Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
AGR352C5.352ON64864832810.0
SAKL0G08822g5.352ON5826667694e-93
Ecym_81815.352ON6614877676e-92
ZYRO0D10186g5.352ON6356827011e-82
Kpol_339.135.352ON6867106997e-82
TDEL0E027505.352ON5645566908e-82
KLLA0B10197g5.352ON6216906949e-82
NCAS0F028705.352ON7003136884e-80
KNAG0C055005.352ON5856776771e-79
Kwal_34.159775.352ON5975606744e-79
YDR320C (SWA2)5.352ON6687306514e-75
KAFR0C018505.352ON6467176504e-75
KLTH0H14872g5.352ON6233346337e-73
Smik_4.5795.352ON6677196234e-71
NDAI0C043205.352ON7063086247e-71
Skud_4.5865.352ON6425606191e-70
TPHA0E011105.352ON6933935931e-66
Suva_2.4895.352ON6593355813e-65
CAGL0H07095g5.352ON6613405813e-65
TBLA0H019705.352ON8403055524e-60
Ecym_23748.698ON66148830.21
TBLA0C036908.817ON40564820.25
SAKL0G06930g5.610ON210107800.29
Skud_15.4208.698ON66548800.53
YOR254C (SEC63)8.698ON66348790.61
Suva_8.3038.698ON66448790.63
KLTH0D11770g8.698ON65248780.75
NDAI0K012308.698ON68043771.0
KAFR0H023108.698ON65548751.8
KAFR0K012805.659ON15171721.9
Smik_15.4378.698ON66346752.0
ZYRO0D10934g8.698ON66349742.5
TPHA0G014808.698ON66042742.5
Kwal_26.88798.698ON65648742.7
TBLA0B037308.698ON69346742.8
AAL103W8.698ON66948742.9
NCAS0C012208.698ON66946715.3
SAKL0H05984g8.698ON65848715.5
KLLA0C09823g8.698ON66948715.7
AFR089W1.268ON103159708.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AGR352C
         (648 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AGR352C Chr7 complement(1383723..1385669) [1947 bp, 648 aa] {ON}...  1268   0.0  
SAKL0G08822g Chr7 (755393..757141) [1749 bp, 582 aa] {ON} simila...   300   4e-93
Ecym_8181 Chr8 (377372..379357) [1986 bp, 661 aa] {ON} similar t...   300   6e-92
ZYRO0D10186g Chr4 complement(856401..858308) [1908 bp, 635 aa] {...   274   1e-82
Kpol_339.13 s339 complement(21257..23317) [2061 bp, 686 aa] {ON}...   273   7e-82
TDEL0E02750 Chr5 (529920..531614) [1695 bp, 564 aa] {ON} Anc_5.3...   270   8e-82
KLLA0B10197g Chr2 complement(891842..893707) [1866 bp, 621 aa] {...   271   9e-82
NCAS0F02870 Chr6 complement(573068..575170) [2103 bp, 700 aa] {O...   269   4e-80
KNAG0C05500 Chr3 (1069670..1071427) [1758 bp, 585 aa] {ON} Anc_5...   265   1e-79
Kwal_34.15977 s34 (141005..142798) [1794 bp, 597 aa] {ON} YDR320...   264   4e-79
YDR320C Chr4 complement(1106095..1108101) [2007 bp, 668 aa] {ON}...   255   4e-75
KAFR0C01850 Chr3 (369596..371536) [1941 bp, 646 aa] {ON} Anc_5.3...   254   4e-75
KLTH0H14872g Chr8 complement(1289638..1291509) [1872 bp, 623 aa]...   248   7e-73
Smik_4.579 Chr4 complement(1032558..1034561) [2004 bp, 667 aa] {...   244   4e-71
NDAI0C04320 Chr3 complement(983914..986034) [2121 bp, 706 aa] {O...   244   7e-71
Skud_4.586 Chr4 complement(1042397..1044325) [1929 bp, 642 aa] {...   243   1e-70
TPHA0E01110 Chr5 (228116..230197) [2082 bp, 693 aa] {ON} Anc_5.3...   233   1e-66
Suva_2.489 Chr2 complement(863483..865462) [1980 bp, 659 aa] {ON...   228   3e-65
CAGL0H07095g Chr8 (700262..702247) [1986 bp, 661 aa] {ON} simila...   228   3e-65
TBLA0H01970 Chr8 (464239..466761) [2523 bp, 840 aa] {ON} Anc_5.3...   217   4e-60
Ecym_2374 Chr2 (727001..728986) [1986 bp, 661 aa] {ON} similar t...    37   0.21 
TBLA0C03690 Chr3 (882494..883711) [1218 bp, 405 aa] {ON} Anc_8.8...    36   0.25 
SAKL0G06930g Chr7 complement(569522..570154) [633 bp, 210 aa] {O...    35   0.29 
Skud_15.420 Chr15 complement(743976..745973) [1998 bp, 665 aa] {...    35   0.53 
YOR254C Chr15 complement(805032..807023) [1992 bp, 663 aa] {ON} ...    35   0.61 
Suva_8.303 Chr8 complement(544176..546170) [1995 bp, 664 aa] {ON...    35   0.63 
KLTH0D11770g Chr4 complement(961180..963138) [1959 bp, 652 aa] {...    35   0.75 
NDAI0K01230 Chr11 (280525..282567) [2043 bp, 680 aa] {ON} Anc_8....    34   1.0  
KAFR0H02310 Chr8 (441168..443135) [1968 bp, 655 aa] {ON} Anc_8.6...    33   1.8  
KAFR0K01280 Chr11 (266813..267268) [456 bp, 151 aa] {ON} Anc_5.6...    32   1.9  
Smik_15.437 Chr15 complement(754736..756727) [1992 bp, 663 aa] {...    33   2.0  
ZYRO0D10934g Chr4 complement(921917..923908) [1992 bp, 663 aa] {...    33   2.5  
TPHA0G01480 Chr7 (304449..306431) [1983 bp, 660 aa] {ON} Anc_8.6...    33   2.5  
Kwal_26.8879 s26 complement(988264..990234) [1971 bp, 656 aa] {O...    33   2.7  
TBLA0B03730 Chr2 (860167..862248) [2082 bp, 693 aa] {ON} Anc_8.6...    33   2.8  
AAL103W Chr1 (161385..163394) [2010 bp, 669 aa] {ON} Syntenic ho...    33   2.9  
NCAS0C01220 Chr3 (225905..227914) [2010 bp, 669 aa] {ON} Anc_8.698     32   5.3  
SAKL0H05984g Chr8 (530194..532170) [1977 bp, 658 aa] {ON} simila...    32   5.5  
KLLA0C09823g Chr3 (848641..850650) [2010 bp, 669 aa] {ON} simila...    32   5.7  
AFR089W Chr6 (590137..593232) [3096 bp, 1031 aa] {ON} Syntenic h...    32   8.7  

