Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
AGR353Cna 1ON1771778461e-117
Ecym_8180na 1ON1741684003e-49
TDEL0D030404.147aON94761124e-07
YLR012Cna 2ON99841091e-06
Suva_10.92na 2ON99841091e-06
Skud_12.80na 2ON110801091e-06
NDAI0D01780singletonON106581003e-05
ZYRO0G11176g4.147aON10565984e-05
Smik_12.75na 2ON9984967e-05
KLLA0B10219gna 1ON17944870.004
SAKL0H23122g4.147aON215107750.17
NCAS0E015508.22ON54458760.18
Kpol_YGOB_111764.147aON9990700.32
ZYRO0G17996g7.488ON145585663.2
YLR355C (ILV5)4.190ON39575637.8
CAGL0E05566g7.47ON24231627.9
Skud_12.4404.190ON39575638.6
Smik_12.4434.190ON39575628.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AGR353C
         (177 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AGR353C Chr7 complement(1385949..1386482) [534 bp, 177 aa] {ON} ...   330   e-117
Ecym_8180 Chr8 (376511..377035) [525 bp, 174 aa] {ON} similar to...   158   3e-49
TDEL0D03040 Chr4 complement(572078..572362) [285 bp, 94 aa] {ON}       48   4e-07
YLR012C Chr12 complement(169982..170281) [300 bp, 99 aa] {ON} Pu...    47   1e-06
Suva_10.92 Chr10 complement(176142..176441) [300 bp, 99 aa] {ON}...    47   1e-06
Skud_12.80 Chr12 complement(161864..162196) [333 bp, 110 aa] {ON...    47   1e-06
NDAI0D01780 Chr4 complement(414158..414478) [321 bp, 106 aa] {ON}      43   3e-05
ZYRO0G11176g Chr7 (895757..896074) [318 bp, 105 aa] {ON} some si...    42   4e-05
Smik_12.75 Chr12 complement(156916..157215) [300 bp, 99 aa] {ON}...    42   7e-05
KLLA0B10219g Chr2 complement(893941..894480) [540 bp, 179 aa] {O...    38   0.004
SAKL0H23122g Chr8 (2004664..2005311) [648 bp, 215 aa] {ON} no si...    33   0.17 
NCAS0E01550 Chr5 (291758..293392) [1635 bp, 544 aa] {ON} Anc_8.22      34   0.18 
Kpol_YGOB_11176 s1025 complement(64556..64855) [300 bp, 99 aa] {...    32   0.32 
ZYRO0G17996g Chr7 (1477518..1481885) [4368 bp, 1455 aa] {ON} wea...    30   3.2  
YLR355C Chr12 complement(838066..839253) [1188 bp, 395 aa] {ON} ...    29   7.8  
CAGL0E05566g Chr5 complement(548237..548965) [729 bp, 242 aa] {O...    28   7.9  
Skud_12.440 Chr12 complement(778396..779583) [1188 bp, 395 aa] {...    29   8.6  
Smik_12.443 Chr12 complement(777177..778364) [1188 bp, 395 aa] {...    28   8.9  

>AGR353C Chr7 complement(1385949..1386482) [534 bp, 177 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YLR012C
          Length = 177

 Score =  330 bits (846), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 162/177 (91%), Positives = 162/177 (91%)

Query: 1   MDISEMSAANQTRWLNEGFMFPTSLRMSDLRSFISDTDRMGSXXXXXXXXXXXXXXXYMV 60
           MDISEMSAANQTRWLNEGFMFPTSLRMSDLRSFISDTDRMGS               YMV
Sbjct: 1   MDISEMSAANQTRWLNEGFMFPTSLRMSDLRSFISDTDRMGSFCFMCFMCFILMLLMYMV 60

Query: 61  LASMYDCGYALRRRLEKENAAAVACQTPIWLSIYDYHTKLTPSQQNAYLEYSQRMFEQER 120
           LASMYDCGYALRRRLEKENAAAVACQTPIWLSIYDYHTKLTPSQQNAYLEYSQRMFEQER
Sbjct: 61  LASMYDCGYALRRRLEKENAAAVACQTPIWLSIYDYHTKLTPSQQNAYLEYSQRMFEQER 120

