A+    + + +++  +++  +L    + +    +      +EE KV 
Sbjct: 143 FIRSVHPDKEFLSAAQQCHEEMFEFMNTLNTDVELCDKLKTLLHDNEILSKLSEEEIKVG 202

Query: 133 NYELYKYMEKDASYYNRNKRNLTNAESIELGQVTRKISVDTLQFSINLGXXXXXXXXXXX 192
              L  + EK   Y N   R     + IEL Q    I  D +  +               
Sbjct: 203 RILLEDF-EKSGIYMNPRIRE----QFIELSQEISLIGQDFINNANQPKTNYIKVNASKL 257

Query: 193 XXXGVSPLVLDQFERIIEGGVKKLKVTFKYPDIGP----VLRTATNPETRRKAYVADQNR 248
              G++ L+L+  ++        ++  +K P  GP    VL+   N E R   + A  + 
Sbjct: 258 ESAGLNRLLLNSLKK------DAIRENYKIPTYGPTPYAVLKDCKNEEVRADIWTALHS- 310

Query: 249 VAANEQLL--FETLDLRRRMAQLRGYKNYAEYNLRDKMAKNEETVIPFLTDLVERLLPVG 306
             ++EQ+L     + LR  +A L G +++++Y L+ K+AK  + V  F+  L++ + P  
Sbjct: 311 -CSSEQILRLSHLVKLRAMLANLMGAESFSQYQLKGKLAKAPKDVKNFIETLIKYVRPNT 369

Query: 307 EKDREILKSKKAEDYKSKNL-TFDG---EIYAWDNAYYNNKILQEKYQID---PEDMAQY 359
           EK+ + +   K ED    N    DG    +  WD  YY++   + K + +    E ++ Y
Sbjct: 370 EKELKFIADLKREDQGKINCGEMDGVLSTVRPWDRDYYSSIYFKGKEKTEHEFTEPLSSY 429

Query: 360 FPIESVIEGMLDTYQTLFRLKFVEVTDPSQKNVWHEDVKQFAVWNIDDEDCPEFQGWIYF 419
           F +  V EG+ D    ++ +K +E   P     W  DV++  V  I +E+     G IYF
Sbjct: 430 FTLGGVFEGLSDLLTQIYGIK-LEPAIPVSGETWFNDVRKINV--ISEEE--GIIGIIYF 484

Query: 420 DLYPRDGKYSHAANFGMASAFR---------------KKDGSQ-SYPVTVLVCNLTKPT- 462
           DL+ R GK S+ A+F +  +                 KKDG+    P+  LVCN ++ T 
Sbjct: 485 DLFERYGKTSNPAHFTVCCSREMYPEENADSIIQLGSKKDGTIFQLPIISLVCNFSRRTF 544

Query: 463 --PTRTAILRPGEITTLFHELGHGIHHLVANNKLAAHNSLGS-VPWDFVEAPSQMLEYWT 519
                  +L   EI TLFHE+GH IH ++    L   N  G+    DFVE PS ++E++ 
Sbjct: 545 QSDKTICLLTLSEIETLFHEMGHAIHSMLGRTTL--QNVSGTRCATDFVELPSILMEHFA 602

Query: 520 GRRDVLTMLSKHYETGEKIPPSLLDAWFNXXXXXXXXXXXXXXXXXXFDMYVHT-REYHG 578
               VL  +S HYETGEKI    L                        D  +H+ +  H 
Sbjct: 603 SDTRVLKKMSCHYETGEKIAEKKLQFHLKEGEFLRSCETFSQAKMAMLDQELHSDKIIHN 662

Query: 579 LE---VRKLWNDMRREISLINSQNYTSTGYNTFGHIMTGSYSAGYYGYLWSQVFAADMYQ 635
           L+   V +++ ++ R + ++        G   FGH+    Y A YY YL+ +  A  ++ 
Sbjct: 663 LDNLNVVEIYQNLERRLQVLVDDRSNWCG--KFGHLF--GYGATYYSYLFDRAIARKVWN 718

Query: 636 TKFKSNPFNSTVGRQYRDTILAPGGLYD 663
             F ++PFN T G ++++++L  GG  D
Sbjct: 719 HLFANDPFNKTNGEKFKESLLKWGGSKD 746

>ZYRO0G20130g Chr7 (1666665..1669025) [2361 bp, 786 aa] {ON} similar
           to uniprot|P35999 Saccharomyces cerevisiae YKL134C OCT1
           Mitochondrial intermediate peptidase cleaves N-terminal
           residues of a subset of proteins upon import after their
           cleavage by mitochondrial processing peptidase
           (Mas1p-Mas2p) may contribute to mitochondrial iron
           homeostasis
          Length = 786

 Score =  182 bits (461), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 171/675 (25%), Positives = 298/675 (44%), Gaps = 74/675 (10%)

Query: 37  QKSDAVYESVFSQKDEFT---LDNYIWPLLYNDQETDLLWNQLI---FLRNVSPDPKVRE 90
           Q  +  YE +   K++ T   L NYI  L   DQ +D L   +    F+R+  PD    +
Sbjct: 107 QSLNQAYELLEDMKNDETPQGLQNYILRL---DQLSDTLCRVIDLCEFIRSSHPDSHFVD 163

Query: 91  ASLSTGKILDQWV------ANISSKYDLYTNFEHIWTQYKDDEEFKVTNYELYKYMEKDA 144
           A+    + + +++       N+ +K     N   +  +    EE KV    L  + EK  
Sbjct: 164 AAQDCHEEMFEFMNVLNTDVNLCNKLRTVLNTPEVVCKLSS-EEVKVGKILLEDF-EKSG 221

Query: 145 SYYNRNKRNLTNAESIELGQVTRKISVDTLQFSINLGXXXXXXXXXXXXXXGVSPLVLDQ 204
            Y N   R     + I L Q    +  D +  +  +               G++ L+L Q
Sbjct: 222 IYMNPEIRE----QFIALSQEISIVGQDFINNTDFVRTNYITVDCETIHNSGINQLILSQ 277

Query: 205 FERIIEGGVKKLKVTFKYPDIG----PVLRTATNPETRRKAYVADQNRVAANEQLLFETL 260
             + I+G        +K P  G     VLR   +   R+K + A  +        L + +
Sbjct: 278 LSKDIKGK------HYKIPTHGYIAYSVLRACPDEIVRKKLWTAMHSCPDKQIVRLDQLV 331

Query: 261 DLRRRMAQLRGYKNYAEYNLRDKMAKNEETVIPFLTDLVERLLPVGEKDREILKSKKAED 320
            LR  +A L G K+YAEY L  KMAK+ E V  F+  L++   P  +++   +   K + 
Sbjct: 332 RLRAVLAFLMGKKSYAEYQLEGKMAKSPEEVTDFIDSLIKVTQPKAKQELGFISDLKRKH 391

Query: 321 Y-----KSKNLTFDGEIYAWDNAYYNNKI-LQEKYQ--IDPEDMAQYFPIESVIEGMLDT 372
                 ++ NL     +  WD  +Y+    +Q++ Q  ID + ++ YF + +V++G+ D 
Sbjct: 392 MDLPPSETSNLDTLDIVRPWDRDFYHTIYSIQQRRQSPIDDQQISMYFTLGNVMQGLSDL 451

Query: 373 YQTLFRLKFVEVTDPSQKNVWHEDVKQFAVWNIDDEDCPEFQGWIYFDLYPRDGKYSHAA 432
           +  ++ ++   V    +   W  +V++  V  + DE+     G +Y DL+ RDGK S+ +
Sbjct: 452 FHQIYGIRLEPVI-AQKGETWSPEVRRLNV--VSDEE--GVIGVVYCDLFERDGKTSNPS 506

Query: 433 NFGMASAFR---------------KKDGSQ-SYPVTVLVCNLTKPTPT---RTAILRPGE 473
           +F +  + +                KDG++   P+  LVCN      +      +L   E
Sbjct: 507 HFTVCCSRQIYPKENDLSTIQIGTNKDGTKFQLPIISLVCNFASSVVSFGQSLCLLHISE 566

Query: 474 ITTLFHELGHGIHHLVANNKLAAHNSLGS-VPWDFVEAPSQMLEYWTGRRDVLTMLSKHY 532
           I TLFHE+GH +H ++   +L   N  G+    DFVE PS ++E++     VL  + KH 
Sbjct: 567 IETLFHEMGHAMHSMLGRTRL--QNLSGTRCATDFVELPSILMEHFARDTRVLRQIGKHC 624

Query: 533 ETGEKIPPSLLDAWFNXXXXXXXXXXXXXXXXXXFDMYVHTRE----YHGLEVRKLWNDM 588
            TGE +P SLL  +                     D  +H +E       L+V  L+ ++
Sbjct: 625 NTGEPVPESLLTNYLQDLQYMQYCETFSQAKMAMLDQRLHGKEIITGMDTLDVVALYQNL 684

Query: 589 RREISLINSQNYTSTGYNTFGHIMTGSYSAGYYGYLWSQVFAADMYQTKFKSNPFNSTVG 648
            RE+ ++     T  G   FGH+    Y A YY YL+ +  A+ ++++ F+ +PF+   G
Sbjct: 685 ERELRVLVDDQSTWCG--RFGHLF--GYGATYYSYLFDRAIASKVWESLFQEDPFSRAGG 740

Query: 649 RQYRDTILAPGGLYD 663
           +++++ +L  GG  D
Sbjct: 741 QRFKEYVLKWGGAKD 755

>TPHA0G02390 Chr7 complement(486025..488412) [2388 bp, 795 aa] {ON}
           Anc_2.432 YKL134C
          Length = 795

 Score =  181 bits (460), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 162/627 (25%), Positives = 279/627 (44%), Gaps = 66/627 (10%)

Query: 78  FLRNVSPDPKVREASLSTGKILDQWVANISSKYDLYTNFEHIWTQYK-----DDEEFKVT 132
           F+R+  PD +  + S    +++ +++  +++   L    +HI    K      DEE+KV 
Sbjct: 160 FIRSAHPDDEYLKVSQECYELMFEFMNTLNTDVQLCYTLKHILEDEKICSKLTDEEYKVG 219

Query: 133 NYELYKYMEKDASYYNRNKRNLTNAESIELGQVTRKISVDTLQFSINLGXXXXXXXXXXX 192
              L  + EK   Y   N R     + IEL Q   +IS+   +F  N             
Sbjct: 220 KILLEDF-EKSGIYMEPNTRE----KFIELSQ---EISLVGQEFISNTDYVTKNNILIDR 271

Query: 193 XXXGVSPLVLD---QFERIIEGGVKKLKVTFKYPDIGPV----LRTATNPETRRKAYVAD 245
               +S L L    Q +  I G        +K P  GP+    L   +N   R+K +   
Sbjct: 272 ESLNLSELELPFTYQLKTDITGK------HYKIPTTGPIPYSILTNCSNETIRKKIWTEL 325

Query: 246 QNRVAANEQLLFETLDLRRRMAQLRGYKNYAEYNLRDKMAKNEETVIPFLTDLVERLLPV 305
            +      + L + + LR ++A+L   K++AEY L+ KMAKN E V  F++ L++   P+
Sbjct: 326 HSCSQEQIERLKKMVTLRYKLAKLLKKKSFAEYQLQGKMAKNPEEVKKFISTLLDFTKPL 385