>AGR352C Chr7 complement(1383723..1385669) [1947 bp, 648 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR320C
           (SWA2)
          Length = 648

 Score = 1268 bits (3281), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 615/648 (94%), Positives = 615/648 (94%)

Query: 1   MSDPFANLLTKFKGKEKPADAQTSKNRSLNDLLAQHSVSSLSEPPATLYTPRDTRPAAGL 60
           MSDPFANLLTKFKGKEKPADAQTSKNRSLNDLLAQHSVSSLSEPPATLYTPRDTRPAAGL
Sbjct: 1   MSDPFANLLTKFKGKEKPADAQTSKNRSLNDLLAQHSVSSLSEPPATLYTPRDTRPAAGL 60

Query: 61  VDLGRESPNLPGETSGIYQSGRGNPSTEGYKSQSLIDLEDAQPHPAASVSSFEDKTTTIA 120
           VDLGRESPNLPGETSGIYQSGRGNPSTEGYKSQSLIDLEDAQPHPAASVSSFEDKTTTIA
Sbjct: 61  VDLGRESPNLPGETSGIYQSGRGNPSTEGYKSQSLIDLEDAQPHPAASVSSFEDKTTTIA 120

Query: 121 DEEQDFELAKLMSLGLDIGAANDYYHRGGRYEQLRMRRAESDGTRMHRGSNLGRNSDFCR 180
           DEEQDFELAKLMSLGLDIGAANDYYHRGGRYEQLRMRRAESDGTRMHRGSNLGRNSDFCR
Sbjct: 121 DEEQDFELAKLMSLGLDIGAANDYYHRGGRYEQLRMRRAESDGTRMHRGSNLGRNSDFCR 180

Query: 181 SRDFGRGSDLGRSGDFERGSDLGRAESSETPQWSSLRSGHSNRLVSAASNLFNRGRDFIE 240
           SRDFGRGSDLGRSGDFERGSDLGRAESSETPQWSSLRSGHSNRLVSAASNLFNRGRDFIE
Sbjct: 181 SRDFGRGSDLGRSGDFERGSDLGRAESSETPQWSSLRSGHSNRLVSAASNLFNRGRDFIE 240

Query: 241 DQXXXXXXXXXXXXXXXXXXNERFSNHTQESDYSVNQTNDQAHLIHTQPTAAEVDLLEGF 300
           DQ                  NERFSNHTQESDYSVNQTNDQAHLIHTQPTAAEVDLLEGF
Sbjct: 241 DQLATHARTSASSRSTLSDSNERFSNHTQESDYSVNQTNDQAHLIHTQPTAAEVDLLEGF 300