Query: 121 HRLESEKELSRTKEEAREKAHQELDWLKRITTWTCTKARYVKWSRRLQRSISSADMV 177
           HRLESEKELSRTKEEAREKAHQELDWLKRITTWTCTKARYVKWSRRLQRSISSADMV
Sbjct: 121 HRLESEKELSRTKEEAREKAHQELDWLKRITTWTCTKARYVKWSRRLQRSISSADMV 177

>Ecym_8180 Chr8 (376511..377035) [525 bp, 174 aa] {ON} similar to
           Ashbya gossypii AGR353C
          Length = 174

 Score =  158 bits (400), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 74/168 (44%), Positives = 110/168 (65%)

Query: 10  NQTRWLNEGFMFPTSLRMSDLRSFISDTDRMGSXXXXXXXXXXXXXXXYMVLASMYDCGY 69
           N+T W +E F+ P S++  +L+SF++D+D++GS               YM+ + +Y+  Y
Sbjct: 7   NRTYWSDEWFLLPESIKPKELKSFLTDSDKIGSFSFMWFTVFIISLLAYMIFSFVYEYSY 66

Query: 70  ALRRRLEKENAAAVACQTPIWLSIYDYHTKLTPSQQNAYLEYSQRMFEQERHRLESEKEL 129
           A+++R+++ +  A+  Q PIW+SI DYHTKL+P+ Q+AYLEYSQRMFEQ R RLE EK  
Sbjct: 67  AMKKRIQRRHEEALISQKPIWISICDYHTKLSPAAQDAYLEYSQRMFEQLRGRLEVEKAQ 126

Query: 130 SRTKEEAREKAHQELDWLKRITTWTCTKARYVKWSRRLQRSISSADMV 177
           S   + A+ KA +EL+ LKR+T W C +A + KW  + QR I   DMV
Sbjct: 127 STAIQNAKTKAEEELNGLKRLTAWACKRAHFSKWKFKEQRHIILEDMV 174

>TDEL0D03040 Chr4 complement(572078..572362) [285 bp, 94 aa] {ON} 
          Length = 94

 Score = 47.8 bits (112), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 27/76 (35%), Positives = 44/76 (57%), Gaps = 2/76 (2%)

Query: 97  HTKLTPSQQNAYLEYSQRMFEQERHRLESEKELSRTKEEAREKAHQELDWLKRITTWTCT 156
           +++L P+ Q  YL++ Q  FE ER  +  E++    +  A  KA +E+DWL+RIT W+  
Sbjct: 11  YSRLPPAVQEQYLDWCQNQFENEREMILFERQ-GGVQGLASRKAQEEVDWLQRITVWSYL 69

Query: 157 KARYVKWSRRLQRSIS 172
            A Y+  +R   R +S
Sbjct: 70  HA-YIPNNRGDHRFLS 84

>YLR012C Chr12 complement(169982..170281) [300 bp, 99 aa] {ON}
           Putative protein of unknown function; YLR012C is not an
           essential gene
          Length = 99

 Score = 46.6 bits (109), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 28/84 (33%), Positives = 44/84 (52%), Gaps = 3/84 (3%)

Query: 94  YDYHTKLTPSQQNAYLEYSQRMFEQERHRLESEKELSRTKEEAREKAHQELDWLKRITTW 153
           Y  + +L P QQ  YL   Q+ FEQE  R+  +++       AR+ A +E+ W  R+TTW
Sbjct: 11  YQQYLQLQPEQQEKYLALCQKDFEQETERIAFDRQ-GGVPGIARKFAQEEVAWFDRVTTW 69

Query: 154 TCTKARYVKWSRRLQRSISSADMV 177
           +   A    + RR  R++   DM+
Sbjct: 70  SYMNAYIPSYRRR--RNLLKIDML 91

>Suva_10.92 Chr10 complement(176142..176441) [300 bp, 99 aa] {ON}
           YLR012C (REAL)
          Length = 99

 Score = 46.6 bits (109), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 28/84 (33%), Positives = 45/84 (53%), Gaps = 3/84 (3%)