Query: 306 GEKDREILKSKKAED----YKSKNLTFDGEIYAWDNAYYN--NKILQEKYQIDPEDMAQY 359
             K+   L   KA D    +K+ +      I  WD  YY+  N+   ++   D  ++  Y
Sbjct: 386 AIKELTSLAEVKAADLGLAFKNDSNFIVNLIRPWDRNYYSKINRYENKQTMEDLNELPYY 445

Query: 360 FPIESVIEGMLDTYQTLFRLKFVEVTDPSQKNVWHEDVKQFAVWNIDDEDCPEFQGWIYF 419
           F + +VI G+ + +  ++ ++F E+  P  +  W  +V++  V +    +     G +Y 
Sbjct: 446 FSLGNVIAGLSNLFHNIYGIRF-ELAVPKLEETWLPEVRKLNVIS----ESEGLIGIVYC 500

Query: 420 DLYPRDGKYSHAANFGMASA---------------FRKKDGSQSYPVTVLVCNLTKP--- 461
           DL+ R  K ++AA+F +  +                  K      P+  L+CN +K    
Sbjct: 501 DLFERPSKKTNAAHFTICCSREIGKGEDISTMQVGMNSKGNMFQLPIISLICNFSKSHLF 560

Query: 462 TPTRTAILRPGEITTLFHELGHGIHHLVANNKLAAHNSLGS-VPWDFVEAPSQMLEYWTG 520
                  L+  EI TLFHE+GH +H ++   +L   N+ G+    DFVE PS ++E++  
Sbjct: 561 EENGPCFLQLHEIETLFHEMGHAMHSVLGRTRL--QNTSGTRCATDFVELPSILMEHFAK 618

Query: 521 RRDVLTMLSKHYETGEKIPPSLLDAWFNXXXXXXXXXXXXXXXXXXFDMYVHTREY---- 576
              V+  +S HY + E   P LL  W +                   D  +H+ E     
Sbjct: 619 DVRVMESISSHYISQEPASPELLQTWLHSTDNLQNLELYTQAKMSMLDQILHSNEIFEDQ 678

Query: 577 HGLEVRKLWNDMRREISLINSQNYTSTGYNTFGHIMTGSYSAGYYGYLWSQVFAADMYQT 636
             + V K +ND+ +++ L +       G   FGH+    Y A YY YL+ +  A+ ++++
Sbjct: 679 KDINVVKSYNDLEKKLELFSDDQSNWCG--KFGHLF--GYGASYYSYLFDRAIASKVWES 734

Query: 637 KFKSNPFNSTVGRQYRDTILAPGGLYD 663
            FK NPF+ T G +++D++L  GG  D
Sbjct: 735 LFKQNPFSRTSGLKFKDSVLRWGGSRD 761

>SAKL0E03938g Chr5 (317017..319320) [2304 bp, 767 aa] {ON} similar
           to uniprot|P35999 Saccharomyces cerevisiae YKL134C OCT1
           Mitochondrial intermediate peptidase cleaves N-terminal
           residues of a subset of proteins upon import after their
           cleavage by mitochondrial processing peptidase
           (Mas1p-Mas2p) may contribute to mitochondrial iron
           homeostasis
          Length = 767

 Score =  180 bits (456), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 157/649 (24%), Positives = 284/649 (43%), Gaps = 67/649 (10%)

Query: 57  NYIWPLLYNDQETDLLWNQL---IFLRNVSPDPKVREASLSTGKILDQWVANISSKYDLY 113
           NYI  L   D+ +D+L   +    F+R   PDP   +A+    + + + +  +++   L 
Sbjct: 113 NYIANL---DRLSDILCRVIDLAEFIRASHPDPHFVQAAQDCHEEMFEIMNVLNTDVALC 169

Query: 114 TNFEHIWTQYK-----DDEEFKVTNYELYKYMEKDASYYNRNKRNLTNAESIELGQVTRK 168
              +H+ T          EE KV    L  + EK   + N   R     + I L Q    
Sbjct: 170 DILKHVLTDPTILSELSPEEIKVGKILLEDF-EKSGIHMNPEVRE----QFIALSQQISV 224

Query: 169 ISVDTLQFSINLGXXXXXXXXXXXXXXGVSPLVLDQFERIIEGGVKKLKVTFKYPDIG-- 226
           +  D +  +  +               G++ +VL+Q  + I+G        +K P  G  
Sbjct: 225 VGQDFINNTEYVRSNYIKVEVEELNKSGINKIVLNQLSKDIKGR------HYKIPTFGYI 278

Query: 227 --PVLRTATNPETRRKAYVADQNRVAANEQLLFETLDLRRRMAQLRGYKNYAEYNLRDKM 284
              +LR+  +   R K + A  +        L + + LR  +A + G K++A Y L  KM
Sbjct: 279 PYSILRSCPDDNIRMKVWSALHSCSEKQIARLDQLIKLRSVLANIMGKKSFAHYQLEGKM 338

Query: 285 AKNEETVIPFLTDLVERLLPVGEKDREILKSKKAEDYKSKNLTFDGE-----IYAWDNAY 339
           AK  E V  F+  L++   P   ++ + +   KA+                 +  WD  +
Sbjct: 339 AKTPEYVRGFMQSLIDATKPKAAEELKFIADLKAKHVPGNKPAESMHEILEMVKPWDRDF 398

Query: 340 YNN-KILQEKYQIDPEDMAQYFPIESVIEGMLDTYQTLFRLKFVEVTDPSQKNVWHEDVK 398
           Y +   LQ++   + E ++ YF +  VI+G+ + ++ ++ + ++E   P     W  +V+
Sbjct: 399 YGSVHALQQRRPFNNEQISSYFSLGVVIQGLSNLFKQIYGI-YLEPVVPKTGETWSPEVR 457

Query: 399 QFAVWNIDDEDCPEFQGWIYFDLYPRDGKYSHAANFGMASAFRKKDGSQ----------- 447
           +  V +  +       G +Y DL+ R GK ++ A+F +  + +  DG             
Sbjct: 458 RINVVSEKEG----VIGVVYCDLFERQGKTANPAHFTVCCSRQIYDGETDLSTIQVGQNS 513

Query: 448 -----SYPVTVLVCNLTKPTPTR---TAILRPGEITTLFHELGHGIHHLVANNKLAAHNS 499
                  PV  LVCN +  T ++     +L+  EI TLFHE+GH +H ++   KL   N 
Sbjct: 514 KGEQFQLPVISLVCNFSPTTISQEQSICLLQLSEIETLFHEMGHAMHSMLGRTKL--QNI 571

Query: 500 LGS-VPWDFVEAPSQMLEYWTGRRDVLTMLSKHYETGEKIPPSLLDAWFNXXXXXXXXXX 558
            G+    DFVE PS ++E++     VL  ++ HY TGE IP  LL ++ +          
Sbjct: 572 SGTRCATDFVELPSILMEHFARDHRVLQRMASHYSTGESIPEQLLFSYQSEVKFLQHAEA 631

Query: 559 XXXXXXXXFDMYVH----TREYHGLEVRKLWNDMRREISLINSQNYTSTGYNTFGHIMTG 614
                    D  +H     +E   L++ KL++++ R++ +++       G   FGH+   
Sbjct: 632 FSQAKMAILDQELHGESIMKEMQYLDIVKLYHNLERQLEVLSDDKSNWCG--RFGHLF-- 687

Query: 615 SYSAGYYGYLWSQVFAADMYQTKFKSNPFNSTVGRQYRDTILAPGGLYD 663
            Y A YY YL+ +  A+ ++Q  F ++PF    G ++++++L  GG  D
Sbjct: 688 GYGATYYSYLFDRAIASKIWQHLFANDPFCRRSGEKFKNSVLKWGGSRD 736

>KNAG0A06200 Chr1 complement(937577..939946) [2370 bp, 789 aa] {ON}
           Anc_2.432 YKL134C
          Length = 789

 Score =  179 bits (453), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 136/497 (27%), Positives = 225/497 (45%), Gaps = 42/497 (8%)

Query: 196 GVSPLVLDQFERIIEGGVKKLKVTFKYPDIGPVLRTATNPETRRKAYVADQNRVAANEQL 255
           GVSP++L Q    + G   K+      P I  +LR+  N   R+  + A  +        
Sbjct: 275 GVSPILLRQLTTTVRGTHYKVPAYGTAPYI--ILRSCKNENARKAVWTALHSCPDKQINR 332

Query: 256 LFETLDLRRRMAQLRGYKNYAEYNLRDKMAKNEETVIPFLTDLVERLLPVGEKDREILKS 315
           L   + +R  ++ + G   +A Y L+ KMAK+ E V+ F+T L+E   P+  ++ ++L +
Sbjct: 333 LTHMVKMRSVLSNIMGKVGFAVYQLQGKMAKSPENVLNFITRLMEHTKPMAAEELKLLAN 392

Query: 316 KKAEDYKSKNLTFDGEIYA----WDNAYYNNKILQ---EKYQI-DPEDMAQYFPIESVIE 367
            K  D        + EI      WD  YY  K  Q    K Q+ + E +  YF + SV+E
Sbjct: 393 MKLNDLGLPEANSEKEILETVRPWDRDYYVAKSQQTRKAKNQLTNHEPINAYFTLGSVLE 452

Query: 368 GMLDTYQTLFRLKFVEVTDPSQKNVWHEDVKQFAVWNIDDEDCPEFQGWIYFDLYPRDGK 427
           G+ + +++++ +   EV        W  +V++    N+  E+     G +Y DL+ R  K
Sbjct: 453 GLSNLFKSIYGISL-EVVASIPGETWSSEVRRV---NVKTEN-NNIIGVVYCDLFERKAK 507

Query: 428 YSHAANFGMA----------------SAFRKKDGSQSYPVTVLVCNLTKPTPTRTAILRP 471
            S  A+F +                 S    +      P+  LVCN  + +     +L+ 
Sbjct: 508 TSSPAHFTVCCSRELYAEENDPSILQSGVNSRGEKFQLPIISLVCNFARTSDNELCLLQL 567

Query: 472 GEITTLFHELGHGIHHLVANNKLAAHNSLGS-VPWDFVEAPSQMLEYWTGRRDVLTMLSK 530
            EI TLFHE+GH +H ++   KL   N  G+    DFVE PS ++E++     VL  + +
Sbjct: 568 SEIETLFHEMGHAMHSMLGQTKL--QNISGTRCTTDFVELPSIIMEHFARDPRVLKGIGR 625

Query: 531 HYETGEKIPPSLLDAWFNXXXXXXXXXXXXXXXXXXFD--MYVHTREYH--GLEVRKLWN 586
           HY T EK+P  LL    N                   D  +Y +   +H   L+V +L++
Sbjct: 626 HYITKEKVPEDLLAEELNSTRYLQNCETFAQAKMAMLDQRLYDNNIIFHVRDLDVVELYH 685

Query: 587 DMRREISLINSQNYTSTGYNTFGHIMTGSYSAGYYGYLWSQVFAADMYQTKFKSNPFNST 646
           D+ R + ++        G   FGH+    Y A YY YL  +  AA ++   F ++PF+ T
Sbjct: 686 DLERNLEVLVDDQTNWCG--KFGHLF--GYGATYYSYLLDRAIAAKIWDCLFVNDPFSRT 741

Query: 647 VGRQYRDTILAPGGLYD 663
            G  +++ +L  GGL D
Sbjct: 742 GGENFKNAVLKWGGLRD 758

>CAGL0D02112g Chr4 complement(216204..218489) [2286 bp, 761 aa] {ON}
           similar to uniprot|P35999 Saccharomyces cerevisiae
           YKL134c MIP1
          Length = 761