Query: 301 ADTEVVQHQSTLEVPRMQAAGVKSEESLIDFSSEGPSKSAAQLNYVSITPLELSGYYDFN 360
           ADTEVVQHQSTLEVPRMQAAGVKSEESLIDFSSEGPSKSAAQLNYVSITPLELSGYYDFN
Sbjct: 301 ADTEVVQHQSTLEVPRMQAAGVKSEESLIDFSSEGPSKSAAQLNYVSITPLELSGYYDFN 360

Query: 361 KTAAESYKKGDYHAAFQDYLKSLNTLPLAHPLRIIALSNIITTQLKIGEHTESMKNINSA 420
           KTAAESYKKGDYHAAFQDYLKSLNTLPLAHPLRIIALSNIITTQLKIGEHTESMKNINSA
Sbjct: 361 KTAAESYKKGDYHAAFQDYLKSLNTLPLAHPLRIIALSNIITTQLKIGEHTESMKNINSA 420

Query: 421 VELLQDVPFDAQIQDTSPPRTYKEFWQKILAKKAEVLESQDNYEAALSVYQQLISRGYTP 480
           VELLQDVPFDAQIQDTSPPRTYKEFWQKILAKKAEVLESQDNYEAALSVYQQLISRGYTP
Sbjct: 421 VELLQDVPFDAQIQDTSPPRTYKEFWQKILAKKAEVLESQDNYEAALSVYQQLISRGYTP 480

Query: 481 KLILNGKARCQKACNSQKGNVSSNPTATTQGDRKNPRKQTATAKGKTEEVKRLKAQNHAI 540
           KLILNGKARCQKACNSQKGNVSSNPTATTQGDRKNPRKQTATAKGKTEEVKRLKAQNHAI
Sbjct: 481 KLILNGKARCQKACNSQKGNVSSNPTATTQGDRKNPRKQTATAKGKTEEVKRLKAQNHAI 540

Query: 541 EKQENERFGLHDKVESRIRTWTAGKSTDXXXXXXXXXXXXXXXNSDQMIASDLVMPKRVK 600
           EKQENERFGLHDKVESRIRTWTAGKSTD               NSDQMIASDLVMPKRVK
Sbjct: 541 EKQENERFGLHDKVESRIRTWTAGKSTDLRHLLLGLPALLPWLNSDQMIASDLVMPKRVK 600

Query: 601 LSYLKAVSKTHPDKLPQTLELEEKMVAEHVFITLTKAWGVFKEENSLS 648
           LSYLKAVSKTHPDKLPQTLELEEKMVAEHVFITLTKAWGVFKEENSLS
Sbjct: 601 LSYLKAVSKTHPDKLPQTLELEEKMVAEHVFITLTKAWGVFKEENSLS 648

>SAKL0G08822g Chr7 (755393..757141) [1749 bp, 582 aa] {ON} similar
           to gnl|GLV|KLLA0B10197g Kluyveromyces lactis
           KLLA0B10197g and some similarites with YDR320C
           uniprot|Q06677 Saccharomyces cerevisiae YDR320C SWA2
           auxilin- like protein
          Length = 582

 Score =  300 bits (769), Expect = 4e-93,   Method: Compositional matrix adjust.
 Identities = 209/666 (31%), Positives = 323/666 (48%), Gaps = 107/666 (16%)

Query: 3   DPFANLLTKFKGKEKPADAQTSKNRSLNDLLAQHSVSSLSEPPAT--LYTPRDTRPAAGL 60
           DPFA+LL+ FKG EK   + TS+  SL D   +H   S+S P  +  L T  D   AA  
Sbjct: 4   DPFADLLSSFKG-EKQKSSTTSETVSLFD---KHDGPSISSPAPSKPLQTINDDLDAAF- 58

Query: 61  VDLGRESPNLPGETSGIYQSGRGNPSTEGYKSQSLIDLEDAQPHPAASVSSFEDKTTTIA 120
                           ++ S    P+ +G                           + + 
Sbjct: 59  ---------------DVFNSATNTPAKQG---------------------------SPVV 76

Query: 121 DEEQDFELAKLMSLGLDIGAANDYYHRGGRYEQLRMRRAESDGTRMHRGSNLGRNSDFCR 180
           DE +D E+A+LMSLG+ +  A  YY RG  Y+ +  RR E    +    +    + DF +
Sbjct: 77  DEVKDMEIARLMSLGVSLERALQYYERGILYDDVLRRRHEKHEAKRQAAA---ASRDFTK 133

Query: 181 SRDFGRGSDLGRSGDFERGSDLGRAESSETPQWSSLRSGHSNRLVSAASNLFNRGRDFIE 240
             D G  + LG  G  ++  D                      L S A+ LFN+G+ F+E
Sbjct: 134 LFDNGSSNILGSDGSDDKQQD----------------------LFSMATGLFNKGKSFME 171