Query: 94  YDYHTKLTPSQQNAYLEYSQRMFEQERHRLESEKELSRTKEEAREKAHQELDWLKRITTW 153
           Y  + +L P QQ  YL   Q+ FE+E  R+  E++       AR+ A +E+ W  R+TTW
Sbjct: 11  YQQYLQLQPDQQEKYLALCQKDFERETERIAFERQ-GGVPGIARKVAQEEVAWFDRVTTW 69

Query: 154 TCTKARYVKWSRRLQRSISSADMV 177
           +   A   K+ RR  R++   +M+
Sbjct: 70  SYMNAYIPKYRRR--RNLFKINMM 91

>Skud_12.80 Chr12 complement(161864..162196) [333 bp, 110 aa] {ON}
           YLR012C (REAL)
          Length = 110

 Score = 46.6 bits (109), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 43/80 (53%), Gaps = 3/80 (3%)

Query: 97  HTKLTPSQQNAYLEYSQRMFEQERHRLESEKELSRTKEEAREKAHQELDWLKRITTWTCT 156
           + +L P QQ  YL   Q+ FE+E  R+  E++       A++ A  E+ W  RITTW+  
Sbjct: 25  YLQLQPDQQEKYLTLCQKDFERETERIAFERQ-GGVPGIAKKVAQNEVAWFDRITTWSYM 83

Query: 157 KARYVKWSRRLQRSISSADM 176
            A   K+SR+  R++   DM
Sbjct: 84  NAYIPKYSRK--RNLFKIDM 101

>NDAI0D01780 Chr4 complement(414158..414478) [321 bp, 106 aa] {ON} 
          Length = 106

 Score = 43.1 bits (100), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 23/58 (39%), Positives = 35/58 (60%), Gaps = 1/58 (1%)

Query: 94  YDYHTKLTPSQQNAYLEYSQRMFEQERHRLESEKELSRTKEEAREKAHQELDWLKRIT 151
           Y  ++K  P + NAYL Y++++FE+E  R+E EK        AR KA +EL + +R T
Sbjct: 19  YSVYSKFPPEKYNAYLLYNRKLFEEETARIEFEKA-GGIPGLARTKALRELRYFERCT 75

>ZYRO0G11176g Chr7 (895757..896074) [318 bp, 105 aa] {ON} some
           similarities with uniprot|Q07927 Saccharomyces
           cerevisiae YLR012C Hypothetical ORF
          Length = 105

 Score = 42.4 bits (98), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 40/65 (61%), Gaps = 1/65 (1%)

Query: 94  YDYHTKLTPSQQNAYLEYSQRMFEQERHRLESEKELSRTKEEAREKAHQELDWLKRITTW 153
           Y  +  L P  Q+ YL+++Q  +E++  +L+ E++       A++KA QE+ WL+R+TTW
Sbjct: 19  YMQYKSLPPEIQDEYLDWAQEQWEKQWAQLQFERQ-GGVSGIAKKKAEQEVQWLERVTTW 77

Query: 154 TCTKA 158
           +   A
Sbjct: 78  SYLHA 82

>Smik_12.75 Chr12 complement(156916..157215) [300 bp, 99 aa] {ON}
           YLR012C (REAL)
          Length = 99

 Score = 41.6 bits (96), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 26/84 (30%), Positives = 42/84 (50%), Gaps = 3/84 (3%)

Query: 94  YDYHTKLTPSQQNAYLEYSQRMFEQERHRLESEKELSRTKEEAREKAHQELDWLKRITTW 153
           Y  + +L P QQ  YL   Q  FE+E  R+  E++       A++ A +E+ W  R+TTW
Sbjct: 11  YQQYLQLQPEQQEKYLALCQEDFERETERIAFERQ-GGIPGIAKKLAQEEVAWFDRVTTW 69

Query: 154 TCTKARYVKWSRRLQRSISSADMV 177
           +   A    + RR  ++    DM+
Sbjct: 70  SYMNAYIPSYRRR--KNFLKIDML 91

>KLLA0B10219g Chr2 complement(893941..894480) [540 bp, 179 aa] {ON}
           conserved hypothetical protein
          Length = 179