 Score =  177 bits (450), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 155/621 (24%), Positives = 275/621 (44%), Gaps = 58/621 (9%)

Query: 78  FLRNVSPDPKVREASLSTGKILDQWVANISSKYDLYTNFEHIWTQYKDDEEFKVTNYE-- 135
           FLR+  PD    EA+    + + +++  +++   L    + +    +D E  KV + E  
Sbjct: 129 FLRSAHPDQSYVEAAQMCHEEMFEFMNVLNTDVVLCNKLKEVL---EDPEILKVLSEEER 185

Query: 136 -----LYKYMEKDASYYNRNKRNLTNAESIELGQVTRKISVDTLQFSINLGXXXXXXXXX 190
                L    EK   Y     R     + IEL Q    I  + +  +  +          
Sbjct: 186 KVGEILLDDFEKSGIYMKAGIRE----QFIELSQQISVIGQEFINNTDYVAKEFIKVKRD 241

Query: 191 XXXXXGVSPLVLDQFERIIEGGVKKLKVTFKYPDIGPVLRTATNPETRRKAYVADQNRVA 250
                G+SPL+  +  R + G   K+    + P    +L++  + + R++ + A  N   
Sbjct: 242 EMDKSGISPLLTARLNRDLTGKYYKIPTYGQIP--LQILKSCPDEDIRKEVWAALHNCPK 299

Query: 251 ANEQLLFETLDLRRRMAQLRGYKNYAEYNLRDKMAKNEETVIPFLTDLVERLLPVGEKDR 310
           A  Q L + + LR  ++ L G ++Y++Y L +KMA + E V  F+  L+    P+  ++ 
Sbjct: 300 AQIQRLNQLVRLRVILSNLLGKQSYSDYQLDNKMAGSPENVKGFIKTLMNVTKPLAAREL 359

Query: 311 EILKSKKAEDYKSKNLTFDGEIYA----WDNAYYNNKILQ--EKYQIDPEDMAQYFPIES 364
           E +   K     S++++ D EI +    WD  Y+++K     E   I  E +  YF + +
Sbjct: 360 EFIARDKLNAPDSRHMS-DNEILSIVKPWDKNYFSSKYDSDNEMAMIRDEQLRYYFSLGN 418

Query: 365 VIEGMLDTYQTLFRLKFVEVTDPSQKNVWHEDVKQFAVWNIDDEDCPEFQGWIYFDLYPR 424
           VI G+ + ++ ++ +  ++ +       W  DV++  V  I +E+     G IY DL+ R
Sbjct: 419 VINGLSELFKRIYGIT-LQPSRTENGETWSPDVRRLDV--ISEEE--GLVGVIYCDLFER 473

Query: 425 DGKYSHAANFGMASA---------------FRKKDGSQ-SYPVTVLVCNLTK---PTPTR 465
            GK S+ A+F +  +                +  DG+    PV  LVCN +    P   R
Sbjct: 474 VGKISNPAHFTVCCSRQVYPDENDFTTIQTGQNSDGTVFQLPVISLVCNFSTVALPNGNR 533

Query: 466 TAILRPGEITTLFHELGHGIHHLVANNKLAAHNSLGS-VPWDFVEAPSQMLEYWTGRRDV 524
           T  L   EI TLFHE+GH +H ++   +L   N  G+    DFVE PS ++E++     V
Sbjct: 534 TCFLHMNEIETLFHEMGHAMHSMLGRTRL--QNISGTRCATDFVELPSILMEHFARDIRV 591

Query: 525 LTMLSKHYETGEKIPPSLLDAWFNXXXXXXXXXXXXXXXXXXFDMYVH----TREYHGLE 580
           L  +  HYET E  P +LL+ + +                   D  +H      +   ++
Sbjct: 592 LRTIGSHYETSEPAPEALLNDYLDKTQFLQHCETYSQAKMAMLDQKLHGSFSLSDIERID 651

Query: 581 VRKLWNDMRREISLINSQNYTSTGYNTFGHIMTGSYSAGYYGYLWSQVFAADMYQTKFKS 640
             K++  +   + ++        G   FGH+    Y A YY YL+ +  A+ ++ + FK 
Sbjct: 652 SAKIYQKLETRLQVLADDESNWCG--RFGHLF--GYGATYYSYLFDRAIASKVWDSLFKD 707

Query: 641 NPFNSTVGRQYRDTILAPGGL 661
           +PFN T G ++++ +L  GGL
Sbjct: 708 DPFNRTGGEKFKERVLKWGGL 728

>Skud_11.93 Chr11 complement(175243..177561) [2319 bp, 772 aa] {ON}
           YKL134C (REAL)
          Length = 772

 Score =  176 bits (447), Expect = 9e-46,   Method: Compositional matrix adjust.
 Identities = 163/627 (25%), Positives = 273/627 (43%), Gaps = 65/627 (10%)

Query: 78  FLRNVSPDPKVREASLSTGKILDQWVANISSKYDLYTNFEHIW-----TQYKDDEEFKVT 132
           F+R+  PD K  +A+    + + +++  +++   L    + +      +    DEE KV 
Sbjct: 139 FIRSTHPDDKFVKAAQDCHEQMFEFMNVLNTDVSLCNILKSVLNSPEVSSKLSDEELKVG 198

Query: 133 NYELYKYMEKDASYYNRNKRNLTNAESIELGQVTRKISVDTLQFSINLGXXXXXXXXXXX 192
              L  + EK   Y N + R     + IEL Q    I  + +  +   G           
Sbjct: 199 KILLDDF-EKSGIYMNPDVRE----KFIELSQEISLIGQEFINHTDYPGSNSVKIPCKDL 253

Query: 193 XXXGVSPLVLDQFERIIEGGVKKLKVTFKYPDIGPVLRTATNPETRRKAYVADQNRVAAN 252
               VS  +L Q  + ++G   K+  TF Y     +L++    E R+K + A  +     
Sbjct: 254 DNGNVSAFLLKQLNKDVKGQNYKIP-TFGYAAYA-LLKSCEKEEVRKKLWTALHSCSDKQ 311

Query: 253 EQLLFETLDLRRRMAQLRGYKNYAEYNLRDKMAKNEETVIPFLTDLVERLLPVGEKDREI 312
            + L   + LR  +A L   ++YAEY L  KMAKN + V  F+  L+   +     + + 
Sbjct: 312 IKRLSHLIKLRAILANLMNKESYAEYQLEGKMAKNPKDVQDFILTLMNGTIDKTANELKF 371

Query: 313 LKSKKAEDYKSKNLTFDGEIY----AWDNAYYNNKILQEKYQIDPED------MAQYFPI 362
           +   K +D K    T   +I      WD  YY  K L    Q++P D      ++ YF +
Sbjct: 372 IAELKTKDLKKPLATKTDDILRLVRPWDRDYYTGKYL----QLNPSDAPNAKEISYYFTL 427

Query: 363 ESVIEGMLDTYQTLFRLKFV-EVTDPSQKNVWHEDVKQFAVWNIDDEDCPEFQGWIYFDL 421
            +VIEG+ D +Q ++ ++   E+ D  +   W  DV++  V  I +E+     G IY DL
Sbjct: 428 GNVIEGLSDLFQHIYGIRLEPEIADEGE--TWSPDVRRLNV--ISEEE--GIIGIIYCDL 481

Query: 422 YPRDGKYSHAANFGMASAFR---------------KKDGSQ-SYPVTVLVCNLTKPTPTR 465
           + R+GK S+ A+F +  + +                 DGS    PV  LVCN   P P  
Sbjct: 482 FERNGKTSNPAHFTVCCSRQIYPNETDFSTIQVGENPDGSYFQLPVISLVCNFA-PIPIA 540

Query: 466 T----AILRPGEITTLFHELGHGIHHLVANNKLAAHNSLGS-VPWDFVEAPSQMLEYWTG 520
           +      L+  E+ TLFHE+GH +H ++    +   N  G+    DFVE PS ++E++  
Sbjct: 541 SKKTLCFLQLSEVETLFHEMGHAMHSMLGRTHM--QNISGTRCATDFVELPSILMEHFAK 598

Query: 521 RRDVLTMLSKHYETGEKIPPSLLDAWFNXXXXXXXXXXXXXXXXXXFDMYVHTRE----Y 576
              +LT +SKHYETGE I   +L ++                     D   H  E     
Sbjct: 599 DIRILTKISKHYETGETIQAGMLQSFMRTTNFLQNCETYSQAKMAMLDQSFHDEEIISDI 658

Query: 577 HGLEVRKLWNDMRREISLINSQNYTSTGYNTFGHIMTGSYSAGYYGYLWSQVFAADMYQT 636
              ++ K +  + R + ++        G   FGH+    Y A YY YL+ +  A+ ++  
Sbjct: 659 DNFDIVKNYQALERRLKVLVDDQSNWCG--RFGHLF--GYGATYYSYLFDRTIASKIWYA 714

Query: 637 KFKSNPFNSTVGRQYRDTILAPGGLYD 663
            F+ +P++   G +++  +L  GGL D
Sbjct: 715 LFEDDPYSRKNGDKFKKHLLKWGGLKD 741

>Suva_11.91 Chr11 complement(175327..177654) [2328 bp, 775 aa] {ON}
           YKL134C (REAL)
          Length = 775

 Score =  174 bits (441), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 158/626 (25%), Positives = 268/626 (42%), Gaps = 63/626 (10%)

Query: 78  FLRNVSPDPKVREASLSTGKILDQWVANISSKYDLYTNFEHIWTQYK-----DDEEFKVT 132
           F+R+  PD    +A+    + + +++  +++   L    + +    K      +EE KV 
Sbjct: 142 FIRSTHPDDAFVKAAQDCHEQMFEFMNVLNTDVSLCNMLKTVLNSPKISSKLSEEELKVG 201

Query: 133 NYELYKYMEKDASYYNRNKRNLTNAESIELGQVTRKISVDTLQFSINLGXXXXXXXXXXX 192
              L  + EK   Y N + R     + I+L Q    +  + +  +   G           
Sbjct: 202 KILLDDF-EKSGIYMNPDVRE----KFIQLSQEISLVGQEFINHTDYPGSNSVKISCREL 256

Query: 193 XXXGVSPLVLDQFERIIEGGVKKLKVTFKYPDIG----PVLRTATNPETRRKAYVADQNR 248
               VS  +L Q  + ++G        +K P  G     +L++    + R+K + A  + 
Sbjct: 257 DNSNVSAFLLKQLNKDVKGQ------NYKVPTFGYAAYALLKSCEKEQVRKKIWTALHSC 310

Query: 249 VAANEQLLFETLDLRRRMAQLRGYKNYAEYNLRDKMAKNEETVIPFLTDLVERLLPVGEK 308
                + L   + LR  +A L    +YAEY L  KMAKN + V  F+  L+   +     
Sbjct: 311 SDKQIKRLNHLIKLRANLADLMHKGSYAEYQLEGKMAKNPKDVQDFILTLMNDTIDKTAT 370

Query: 309 DREILKSKKAEDYKSKNLTFDGEIYA----WDNAYYNNKILQEKYQIDP--EDMAQYFPI 362
           + + +   KA+D K    T   EI      WD  YY  K LQ      P  ++++ YF +
Sbjct: 371 ELKFIAELKAKDLKKPLATKTDEILKLVRPWDRDYYTGKYLQLNPSNAPSAKEISSYFTL 430

Query: 363 ESVIEGMLDTYQTLFRLKFVEVTDPSQKNVWHEDVKQFAVWNIDDEDCPEFQGWIYFDLY 422
            +VI+G+ D +Q ++ +K +E     +   W  DV++  V  I +E+     G IY DL+
Sbjct: 431 GNVIQGLSDLFQHIYGIK-LEPAIADEGETWSPDVRRLNV--ISEEE--GIIGIIYCDLF 485

Query: 423 PRDGKYSHAANFGMASAFR---------------KKDGSQ-SYPVTVLVCNLTKPTPTRT 466
            R GK S+ A+F +  + +                 DGS    PV  LVCN   P P  +
Sbjct: 486 ERSGKTSNPAHFTVCCSRQIYPNETDFSTIQLGENADGSFFQLPVISLVCNFA-PIPIAS 544

Query: 467 ----AILRPGEITTLFHELGHGIHHLVANNKLAAHNSLGS-VPWDFVEAPSQMLEYWTGR 521
                 L+  E+ TLFHE+GH +H ++    +   N  G+    DFVE PS ++E++   
Sbjct: 545 KKSLCFLQLSEVETLFHEMGHAMHSMLGRTHM--QNISGTRCATDFVELPSILMEHFAKD 602

Query: 522 RDVLTMLSKHYETGEKIPPSLLDAWFNXXXXXXXXXXXXXXXXXXFDMYVHTREY----H 577
             +LT + KHYETGE + P +L ++                     D   H  E      
Sbjct: 603 IRILTRIGKHYETGETVEPDMLQSFMRTTNFLQNCETYSQAKMAMLDQSFHDEEVISNID 662

Query: 578 GLEVRKLWNDMRREISLINSQNYTSTGYNTFGHIMTGSYSAGYYGYLWSQVFAADMYQTK 637
             +V K +  + R + ++        G   FGH+    Y A YY YL+ +  A+ ++   
Sbjct: 663 NYDVVKNYQALERRLKVLVDDQSNWCG--RFGHLF--GYGATYYSYLFDRTIASKIWYAL 718

Query: 638 FKSNPFNSTVGRQYRDTILAPGGLYD 663
           F+ +P++   G +++  +L  GGL D
Sbjct: 719 FEDDPYSRKNGDKFKKHLLKWGGLKD 744

>Ecym_6099 Chr6 complement(186647..188968) [2322 bp, 773 aa] {ON}
           similar to Ashbya gossypii AFR198W
          Length = 773

 Score =  172 bits (436), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 166/673 (24%), Positives = 292/673 (43%), Gaps = 74/673 (10%)

Query: 35  LAQKSDAVYESVFSQKDEFT----LDNYIWPLLYNDQETDLLWNQL---IFLRNVSPD-- 85
            A+KS    E++  Q  E T    L +YI  L   DQ +D+L   +    F+R   PD  
Sbjct: 100 FARKSRKDAEAIVKQLREDTSFDALKSYIIRL---DQLSDILCRVIDLCEFIRASHPDDN 156

Query: 86  -----PKVREASLSTGKILDQWVANISSKYDLYTNFEHIWTQYKDDEEFKVTNYELYKYM 140
                 +  E       +L+  V   +   ++ TN E I  +    EE +V +  L  + 
Sbjct: 157 FVTAAQECHEEMFEIMNVLNTDVVLCNVLKEVLTN-ESIRKEL-SSEEIRVGHILLEDF- 213

Query: 141 EKDASYYNRNKRNLTNAESIELGQVTRKISVDTLQFSIN---LGXXXXXXXXXXXXXXGV 197
           EK   Y N   R       IEL QV   IS+   +F  N   +G              GV
Sbjct: 214 EKSGIYMNPKVRE----RFIELSQV---ISIVGQEFITNTEYVGTSFVEIETDVLEASGV 266

Query: 198 SPLVLDQFERIIEGGVKKLKVTFKYPDIG----PVLRTATNPETRRKAYVADQNRVAANE 253
           S +VL Q  + + G        +K P  G     ++RT  +   R+K + A  +      
Sbjct: 267 SQMVLQQLSKDLSGKF------YKIPTYGYLPYSIIRTCPSEYIRKKVWTAMYSCPEKQI 320

Query: 254 QLLFETLDLRRRMAQLRGYKNYAEYNLRDKMAKNEETVIPFLTDLVERLLPVGEKDREIL 313
           + L + + LR+++A + G  +YA Y L  KMAK+ + V  F+  L+E   P+  ++ + L
Sbjct: 321 KRLKKLVRLRQQLAHIMGKPDYATYQLEGKMAKSPKNVKNFMNTLIEYTKPLAMEELKPL 380

Query: 314 KSKKAEDYKSKNLTFDGEIYAWDNAYYNN-KILQEKYQIDP---EDMAQYFPIESVIEGM 369
              K +++          +  WD  Y+ +  +L +   +     + +  YF +  VI+G+
Sbjct: 381 ADMKHDNHCKDASEILSSVRPWDRDYFGSMSLLAQPRSVKTMSFQSLNCYFSLGVVIQGL 440

Query: 370 LDTYQTLFRLKFVEVTDPSQKNVWHEDVKQFAVWNIDDEDCPEFQGWIYFDLYPRDGKYS 429
            D +Q+++ ++   V   + +  W  +V++  V +    +     G IY DL+ R GK  
Sbjct: 441 SDLFQSIYGIRLEPVVAKTGET-WDPEVRKIQVIS----EANGVIGVIYCDLFERQGKTP 495

Query: 430 HAANFGMASAFRKKDGSQSY----------------PVTVLVCNL--TKPTPTRTAILRP 471
           + A+F +  + +       Y                PV  LVCN   T+       +L+ 
Sbjct: 496 NPAHFTVCCSRQIYPNETDYSTIQVGSHPDKSKFQMPVISLVCNFSHTQADDDSICLLQL 555

Query: 472 GEITTLFHELGHGIHHLVANNKLAAHNSLGS-VPWDFVEAPSQMLEYWTGRRDVLTMLSK 530
            E+ TLFHE+GH +H ++   +L   N  G+    DFVE PS ++E++     VL+ +S 
Sbjct: 556 SEVETLFHEMGHAMHSMLGRTQL--QNISGTRCATDFVELPSILMEHFAKDLRVLSRISS 613

Query: 531 HYETGEKIPPSLLDAWFNXXXXXXXXXXXXXXXXXXFDMYVHTREYHGLEVRKLWNDMRR 590
           HY TGE++P  +L  +                     D  +H+   +  ++  +++ + +
Sbjct: 614 HYATGERVPKEMLVNYQQENRFLEHTETFSQIKMAMLDQRLHSLTDNSEDIVTVYHGLEK 673

Query: 591 EISLINSQNYTSTGYNTFGHIMTGSYSAGYYGYLWSQVFAADMYQTKFKSNPFNSTVGRQ 650
           E+ ++        G   FGH+    Y A YY YL  +  AA ++   F+ +PF+   G +
Sbjct: 674 ELQVLVDDRSNWCG--RFGHLF--GYGASYYSYLMDRAIAAKVWNHLFQHDPFSRAGGEK 729

Query: 651 YRDTILAPGGLYD 663
           +++++L  GG  D
Sbjct: 730 FKNSVLKWGGSRD 742

>NDAI0E02010 Chr5 complement(404579..406915) [2337 bp, 778 aa] {ON}
           Anc_1.9 YCL057W
          Length = 778

 Score =  170 bits (430), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 148/623 (23%), Positives = 279/623 (44%), Gaps = 61/623 (9%)

Query: 78  FLRNVSPDPKVREASLSTGKILDQWVANISSKYDLYT----NFEHIWTQYKDDEEFKVTN 133
           F+R+  P+    EA+    + L +++  +++  +L        +      K  EE K   
Sbjct: 145 FIRSAHPEEGFIEAAQDCHEKLFEFMNVLNTDRELCELLNETLQDEQVLSKLSEEEKKVG 204

Query: 134 YELYKYMEKDASYYNRNKRNLTNAESIELGQVTRKISVDTLQFSINLGXXXXXXXXXXXX 193
           Y L +   K   Y +  K++    + I L Q    I  + +     L             
Sbjct: 205 YILLQDFIKSGIYMDSGKKD----QFITLSQDISVIGQEYINNINQLARNHIKVKRSELD 260

Query: 194 XXGVSPLVLDQFERIIEGGVKKLKVTFKYPDIGPVLRTATNPETRRKAYVADQNRVAANE 253
             G+   V  Q  + I G   K+      P +  +L+  T+PE R+K +VA  +      
Sbjct: 261 NAGIEFDVACQLGKDITGKYYKIPTYGHLPFL--ILKACTDPEIRKKIWVAMHDCSKQQI 318

Query: 254 QLLFETLDLRRRMAQLRGYKNYAEYNLRDKMAKNEETVIPFLTDLVERLLPVGEKDREIL 313
           + L   + +R  +A   G + YA Y +  KMAKN + V  FL  L++ L P   K+ + +
Sbjct: 319 ERLTNLVKIRAFLAHTMGRECYAAYAIDGKMAKNPKDVDEFLKSLMDFLKPKAAKELKFI 378

Query: 314 -------KSKKAEDYKSKNLTFDGEIYAWDNAYYN--NKILQEKYQIDPEDMAQYFPIES 364
                  K +K  D   + LT    +  WD  YY   ++  Q+   +D   +  Y+P+ +
Sbjct: 379 SDLIHNEKGEKPSDDVDEILT---AVRPWDREYYTAIHRNKQKHLLLDDYALDVYYPLGN 435

Query: 365 VIEGMLDTYQTLFRLKFVEVTDPSQKNVWHEDVKQFAVWNIDDEDCPEFQGWIYFDLYPR 424
           VI+G+ D +++++ ++F E     +   W  DV++  V +  +       G IY DL+ R
Sbjct: 436 VIQGLSDIFESIYGIRF-EPAVAGKGETWSSDVRRLNVVSEKE----GLIGIIYCDLFRR 490

Query: 425 DGKYSHAANFGMASAFR---------------KKDGSQ-SYPVTVLVCNLTKP---TPTR 465
            GK ++AA+F +  + +                 DG++   P+  L+CN       +   
Sbjct: 491 QGKTNNAAHFTICCSRQIYPHEDDFSTIQLGTNVDGTKFQLPIISLLCNFNTRCLNSGET 550

Query: 466 TAILRPGEITTLFHELGHGIHHLVANNKLAAHNSLGS-VPWDFVEAPSQMLEYWTGRRDV 524
             +L   EI TLFHE+GH IH ++   +L   N  G+    DFVE PS ++E++     V
Sbjct: 551 ICLLALNEIETLFHEMGHAIHSMLGRTRL--QNVSGTRCSTDFVELPSVLMEHFARDTRV 608

Query: 525 LTMLSKHYETGEKIPPSLLDAWFNXXXXXXXXXXXXXXXXXXFDMYVH----TREYHGLE 580
           L  +  HY+TG+++P +LL+ +                     D  ++     +    ++
Sbjct: 609 LKRIGHHYKTGDRVPATLLNRYLEKARFLKDCETFSQAKMAMLDQRLYDKNIVQNIDSVD 668

Query: 581 VRKLWNDMRREISLI--NSQNYTSTGYNTFGHIMTGSYSAGYYGYLWSQVFAADMYQTKF 638
           V K+++++ +E+ ++  +  N+ +     FGH+    Y A YY YL+ +  A+ +++  F
Sbjct: 669 VVKIYHELEKELEVLVDDESNWCA----KFGHLF--GYGATYYCYLFDRAIASKVWKKLF 722