 Score = 38.1 bits (87), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 30/44 (68%), Gaps = 2/44 (4%)

Query: 89  IWLSIYDYHTKLTPSQQNAYLEYSQRMFEQER--HRLESEKELS 130
           +W+SI DY  KLTP QQ+ Y++ +  ++E+E   HRL+  ++ S
Sbjct: 69  LWISIADYQDKLTPEQQDQYIQQACDLYEKEMKLHRLQKHEQES 112

>SAKL0H23122g Chr8 (2004664..2005311) [648 bp, 215 aa] {ON} no
           similarity
          Length = 215

 Score = 33.5 bits (75), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 27/107 (25%), Positives = 51/107 (47%), Gaps = 14/107 (13%)

Query: 73  RRLEKENAAAVACQTPIWLSIYDYHTKLTPSQQNAYLEYSQRMFE---QERHRLESEKEL 129
           RRL+++ + A        L I ++   L P +Q+AYL++     E   +E  R   E + 
Sbjct: 117 RRLKEQESRA--------LCILEFEA-LPPEKQDAYLDWCCAELEKALEEDKRSVVEVQT 167

Query: 130 SRTKEEAREKAHQELDWLKRITTWTCTKARYVKWSRRLQRSISSADM 176
                  +E+  +E++WL ++T+W   +A +   S R ++     DM
Sbjct: 168 HCVPGGCKERVFEEVNWLNKMTSWLFPRAYFP--SYREKKHFCDEDM 212

>NCAS0E01550 Chr5 (291758..293392) [1635 bp, 544 aa] {ON} Anc_8.22
          Length = 544

 Score = 33.9 bits (76), Expect = 0.18,   Method: Composition-based stats.
 Identities = 16/58 (27%), Positives = 31/58 (53%), Gaps = 3/58 (5%)

Query: 86  QTPIWLSIYDYHTKLTPSQQNAYLEYSQRMFEQERHRLESEKELSRTKEEAREKAHQE 143
           +TP WL+++  +TK    Q N  ++++ R      H   S K++  + E+A E+  Q+
Sbjct: 196 ETPQWLTLHGEYTKAQKIQNNLAIKFNSRFGSTSNH---SSKDIVTSNEDAAEEDDQQ 250

>Kpol_YGOB_11176 s1025 complement(64556..64855) [300 bp, 99 aa] {ON}
           ANNOTATED BY YGOB - Search-DOGS addition
          Length = 99

 Score = 31.6 bits (70), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 44/90 (48%), Gaps = 4/90 (4%)

Query: 88  PIWLSIYDYHTKLTPSQQNAYLEYSQRMFEQERHRLESEKELSRTKEEAREKAHQELDWL 147
           P+ L+ Y+   +L+ S Q  YL++ Q  F+ E  R     E    +  ARE+A  ++  L
Sbjct: 12  PLTLNQYE---RLSESDQTQYLDWCQFQFDLEVKRARESVE-GYFENLAREEAMHQVMAL 67

Query: 148 KRITTWTCTKARYVKWSRRLQRSISSADMV 177
           + IT       R+ + S + QR I   DM+
Sbjct: 68  ECITVINFPACRFSQVSTKPQRFIRLEDML 97

>ZYRO0G17996g Chr7 (1477518..1481885) [4368 bp, 1455 aa] {ON} weakly
           similar to uniprot|P34216 Saccharomyces cerevisiae
           YBL047C EDE1 Key endocytic protein involved in a network
           of interactions with other endocytic proteins binds
           membranes in a ubiquitin-dependent manner may also bind
           ubiquitinated membrane-associated proteins
          Length = 1455

 Score = 30.0 bits (66), Expect = 3.2,   Method: Composition-based stats.
 Identities = 24/85 (28%), Positives = 46/85 (54%), Gaps = 3/85 (3%)

Query: 95  DYHTKLTPS-QQNAYLEYSQRMFEQERHRLESE-KELSRTKEEAREKAHQELDWLKRITT 152
           +   KLT + ++ A LE    + E   H +ES+  EL++T EEA++K HQ    +  +  
Sbjct: 682 ELEAKLTEANKETAALEQQLTVTEGNYHAVESKVTELTQTYEEAQQKNHQLKTQISNLNA 741