Query: 639 KSNPFNSTVGRQYRDTILAPGGL 661
           + +P++ + G ++++ +L  GGL
Sbjct: 723 EKDPYSRSGGEKFKNDVLKWGGL 745

>Kwal_26.7616 s26 (444266..446578) [2313 bp, 770 aa] {ON} YKL134C
           (OCT1) - 1:1 [contig 55] FULL
          Length = 770

 Score =  169 bits (427), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 153/670 (22%), Positives = 290/670 (43%), Gaps = 68/670 (10%)

Query: 37  QKSDAVYESVFSQKDEFTLDNYIWPLLYNDQETDLLWNQL---IFLRNVSPDPKVREASL 93
           Q  +   + V   +++ T   Y+  +   D+ +DLL   +    F+R   PDP   +A+ 
Sbjct: 95  QSLEEAEKCVAQMRNDHTKQGYVSYIKNLDRLSDLLCRVIDLCEFIRASHPDPSFVQAAQ 154

Query: 94  STGKILDQWVANISSKYDLYTNFEHIW-----TQYKDDEEFKVTNYELYKYMEKDASYYN 148
              + + +++  +++   L    +H+       Q   DEE +V N  L  + +       
Sbjct: 155 LCHEEMFEFMNVLNTDKTLCEVLKHVLRTESIVQELSDEEIRVGNILLEDFEKSGIDMEP 214

Query: 149 RNKRNLTNAESIELGQVTRKISVDTLQFSINLG---XXXXXXXXXXXXXXGVSPLVLDQF 205
           +      N        ++++IS+   +F  N                   GVS L+L+Q 
Sbjct: 215 KVGEQFIN--------ISQQISIVGQEFINNTDFPRSDYVKIPCKELDSSGVSTLLLNQL 266

Query: 206 ERIIEGGVKKLKVTFKYPDIG----PVLRTATNPETRRKAYVADQNRVAANEQLLFETLD 261
            R ++         +K P  G     +LR+  N   R K + A  +        L + + 
Sbjct: 267 SRDLKNQ------NYKVPAYGYAAFSILRSCPNENVRMKIWTAMHSCPEKQISRLKQLVM 320

Query: 262 LRRRMAQLRGYKNYAEYNLRDKMAKNEETVIPFLTDLVERLLPVGEKDREILKSKKAEDY 321
           LR  +A + G K+YAEY L  KMAK+   V  F+  LV+   P+  ++  +L   K+   
Sbjct: 321 LRGLLASIMGKKSYAEYQLSGKMAKSPVYVRGFVQSLVDVTKPLAAEELRVLAKLKSGHL 380

Query: 322 KSKNLTFDGEIY----AWDNAYYN--NKILQEKYQIDPEDMAQYFPIESVIEGMLDTYQT 375
                  D ++      WD  +Y+  N + Q++  ++ E ++ YF + +V++G+   ++ 
Sbjct: 381 GVNVPQSDADVLRFVRPWDRDFYSTLNALQQQRKTLENEHISSYFSLGTVMQGLSRLFED 440

Query: 376 LFRLKFVEVTDPSQKNVWHEDVKQFAVWNIDDEDCPEFQGWIYFDLYPRDGKYSHAANFG 435
           ++ ++   V   + +  W  +V++  V +  +       G +Y DL+ R GK S+ A+F 
Sbjct: 441 IYGIRLEPVVAKAGET-WSPEVRRINVVSEKE----GIIGVVYCDLFERQGKTSNPAHFT 495

Query: 436 MASAFRKKDGSQ----------------SYPVTVLVCNLTKPTPTR--TAILRPGEITTL 477
           +  +     G                    PV  LVC+  + + +R    +L+  ++ TL
Sbjct: 496 VCCSRTIYPGETDLSTIQVGQLPSGEKFQLPVISLVCSFAQNSASRQGVCLLQLSDVDTL 555

Query: 478 FHELGHGIHHLVANNKLAAHNSLGS-VPWDFVEAPSQMLEYWTGRRDVLTMLSKHYETGE 536
           FHE+GH +H ++    L   N  G+    DFVE PS ++E++     VL+ + +HY T +
Sbjct: 556 FHEMGHAMHSMLGRTSL--QNISGTRCATDFVELPSILMEHFARDSRVLSRIGRHYATDQ 613

Query: 537 KIPPSLLDAWFNXXXXXXXXXXXXXXXXXXFDMYVHTREY---HGLEVRKLWNDMRREIS 593
            IP  LL                        D  +H+ +      L+V KL++ + +++ 
Sbjct: 614 PIPTELLKLNQTEMNYLQHTETFSQAKMAMLDQELHSSKALTDGKLDVVKLYHGVEKDME 673

Query: 594 LINSQNYTSTGYNTFGHIMTGSYSAGYYGYLWSQVFAADMYQTKFKSNPFNSTVGRQYRD 653
           ++        G   FGH++   Y A YY YL+ +  A+ ++Q  F  +PFN   G ++++
Sbjct: 674 VLADDQSNWCG--RFGHLL--GYGASYYSYLFDRAIASKIWQHLFAEDPFNRENGEKFKE 729

Query: 654 TILAPGGLYD 663
           ++L  GG  D
Sbjct: 730 SVLKWGGSKD 739

>Smik_11.102 Chr11 complement(175013..177331) [2319 bp, 772 aa] {ON}
           YKL134C (REAL)
          Length = 772

 Score =  161 bits (407), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 160/656 (24%), Positives = 287/656 (43%), Gaps = 64/656 (9%)

Query: 50  KDEFTLDNYIWPLLYNDQETDLLWNQLI---FLRNVSPDPKVREASLSTGKILDQWVANI 106
           +++F+ D  +  ++  D+ +D L   +    F+R+  P+ +  +A+    + + +++  +
Sbjct: 108 RNDFSEDGKLSYIMNLDRLSDTLCRVIDLCEFIRSTHPEDEFVKAAQDCHEQMFEFMNVL 167

Query: 107 SSKYDLYTNFEHIWTQYK-----DDEEFKVTNYELYKYMEKDASYYNRNKRNLTNAESIE 161
           ++   L    + +    +      +EE KV    L  + EK   Y N   R        +
Sbjct: 168 NTDVSLCNMLKSVLNNPEIAPKLSEEELKVGKILLDDF-EKSGIYMNPGVRE-------K 219

Query: 162 LGQVTRKISVDTLQFSINL---GXXXXXXXXXXXXXXGVSPLVLDQFERIIEGGVKKLKV 218
             Q++++IS+   +F  ++   G               VS  +L Q  + ++G   K+  
Sbjct: 220 FIQLSQEISLVGQEFINHIDYPGSNSVKIPCKDLDSSKVSTFLLKQLNKDVKGQNYKVP- 278

Query: 219 TFKYPDIGPVLRTATNPETRRKAYVADQNRVAANEQLLFETLDLRRRMAQLRGYKNYAEY 278
           TF Y     +L++      R+K + A  +      + L   + LR  +A L    +YAEY
Sbjct: 279 TFGYAAFA-LLKSCEIEVVRKKIWTALHSCSDKQIKRLDRLIKLRAVLANLMHKGSYAEY 337

Query: 279 NLRDKMAKNEETVIPFLTDLVERLLPVGEKDREILKSKKAEDYKSKNLTFDGEIYA---- 334
            L  KMAKN + V  F+  L+   +     + + +   KA+D K    T   EI      
Sbjct: 338 QLEGKMAKNPKDVQDFILTLMNNTIDKTANELKFIADLKAKDLKKPLTTNTDEILKLVRP 397

Query: 335 WDNAYYNNKILQEKYQIDP--EDMAQYFPIESVIEGMLDTYQTLFRLKFVEVTDPSQKNV 392
           WD  YY  K +Q      P  ++++ YF + +VI+G+ D +Q ++ ++ +E     +   
Sbjct: 398 WDRDYYTGKYIQLNPSNVPSAKEISYYFTLGNVIQGLSDLFQQIYGIR-LEPAIADEGET 456

Query: 393 WHEDVKQFAVWNIDDEDCPEFQGWIYFDLYPRDGKYSHAANFGMASAFR----------- 441
           W  DV++  V  I +E+     G IY DL+ R+GK S+ A+F +  + +           
Sbjct: 457 WSPDVRRLNV--ISEEE--GIIGIIYCDLFERNGKTSNPAHFTVCCSRQIYPHETDFSTI 512

Query: 442 --KKDGSQSY---PVTVLVCNLTKPTPTRT----AILRPGEITTLFHELGHGIHHLVANN 492
              ++ + SY   PV  LVCN + P P  +      L+  E+ TLFHE+GH +H ++   
Sbjct: 513 QVGENPNGSYFQLPVISLVCNFS-PVPIASKKSLCFLQLSEVETLFHEMGHAMHSMLGRT 571

Query: 493 KLAAHNSLGS-VPWDFVEAPSQMLEYWTGRRDVLTMLSKHYETGEKIPPSLLDAWFNXXX 551
            +   N  G+    DFVE PS ++E++     VLT + KHYETGE I   +L  +     
Sbjct: 572 HM--QNISGTRCATDFVELPSILMEHFAKDIRVLTRIGKHYETGETIQKGMLQCFMKTTN 629

Query: 552 XXXXXXXXXXXXXXXFDMYVH----TREYHGLEVRKLWNDMRREISLINSQNYTSTGYNT 607
                           D   H      +     V   +  + R + ++        G   
Sbjct: 630 FLQNCETYSQAKMAMLDQSFHDEKIMSDIDNFNVVDNYQALERHLKVLVDDQSNWCG--R 687

Query: 608 FGHIMTGSYSAGYYGYLWSQVFAADMYQTKFKSNPFNSTVGRQYRDTILAPGGLYD 663
           FGH+    Y A YY YL+ +  A+ ++ T F  +P++   G +++  +L  GGL D
Sbjct: 688 FGHLF--GYGATYYSYLFDRTIASKIWYTLFDDDPYSRNNGDKFKKHLLKWGGLKD 741

>AFR198W Chr6 (797448..799778) [2331 bp, 776 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YKL134C (OCT1)
          Length = 776

 Score =  160 bits (404), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 159/642 (24%), Positives = 271/642 (42%), Gaps = 75/642 (11%)

Query: 66  DQETDLLWNQLI---FLRNVSPDPKVREASLSTGKILDQWVANISSKYDLYTNFEHIWTQ 122
           DQ +D+L   +    FLR   PD +   A+    + + + +  +++   L    + + + 
Sbjct: 135 DQLSDILCRVIDLCEFLRAAHPDEQFVAAAQECHEQMFEIMNILNTDVVLCKRLKQVLSD 194

Query: 123 YK-----DDEEFKVTNYELYKYMEKDASYYNRNKRNLTNAESIELGQVTRKISVDTLQFS 177
                    EE +V +  L  + EK  +Y +   R     + I+L Q    I  D +  +
Sbjct: 195 ENISSKLSSEEIRVGHILLEDF-EKAGAYASPEVRK----QFIQLSQNISIIGQDFINNT 249

Query: 178 INLGXXXXXXXXXXXXXXGVSPLVLDQFERIIEGGVKKLKVTFKYPDIG----PVLRTAT 233
            +L               G S LVL Q  +   G        +K P  G     +L    
Sbjct: 250 ESLSSSYIKIPCKDLESSGTSHLVLRQLTKDTMGN------NYKIPTSGYAPYTLLNACP 303

Query: 234 NPETRRKAYVADQNRVAANEQLLFETLDLRRRMAQLRGYKNYAEYNLRDKMAKNEETVIP 293
           +   RR+ + A  +      + L   L LRR++A + G  +Y  Y L  KMAK+ E V  
Sbjct: 304 SEAIRRQVWTAMFSCSEKQVKRLKSLLQLRRKLANIMGATDYVSYQLEGKMAKSPENVKN 363

Query: 294 FLTDLVERLLPVGEKD-REILKSKKAEDYKSKNLTFDGEIYAWDNAYYNN---KILQEKY 349
           FL  LV+   P+   +  E+ K K+  +  S+  T    +  WD  YY++      +  +
Sbjct: 364 FLNTLVDHTKPLAAGELEELAKLKRNVENLSETNTLK-LMRPWDRDYYSSLSPNFTRPNH 422

Query: 350 QIDP-EDMAQYFPIESVIEGMLDTYQTLFRLKFVEVTDPSQKNVWHEDVKQFAVWNIDDE 408
           ++D    +  YF +  V++G+ D ++ ++ +    V   + +  W  DV++  V +    
Sbjct: 423 RVDGFTSINTYFSLGVVMQGISDLFRDIYGISLKPVVAQAGE-TWAPDVRKLQVIS---- 477

Query: 409 DCPEFQGWIYFDLYPRDGKYSHAANFGMASAFR---------------KKDGSQ-SYPVT 452
           +     G IY DL  R GK +  ++F +  + +                 DGS+   PV 
Sbjct: 478 ETEGIIGLIYCDLLERPGKTTSPSHFTVCCSRQIYPEENDFSTIQVGENPDGSRFQMPVI 537

Query: 453 VLVCNL--TKPTPTRT-AILRPGEITTLFHELGHGIHHLVANNKLAAHNSLGSVPWDFVE 509
            L+CN   T+    ++  +L   ++ TLFHE+GH +H ++   +L   +    V  DFVE
Sbjct: 538 SLICNFRATRHGKNKSLCLLELSDVETLFHEMGHALHSMLGRTQLQNLSGTRCVT-DFVE 596

Query: 510 APSQMLEYWTGRRDVLTMLSKHYETGEKIPPSLLDAWFNXXXXXXXXXXXXXXXXXXFDM 569
            PS ++E++   R VL  +S +Y TGE IP  LL A+                     D 
Sbjct: 597 LPSILMEHFAKDRRVLLRISSNYATGEPIPEELLSAFQEQNNFLKNTETFSQIKMSMLDQ 656

Query: 570 YVHT--------REYHGLEVRKLWNDMRREISLINSQNYTSTGYNTFGHIMTGSYSAGYY 621
            +H+          YHGLE         RE+ ++        G   FGH+    Y A YY
Sbjct: 657 RLHSITDQDDIIAVYHGLE---------REMEVLVDDQTNWCG--RFGHLF--GYGASYY 703

Query: 622 GYLWSQVFAADMYQTKFKSNPFNSTVGRQYRDTILAPGGLYD 663
            YL  +  AA ++   FK +PF+ + G ++++ +L  GG  D
Sbjct: 704 SYLMDRAIAAKIWDHLFKKDPFSRSSGEKFKEGVLKWGGSRD 745

>KLTH0D04730g Chr4 (432572..434890) [2319 bp, 772 aa] {ON} similar
           to uniprot|P35999 Saccharomyces cerevisiae YKL134C OCT1
           Mitochondrial intermediate peptidase cleaves N-terminal
           residues of a subset of proteins upon import after their
           cleavage by mitochondrial processing peptidase
           (Mas1p-Mas2p) may contribute to mitochondrial iron
           homeostasis
          Length = 772

 Score =  159 bits (403), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 125/504 (24%), Positives = 234/504 (46%), Gaps = 56/504 (11%)

Query: 196 GVSPLVLDQFERIIEGGVKKLKVTFKYPDIG----PVLRTATNPETRRKAYVADQNRVAA 251
           G+SPL+L+   R  +G        +K P  G     +LR+  +   R K + A  +    
Sbjct: 258 GISPLLLNHLSRDTKGQ------NYKVPTYGYIAFSILRSCPSENIRMKVWTAVHSCPEK 311

Query: 252 NEQLLFETLDLRRRMAQLRGYKNYAEYNLRDKMAKNEETVIPFLTDLVERLLPVGEKDRE 311
               L   + LR  +AQ+ G  +Y++Y L  KMAK+   V  F+  L E + P+  ++  
Sbjct: 312 QITRLKHLVKLRGLLAQIMGKNSYSDYQLEGKMAKSPVYVRGFVESLAEAIKPLAMRELR 371

Query: 312 ILKSKKAEDYKSKNLTFDGEIYA----WDNAYYNNKI--LQEKYQIDPEDMAQYFPIESV 365
            L + K+          D E+      WD  +Y+  I   Q++  ++ E +  YF + +V
Sbjct: 372 ALANLKSSHLDLPIPKTDEEVLKFVRPWDRDFYSTLISLQQQRKTLENEQINSYFSLGTV 431

Query: 366 IEGMLDTYQTLFRLKFVEVTDPSQKNV---WHEDVKQFAVWNIDDEDCPEFQGWIYFDLY 422
           ++G+    + ++ ++     +P+   V   W  +V++  V  + D++     G +Y DL+
Sbjct: 432 MQGLSSLLEDIYGIRL----EPAVAKVGETWSPEVRRINV--VSDQE--GVIGVVYCDLF 483

Query: 423 PRDGKYSHAANFGMASAFR----------KKDGSQ-------SYPVTVLVCNLTKPTPTR 465
            R GK S+ A+F +  + +           + G Q         PV  LVC+ ++ + ++
Sbjct: 484 ERQGKTSNPAHFTVCCSRQIYPEETDLSTIQVGQQPSSGQIFQLPVISLVCSFSQNSGSK 543

Query: 466 --TAILRPGEITTLFHELGHGIHHLVANNKLAAHNSLGS-VPWDFVEAPSQMLEYWTGRR 522
               +L+  E+ TLFHE+GH IH ++    L   N  G+    DFVE PS ++E++    
Sbjct: 544 KDVCLLQLSEVDTLFHEMGHAIHSMLGRTSL--QNISGTRCATDFVELPSILMEHFAHDS 601

Query: 523 DVLTMLSKHYETGEKIPPSLLDAWFNXXXXXXXXXXXXXXXXXXFDMYVHTREY---HGL 579
            VL+ + KHY T E +P  LL    N                   D  +H+        +
Sbjct: 602 RVLSRIGKHYITNEPVPDELLHLNQNELKYLQNTETFSQAKMAMLDQEMHSPRMLTDGPV 661

Query: 580 EVRKLWNDMRREISLINSQNYTSTGYNTFGHIMTGSYSAGYYGYLWSQVFAADMYQTKFK 639
           +V ++++++ +++ ++        G   FGH++   Y A YY YL+ +  A+ ++Q  F 
Sbjct: 662 DVVEIYHEVEKQMGVLTDDKSNWCG--RFGHLL--GYGASYYSYLFDRAIASKVWQHLFA 717

Query: 640 SNPFNSTVGRQYRDTILAPGGLYD 663
           ++PF+   G ++++++L  GG  D
Sbjct: 718 NDPFSRKSGEKFKNSVLRWGGSRD 741

>YKL134C Chr11 complement(189124..191442) [2319 bp, 772 aa] {ON}
           OCT1Mitochondrial intermediate peptidase, cleaves
           destabilizing N-terminal residues of a subset of
           proteins upon import, after their cleavage by
           mitochondrial processing peptidase (Mas1p-Mas2p); may
           contribute to mitochondrial iron homeostasis
          Length = 772

 Score =  159 bits (401), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 131/502 (26%), Positives = 221/502 (44%), Gaps = 53/502 (10%)

Query: 197 VSPLVLDQFERIIEGGVKKLKVTFKYPDIG----PVLRTATNPETRRKAYVADQNRVAAN 252
           VS  +L Q  + ++G        +K P  G     +L++  N   R+K + A  +     
Sbjct: 258 VSTFLLKQLNKDVKGQ------NYKVPTFGYAAYALLKSCENEMVRKKLWTALHSCSDKQ 311

Query: 253 EQLLFETLDLRRRMAQLRGYKNYAEYNLRDKMAKNEETVIPFLTDLVERLLPVGEKDREI 312
            + L   + LR  +A L    +YAEY L  KMAKN + V  F+  L+   +     + + 
Sbjct: 312 VKRLSHLIKLRAILANLMHKTSYAEYQLEGKMAKNPKDVQDFILTLMNNTIEKTANELKF 371

Query: 313 LKSKKAEDYKSKNLTFDGEIYA----WDNAYYNNKILQEKYQIDP--EDMAQYFPIESVI 366
           +   KA+D K    T   EI      WD  YY  K  Q      P  ++++ YF + +VI
Sbjct: 372 IAELKAKDLKKPLTTNTDEILKLVRPWDRDYYTGKYFQLNPSNSPNAKEISYYFTLGNVI 431

Query: 367 EGMLDTYQTLFRLKF-VEVTDPSQKNVWHEDVKQFAVWNIDDEDCPEFQGWIYFDLYPRD 425
           +G+ D +Q ++ ++    +TD  +   W  DV++  V  I +E+     G IY DL+ R+
Sbjct: 432 QGLSDLFQQIYGIRLEPAITDEGE--TWSPDVRRLNV--ISEEE--GIIGIIYCDLFERN 485

Query: 426 GKYSHAANFGMASAFR---------------KKDGSQ-SYPVTVLVCNLTK---PTPTRT 466
           GK S+ A+F +  + +                 DG+    PV  LVCN +     +    
Sbjct: 486 GKTSNPAHFTVCCSRQIYPSETDFSTIQVGENPDGTYFQLPVISLVCNFSPILIASKKSL 545

Query: 467 AILRPGEITTLFHELGHGIHHLVANNKLAAHNSLGS-VPWDFVEAPSQMLEYWTGRRDVL 525
             L+  E+ TLFHE+GH +H ++    +   N  G+    DFVE PS ++E++     +L
Sbjct: 546 CFLQLSEVETLFHEMGHAMHSMLGRTHM--QNISGTRCATDFVELPSILMEHFAKDIRIL 603

Query: 526 TMLSKHYETGEKIPPSLLDAWFNXXXXXXXXXXXXXXXXXXFDMYVH----TREYHGLEV 581
           T + KHY TGE I   +L  +                     D   H      +    +V
Sbjct: 604 TKIGKHYGTGETIQADMLQRFMKSTNFLQNCETYSQAKMAMLDQSFHDEKIISDIDNFDV 663

Query: 582 RKLWNDMRREISLINSQNYTSTGYNTFGHIMTGSYSAGYYGYLWSQVFAADMYQTKFKSN 641
            + +  + R + ++        G   FGH+    Y A YY YL+ +  A+ ++   F+ +
Sbjct: 664 VENYQALERRLKVLVDDQSNWCG--RFGHLF--GYGATYYSYLFDRTIASKIWYALFEDD 719

Query: 642 PFNSTVGRQYRDTILAPGGLYD 663
           P++   G +++  +L  GGL D
Sbjct: 720 PYSRKNGDKFKKHLLKWGGLKD 741

>TBLA0I00710 Chr9 (128272..130593) [2322 bp, 773 aa] {ON} Anc_2.432
           YKL134C
          Length = 773

 Score =  158 bits (399), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 127/504 (25%), Positives = 233/504 (46%), Gaps = 57/504 (11%)