Query: 153 WTCT-KARYVKWSRRLQRSISSADM 176
            + T +A+  +  R++++  S  D+
Sbjct: 742 MSSTLQAQLAEKQRQVKQERSMVDV 766

>YLR355C Chr12 complement(838066..839253) [1188 bp, 395 aa] {ON}
           ILV5Bifunctional acetohydroxyacid reductoisomerase and
           mtDNA binding protein; involved in branched-chain amino
           acid biosynthesis and maintenance of wild-type
           mitochondrial DNA; found in mitochondrial nucleoids
          Length = 395

 Score = 28.9 bits (63), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 19/75 (25%), Positives = 36/75 (48%), Gaps = 5/75 (6%)

Query: 84  ACQTPIWLSIYDYHTKLTPSQQNAYLEYSQRMFEQERHRLESEKELS-RTKEEAREKAHQ 142
           AC T       D++    P  +NA     Q ++E  ++  E+++ L   ++ + REK  +
Sbjct: 315 ACSTTARRGALDWY----PIFKNALKPVFQDLYESTKNGTETKRSLEFNSQPDYREKLEK 370

Query: 143 ELDWLKRITTWTCTK 157
           ELD ++ +  W   K
Sbjct: 371 ELDTIRNMEIWKVGK 385

>CAGL0E05566g Chr5 complement(548237..548965) [729 bp, 242 aa] {ON}
           similar to uniprot|P33122 Saccharomyces cerevisiae
           YOR344c TYE7 basic helix-loop-helix transcription factor
          Length = 242

 Score = 28.5 bits (62), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 22/31 (70%), Gaps = 2/31 (6%)

Query: 108 YLEYSQRMFEQERHRLESEKELSRTKEEARE 138
           YL+ ++++FE E HRL+S  EL   K+E +E
Sbjct: 206 YLQNNEKLFEMEVHRLKS--ELGAVKKENQE 234

>Skud_12.440 Chr12 complement(778396..779583) [1188 bp, 395 aa] {ON}
           YLR355C (REAL)
          Length = 395

 Score = 28.9 bits (63), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 19/75 (25%), Positives = 36/75 (48%), Gaps = 5/75 (6%)

Query: 84  ACQTPIWLSIYDYHTKLTPSQQNAYLEYSQRMFEQERHRLESEKELS-RTKEEAREKAHQ 142
           AC T       D++    P  +NA     Q ++E  ++  E+++ L   ++ + REK  +
Sbjct: 315 ACSTTARRGALDWY----PIFKNALKPVFQDLYESTKNGTETKRSLEFNSQPDYREKLEK 370

Query: 143 ELDWLKRITTWTCTK 157
           ELD ++ +  W   K
Sbjct: 371 ELDTIRNMEIWKVGK 385

>Smik_12.443 Chr12 complement(777177..778364) [1188 bp, 395 aa] {ON}
           YLR355C (REAL)
          Length = 395

 Score = 28.5 bits (62), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 19/75 (25%), Positives = 36/75 (48%), Gaps = 5/75 (6%)

Query: 84  ACQTPIWLSIYDYHTKLTPSQQNAYLEYSQRMFEQERHRLESEKELS-RTKEEAREKAHQ 142
           AC T       D++    P  +NA     Q ++E  ++  E+++ L   ++ + REK  +
Sbjct: 315 ACSTTARRGALDWY----PIFKNALKPVFQDLYESTKNGTETKRSLEFNSQPDYREKLEK 370

Query: 143 ELDWLKRITTWTCTK 157
           ELD ++ +  W   K
Sbjct: 371 ELDTIRNMEIWKVGK 385

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.127    0.380 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 15,866,397
Number of extensions: 547239
Number of successful extensions: 4458
Number of sequences better than 10.0: 50
Number of HSP's gapped: 4491
Number of HSP's successfully gapped: 57
Length of query: 177
Length of database: 53,481,399
Length adjustment: 102
Effective length of query: 75
Effective length of database: 41,785,467
Effective search space: 3133910025
Effective search space used: 3133910025
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 62 (28.5 bits)