Query: 202 LDQFERIIEGGVKKLKVT-------FKYPDIGPVLRTA----TNPETRRKAYVADQNRVA 250
            D+F++  +    K K++       +K P  G +  TA     + E R+K +VA  +   
Sbjct: 254 CDEFDKACDYPALKYKLSKDLSGKYYKIPTYGKIPYTALLKCKDEELRKKLWVAFHS--C 311

Query: 251 ANEQL--LFETLDLRRRMAQLRGYKNYAEYNLRDKMAKNEETVIPFLTDLVERLLPVGEK 308
           +N+Q+  L + +  R  +A+L    +Y+EY L  KMAK  + V  FL  L++ +LP   K
Sbjct: 312 SNKQIERLTKIIKHRIELAKLLSKSSYSEYTLEGKMAKGPKEVNNFLNALLKSILPEVTK 371

Query: 309 DREILKSKKA--EDY--KSKNLTFDGEIYAWDNAYYN--NKILQEKYQIDPEDMAQYFPI 362
           + E + +KK   E +  ++   +    I  WD  YYN      +  YQ+    + +YF +
Sbjct: 372 ELEPISNKKCLSEGFSLETSEQSILNNIKPWDRDYYNPIQATSEGAYQM---LIMEYFTL 428

Query: 363 ESVIEGMLDTYQTLFRLKFVEVTDPSQKNVWHEDVKQFAVWNIDDEDCPEFQGWIYFDLY 422
            ++I G+ + + +++ ++F E         W +DV++  V + D+       G IY DL+
Sbjct: 429 GNIIHGLSNLFNSIYGIRF-EPGKIEDGETWSKDVRKLNVISEDE----GLIGVIYCDLF 483

Query: 423 PRDGKYSHAANFGMASA----------------FRKKDGSQ-SYPVTVLVCNL---TKPT 462
            R+GK    +++ +  +                   K G     P+  LVCN        
Sbjct: 484 EREGKSESPSHYTICCSREIYSEEHDLSTIQTGVNNKTGKNFQLPIVSLVCNFQVTNAKE 543

Query: 463 PTRTAILRPGEITTLFHELGHGIHHLVANNKLAAHNSLGSVPWDFVEAPSQMLEYWTGRR 522
             R   L+  EI TLFHE+GH +H ++   +    +    V  DFVE PS ++E++    
Sbjct: 544 SRRICFLQHHEIETLFHEMGHAMHSMLGRTRFQTISGTRCVS-DFVEIPSILMEFFANNP 602

Query: 523 DVLTMLSKHYETGEKIPPSLLDAWFNXXXXXXXXXXXXXXXXXXFDMYVHTREYHGL--- 579
            VL  +S+HY++GE I   +L+ +                     D  +H    + L   
Sbjct: 603 KVLIDISRHYDSGESIDIEVLNKYLENTKQFKACETYSQGKMALLDQRLHAENANSLDNI 662

Query: 580 EVRKLWNDMRREISLINSQNYTSTGYNTFGHIMTGSYSAGYYGYLWSQVFAADMYQTKFK 639
           +V ++++++ +E+S++        G   FGH+    Y A YY YL+ +  A  ++++ F+
Sbjct: 663 DVVEIYHNLEKELSVLPDTESNWCG--RFGHLY--GYGALYYCYLFDRAIATKIWESLFQ 718

Query: 640 SNPFNSTVGRQYRDTILAPGGLYD 663
           ++PF+   G  +++ +L  GG  D
Sbjct: 719 NDPFSRKGGNIFKEQLLKWGGSKD 742

>TDEL0A02080 Chr1 complement(373425..375788) [2364 bp, 787 aa] {ON}
           Anc_2.432 YKL134C
          Length = 787

 Score =  158 bits (399), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 146/633 (23%), Positives = 267/633 (42%), Gaps = 81/633 (12%)

Query: 78  FLRNVSPDPKVREASLSTGKILDQWVANISSKYDLYTNFEHIWTQYK-----DDEEFKVT 132
           F+R+  PD    EA+ +  + + +++  +++  +L      + T  +      +EE  V 
Sbjct: 152 FIRSSHPDSSFIEAAQACHEEMFEFMNILNTDVELCDTLRQVLTDPEIKGKLSNEEITVG 211

Query: 133 NYELYKYMEKDASYYNRNKRNLTNAESIELGQVTRKISVDTLQFSINLGXXXXXXXXXXX 192
              L  + EK   Y N   R+   A S E+  V ++   +T     N             
Sbjct: 212 KILLEDF-EKSGIYMNPEVRDQFIALSQEISLVGQEFINNTDYVRSN----YIKIKCEEV 266

Query: 193 XXXGVSPLVLDQFERIIEGGVKKLKVTFKYPDIG----PVLRTATNPETRRKAYVADQNR 248
              G++ L++ Q  + + G        +K P  G     +LR+  + E R   + A    
Sbjct: 267 DNSGINKLLISQLPKDVRGKY------YKIPTHGYIAYSILRSCPDEEIRMNLWTAMHRC 320

Query: 249 VAANEQLLFETLDLRRRMAQLRGYKNYAEYNLRDKMAKNEETVIPFLTDLVERLLP---- 304
                  L + L LR  +A+L G +++A+Y L  KMA+  + V  F+  LV  + P    
Sbjct: 321 SDKQINRLDQLLRLRAILAKLMGKESFAQYQLEGKMAQTPQQVRDFIGTLVNYMRPKTIE 380

Query: 305 ---------VGEKDREILKSKKAEDYKSKNLTFDGEIYAWDNAYYNN--KILQEKYQIDP 353
                      ++ REI  S   +D  S        +  WD  YY +   + Q +  ID 
Sbjct: 381 ELKFIYELKSKQEKREIQPSPSEQDIASM-------VRPWDREYYTSMYSLQQRRDAIDD 433

Query: 354 EDMAQYFPIESVIEGMLDTYQTLFRLKFVEVTDPSQKNVWHEDVKQFAVWNIDDEDCPE- 412
           E ++ YF + +VI+G+ D +++++ ++   V  P     +  +V++  V       C + 
Sbjct: 434 EQISSYFTLGNVIQGLSDLFESIYGIRLEPVV-PKTGETFSPEVRRLNVV------CEQE 486

Query: 413 -FQGWIYFDLYPRDGKYSHAANFGMASA----------------FRKKDGSQSYPVTVLV 455
              G +Y DL+ R GK S+ ++F +  +                F  +      PV  LV
Sbjct: 487 GVIGVVYCDLFERAGKTSNPSHFTVCCSRQIYPKETEFSTIQTGFNSEGLMFQLPVIALV 546

Query: 456 CNLTKPTPTR---TAILRPGEITTLFHELGHGIHHLVANNKLAAHNSLGS-VPWDFVEAP 511
           CN +  T +      +L+  E+ TLFHE+GH +H ++   +L   N  G+    DFVE P
Sbjct: 547 CNFSSSTDSEGKSICLLQLNEVETLFHEMGHAMHSMLGRTRL--QNISGTRCATDFVELP 604

Query: 512 SQMLEYWTGRRDVLTMLSKHYETGEKIPPSLLDAWFNXXXXXXXXXXXXXXXXXXFDMYV 571
           S ++E++     VL  + KH+ TG  I   LL  +                     D  +
Sbjct: 605 SILMEHFARDVRVLERIGKHHRTGAPISEKLLLNYLEETKFMQHCETFSQAKMAMLDQDL 664

Query: 572 H----TREYHGLEVRKLWNDMRREISLINSQNYTSTGYNTFGHIMTGSYSAGYYGYLWSQ 627
           H     +++   +V   +  + R++ ++        G   FGH+    Y A YY YL+ +
Sbjct: 665 HGEKVIKDFDHFDVTAAYQQLERDMKVLVDDKSNWCG--KFGHLF--GYGATYYSYLFDR 720

Query: 628 VFAADMYQTKFKSNPFNSTVGRQYRDTILAPGG 660
             A+ ++ + F S+P++   G ++++ +L  GG
Sbjct: 721 AIASKVWDSLFSSDPYSRVNGEKFKECVLKWGG 753

>KLLA0B12397g Chr2 complement(1084129..1086468) [2340 bp, 779 aa]
           {ON} similar to uniprot|P35999 Saccharomyces cerevisiae
           YKL134C OCT1 Mitochondrial intermediate peptidase
           cleaves N-terminal residues of a subset of proteins upon
           import after their cleavage by mitochondrial processing
           peptidase (Mas1p-Mas2p) may contribute to mitochondrial
           iron homeostasis
          Length = 779

 Score =  152 bits (385), Expect = 8e-38,   Method: Compositional matrix adjust.
 Identities = 128/502 (25%), Positives = 226/502 (45%), Gaps = 48/502 (9%)

Query: 197 VSPLVLDQFERIIEGGVKKLKVTFKYPDIGPVLRTATNPETRRKAYVADQNRVAANEQLL 256
           V+ +V  Q ++ I G   K+      P    +LRT ++   R K +    +   A  + L
Sbjct: 259 VNKMVCSQMKKDITGEYYKVPTYGYIPH--TLLRTCSDEVIRMKIWTEMHSCSDAQIERL 316

Query: 257 FETLDLRRRMAQLRGYKNYAEYNLRDKMAKNEETVIPFLTDLVERLLPVGEKDREILKSK 316
            + + LR  +A+L G +N+A+Y L  KMAK  E V  FL  LV         + + L   
Sbjct: 317 TKLISLRVELAKLLGSQNFAQYQLHGKMAKTPENVSGFLESLVHSTRIKAASELKPLAVL 376

Query: 317 KAEDYKSKNLTFDGEIYA----WDNAYYNN-KILQEKYQI---DPEDMAQYFPIESVIEG 368
           K+E   ++      E+      WD  YY + + L ++      + E ++  F +  V++G
Sbjct: 377 KSELTGTQTPHTSEEVLELMKPWDRDYYGSIQALAQRRSSSLDNGESISSSFSLGVVMQG 436

Query: 369 MLDTYQTLFRLKFVEVTDPSQKNVWHEDVKQFAVWNIDDEDCPEFQGWIYFDLYPRDGKY 428
           + D ++ ++ +K V  T P     W  DV++  V  +D+ D     G +Y DL+ R+GK 
Sbjct: 437 LSDLFEKIYGIKLVPAT-PKTGETWSPDVRRIDV--VDEHD--GLIGVMYCDLFEREGKT 491

Query: 429 SHAANFGMASA----FRKKDGSQ------------SYPVTVLVC-------NLTKPTPTR 465
            + A+F +  +      + D S               PV  LVC       N+      +
Sbjct: 492 PNPAHFTVCCSRNMYLNEADTSTIQVGVNSNGQKFQLPVISLVCDFRWVEVNMGDGKHQQ 551

Query: 466 TAILRPGEITTLFHELGHGIHHLVANNKLAAHNSLGS-VPWDFVEAPSQMLEYWTGRRDV 524
             +L+  EI TLFHE+GH +H ++   +L   N  G+    DFVE PS ++E++     V
Sbjct: 552 MCLLQLNEIETLFHEMGHAMHSMLGRTQL--QNVSGTRCATDFVELPSILMEHFARDTRV 609

Query: 525 LTMLSKHYETGEKIPPSLLDAWFNXXXXXXXXXXXXXXXXXXFDMYVHTREY---HGLEV 581
           L+ +S HY+TG+ +   +L                        D  +H  ++     ++V
Sbjct: 610 LSSISSHYKTGKSLDVEVLKNHQLENQFLQNCETFSQIKMSFLDQELHNLDHTTDGSIDV 669

Query: 582 RKLWNDMRREISLINSQNYTSTGYNTFGHIMTGSYSAGYYGYLWSQVFAADMYQTKFKSN 641
             +++ + R ++++        G   FGH+    Y A YY YL+ +  A+ ++   F+ +
Sbjct: 670 IAIYHRLERRLAVLPDDQSNWCG--KFGHLF--GYGASYYSYLFDRAIASKIWDHLFEQD 725

Query: 642 PFNSTVGRQYRDTILAPGGLYD 663
           PFN T G ++++ +L  GG  D
Sbjct: 726 PFNRTNGTKFKEGLLQWGGSRD 747

>NCAS0A04280 Chr1 complement(864327..866648) [2322 bp, 773 aa] {ON}
           Anc_2.432
          Length = 773

 Score =  150 bits (379), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 145/633 (22%), Positives = 274/633 (43%), Gaps = 77/633 (12%)

Query: 78  FLRNVSPDPKVREASLSTGKILDQWVANISSKYDLYTNFEHIWTQYKDD-----EEFKVT 132
           F+R+  PD    +A+    + + +++  +++   L    +H+      +     EE KV 
Sbjct: 140 FIRSTHPDEAFVKAAQDCHEQMFEFMNVLNTDVVLCDILKHVLNDPNINSKLTPEEIKVG 199

Query: 133 NYELYKYMEKDASYYNRNKRNLTNAESIELGQVTRKISVDTLQFSINLGXXXXXXXXXXX 192
              L  + EK   Y + N R        +   ++++IS+    F  N+            
Sbjct: 200 KLLLEDF-EKSGIYMDPNIRK-------QFISLSQEISLTGQDFINNIDLIKSNHVKIKC 251

Query: 193 X---XXGVSPLVLDQFERIIEGGVKKLKVTFKYPDIG--PVLRTATNPETRRKAYVADQN 247
                 GV+ L+L Q  + I G        +K P  G  P+    + P+   +A V    
Sbjct: 252 SELNKSGVNSLLLKQLPKDITGKY------YKIPTSGYIPISLIRSCPDATIRAKVWASL 305

Query: 248 RVAANEQL--LFETLDLRRRMAQLRGYKNYAEYNLRDKMAKNEETVIPFLTDLVERLLPV 305
               N+Q+  L   + LR  +A L    ++A+Y L  KMAK  + V  F+  L++ + P 
Sbjct: 306 HSCPNDQIRRLTHLVKLRAILAHLLNKCSFAKYQLEGKMAKTPQNVRDFIKTLMDYMRPK 365

Query: 306 GEKDREILKSKKAEDYK-----SKNLTFDGEIYAWDNAYYNNKILQEK----YQIDPEDM 356
             ++ + +   K ++       S     D  I  WD  YY     + K    Y+  P +M
Sbjct: 366 AAQELKFMADLKCKELNIPTSDSTTAILD-LISPWDREYYTTIHSKAKDVNLYENHPINM 424

Query: 357 AQYFPIESVIEGMLDTYQTLFRLKFVEVTDPSQKNVWHEDVKQFAVWNIDDEDCPEFQGW 416
             YF + ++++G+   +Q ++ ++ +E   P +   W  +V++  V +    +     G 
Sbjct: 425 --YFTMGNIMKGLSHIFQRIYGIR-LEAVVPEEGETWSPEVRRLNVIS----ETEGLIGV 477

Query: 417 IYFDLYPRDGKYSHAANFGMASAFR---------------KKDGSQ-SYPVTVLVCNLTK 460
           +Y DL+ R GK S+ A+F +  + +                 DG+    PV  LVCN + 
Sbjct: 478 VYCDLFERAGKTSNPAHFTVCCSRQIYPDENDLSTIQIGTNPDGTAFQLPVISLVCNFSS 537

Query: 461 PTPTR---TAILRPGEITTLFHELGHGIHHLVANNKLAAHNSLGS-VPWDFVEAPSQMLE 516
              +      +L+  EI TLFHE+GH +H ++  ++L   N  G+    DFVE PS ++E
Sbjct: 538 TLTSNDKMICLLQLNEIETLFHEMGHAMHSMLGRSRL--QNVSGTRCATDFVELPSILME 595

Query: 517 YWTGRRDVLTMLSKHYETGEKIPPSLLDAWFNXXXXXXXXXXXXXXXXXXFDMYVHT--- 573
           ++   + VL  +  HYET E++   +++A                      D  +++   
Sbjct: 596 HFARDKRVLHEIGFHYETNERVSEYVIEAHLKKMKFLQDCETFSQGKMAMLDQELYSENI 655

Query: 574 -REYHGLEVRKLWNDMRREISLI--NSQNYTSTGYNTFGHIMTGSYSAGYYGYLWSQVFA 630
            ++   ++V K++  +  ++ ++  N  N+       FGH+    Y A YY YL+ +  A
Sbjct: 656 IKDLDHVDVVKIYQTLEEDLKVLVDNKSNWCGK----FGHLF--GYGASYYSYLFDRAIA 709

Query: 631 ADMYQTKFKSNPFNSTVGRQYRDTILAPGGLYD 663
           + ++   F  +PF+   G ++++ +L  GGL D
Sbjct: 710 SKVWDQLFAKDPFSREGGEKFKNCVLKWGGLRD 742

>CAGL0C02585g Chr3 (263270..265585) [2316 bp, 771 aa] {ON} highly
           similar to uniprot|P32794 Saccharomyces cerevisiae
           YLR397c AFG2
          Length = 771

 Score = 37.0 bits (84), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 32/63 (50%), Gaps = 5/63 (7%)

Query: 417 IYFD----LYP-RDGKYSHAANFGMASAFRKKDGSQSYPVTVLVCNLTKPTPTRTAILRP 471
           I+FD    L P RDG  + AAN  + S   + DG +     V+V    +P    +A+LRP
Sbjct: 604 IFFDEIDALSPDRDGSSTSAANHVLTSLLNEIDGVEELNGVVIVAATNRPDEIDSALLRP 663

Query: 472 GEI 474
           G +
Sbjct: 664 GRL 666

>YLR397C Chr12 complement(912550..914892) [2343 bp, 780 aa] {ON}
           AFG2ATPase of the CDC48/PAS1/SEC18 (AAA) family, forms a
           hexameric complex; is essential for pre-60S maturation
           and release of several preribosome maturation factors;
           may be involved in degradation of aberrant mRNAs
          Length = 780

 Score = 36.6 bits (83), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 31/63 (49%), Gaps = 5/63 (7%)

Query: 417 IYFD----LYP-RDGKYSHAANFGMASAFRKKDGSQSYPVTVLVCNLTKPTPTRTAILRP 471
           I+FD    L P RDG  + AAN  + S   + DG +     V+V    +P     A+LRP
Sbjct: 613 IFFDEIDALSPDRDGSSTSAANHVLTSLLNEIDGVEELKGVVIVAATNRPDEIDAALLRP 672

Query: 472 GEI 474
           G +
Sbjct: 673 GRL 675

>Smik_12.484 Chr12 complement(851231..853573) [2343 bp, 780 aa] {ON}
           YLR397C (REAL)
          Length = 780

 Score = 36.6 bits (83), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 31/63 (49%), Gaps = 5/63 (7%)

Query: 417 IYFD----LYP-RDGKYSHAANFGMASAFRKKDGSQSYPVTVLVCNLTKPTPTRTAILRP 471
           I+FD    L P RDG  + AAN  + S   + DG +     V+V    +P     A+LRP
Sbjct: 613 IFFDEIDALSPDRDGSSTSAANHVLTSLLNEIDGVEELKGVVIVAATNRPDEIDAALLRP 672

Query: 472 GEI 474
           G +
Sbjct: 673 GRL 675

>KNAG0B06160 Chr2 complement(1209738..1212056) [2319 bp, 772 aa]
           {ON} Anc_4.259 YLR397C
          Length = 772

 Score = 36.2 bits (82), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 32/63 (50%), Gaps = 5/63 (7%)

Query: 417 IYFD----LYP-RDGKYSHAANFGMASAFRKKDGSQSYPVTVLVCNLTKPTPTRTAILRP 471
           I+FD    L P RDG+ + AAN  + S   + DG +     V+V    +P     A+LRP
Sbjct: 605 IFFDEIDALSPDRDGESTSAANHVLTSLLNEIDGVEELNGVVIVAATNRPDEIDPALLRP 664

Query: 472 GEI 474
           G +
Sbjct: 665 GRL 667

>Skud_12.482 Chr12 complement(852748..855081) [2334 bp, 777 aa] {ON}
           YLR397C (REAL)
          Length = 777

 Score = 35.4 bits (80), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 31/63 (49%), Gaps = 5/63 (7%)

Query: 417 IYFD----LYP-RDGKYSHAANFGMASAFRKKDGSQSYPVTVLVCNLTKPTPTRTAILRP 471
           I+FD    L P RDG  + AAN  + S   + DG +     V+V    +P     A+LRP
Sbjct: 610 IFFDEIDALSPVRDGGSTSAANHVLTSLLNEIDGVEELKGVVIVAATNRPDEIDGALLRP 669

Query: 472 GEI 474
           G +
Sbjct: 670 GRL 672

>Suva_10.514 Chr10 complement(878137..880479) [2343 bp, 780 aa] {ON}
           YLR397C (REAL)
          Length = 780

 Score = 34.3 bits (77), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 32/63 (50%), Gaps = 5/63 (7%)

Query: 417 IYFD----LYP-RDGKYSHAANFGMASAFRKKDGSQSYPVTVLVCNLTKPTPTRTAILRP 471
           I+FD    L P RDG  + AA+  + S   + DG +     V+V    +P    +A+LRP
Sbjct: 613 IFFDEIDALSPDRDGGSTSAASHVLTSLLNEIDGVEELKGVVIVAATNRPDEIDSALLRP 672

Query: 472 GEI 474
           G +
Sbjct: 673 GRL 675

>AAR080W Chr1 (487099..488814) [1716 bp, 571 aa] {ON} NOHBY110; No
           homolog in Saccharomyces cerevisiae
          Length = 571

 Score = 33.9 bits (76), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 23/49 (46%)

Query: 445 GSQSYPVTVLVCNLTKPTPTRTAILRPGEITTLFHELGHGIHHLVANNK 493
           G   +P  +LVC  T PT        P  + T+ HELGH   H  A+ +
Sbjct: 59  GRWVFPAWLLVCFSTGPTYVMMRSFVPASLQTIAHELGHPKGHPAAHCR 107

>KAFR0D00990 Chr4 (205107..206522) [1416 bp, 471 aa] {ON} Anc_8.38
           YLR058C
          Length = 471

 Score = 31.6 bits (70), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 16/35 (45%), Positives = 21/35 (60%), Gaps = 1/35 (2%)

Query: 589 RREISLINSQNYTSTG-YNTFGHIMTGSYSAGYYG 622
           R  I LI S+N+TST  Y+  G  ++  YS GY G
Sbjct: 36  RHSIDLIASENFTSTSVYDALGTPLSNKYSEGYPG 70

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.135    0.409 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 78,281,640
Number of extensions: 3516953
Number of successful extensions: 10501
Number of sequences better than 10.0: 65
Number of HSP's gapped: 10638
Number of HSP's successfully gapped: 65
Length of query: 717
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 600
Effective length of database: 40,065,477
Effective search space: 24039286200
Effective search space used: 24039286200
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 69 (31.2 bits)