Query: 241 DQXXXXXXXXXXXXXXXXXXNERFSNHTQ---ESDYSVNQTNDQAHLIHTQPTAAEV--- 294
           ++                   +  S+  +    + Y  +Q  D+      +P  A V   
Sbjct: 172 ERLKQRQQHQHQQDPAFRSFADHISSRLESPTRAKYERSQYTDKQVGSERRPEPAPVDEV 231

Query: 295 --------DLLEGFADTEVVQHQSTLEVPRMQAAGVKSEESLIDFS---SEGPSKSAAQL 343
                   DLL GF +  V   Q                E+L+DF    S    +S++  
Sbjct: 232 EEPSVIEGDLLGGFDELSVSSPQ---------------HETLLDFEQAVSPPQLRSSSAR 276

Query: 344 NYVSITPLELSGYYDFNKTAAESYKKGDYHAAFQDYLKSLNTLPLAHPLRIIALSNIITT 403
             +SI+ +ELSG+ +F     E +  G+Y +A  +Y KSLNTLP  HPLRII+LSNIITT
Sbjct: 277 PPISISAMELSGFGEFKSKGGELFAHGNYSSALLEYEKSLNTLPSGHPLRIISLSNIITT 336

Query: 404 QLKIGEHTESMKNINSAVELLQDVPFDAQIQDTSPPRTYKEFWQKILAKKAEVLESQDNY 463
           QLK+GE + +++NI +A+ L+ +      I  ++PP++Y+EFW KI  +KAE LE  +NY
Sbjct: 337 QLKLGESSSALQNIETALRLIGEDELQLTIPASNPPKSYREFWGKITMRKAEALEHVENY 396

Query: 464 EAALSVYQQLISRGYTPKLILNGKARCQKACNSQKGNVSSNPTATTQGDRKNPRKQTATA 523
            +AL  Y+ LI +G+    +++GK RCQK  +  K      P A  +         ++T 
Sbjct: 397 VSALECYKALIDKGFVTSKVMDGKRRCQKVLSPPKPQSGIPPVARKKPSPNVLDTSSSTL 456

Query: 524 KGKTEEVKRLKAQNHAIEKQENERFGLHDKVESRIRTWTAGKSTDXXXXXXXXXXXXXXX 583
             +++ +++++  N   E+ EN++F L DKV+ +I++W+ GK  D               
Sbjct: 457 PKRSDNLEKIQRINREAEQLENKKFLLRDKVDEQIKSWSQGKENDLRQLLADLPKVLTWS 516

Query: 584 NSDQMI-ASDLVMPKRVKLSYLKAVSKTHPDKLPQTLELEEKMVAEHVFITLTKAWGVFK 642
           N  + +  SDLVMPK+VK++YLKA++KTHPDKL  +L++E KM+AE +F  L+KAW  FK
Sbjct: 517 NDWKPVTTSDLVMPKKVKITYLKAIAKTHPDKLNDSLDVEHKMLAEDIFSILSKAWEAFK 576

Query: 643 EENSLS 648
           EEN++S
Sbjct: 577 EENNIS 582

>Ecym_8181 Chr8 (377372..379357) [1986 bp, 661 aa] {ON} similar to
           Ashbya gossypii AGR352C
          Length = 661

 Score =  300 bits (767), Expect = 6e-92,   Method: Compositional matrix adjust.
 Identities = 181/487 (37%), Positives = 264/487 (54%), Gaps = 51/487 (10%)

Query: 204 RAESSETPQWSSLRSGHSNRLVSAASNLFNRGRDFIEDQXXXXXXXXXXXXXX------X 257
           R++S     ++  +      L+S ASNLF +GRD +E++                     
Sbjct: 184 RSDSDNDRVFTFRKDNEEENLISFASNLFTKGRDLVENKINKTFENIGNRRSTPFEFKLF 243

Query: 258 XXXNERFSNHTQESDYSVNQTNDQAHLIHTQPTAAEVD-----------------LLEGF 300
              N    +HT + +  +++ +  +  I  +     VD                 L   F
Sbjct: 244 SSENTNSRSHTNKYEPELSRDSSNSDYISKKFDGLSVDEDKGNPCLNKEENYADLLSHAF 303

Query: 301 ADTEVVQHQSTLEVPRMQAAGVKSEESL--------IDFSSE--GPSKSAAQLNYVSITP 350
            DT   + +  +     Q+  V S+ESL        IDF +E   P  S    +YV I+ 
Sbjct: 304 LDTGDTEAKDRI---WGQSQNVHSQESLYSAEDGKLIDFDTEEAPPPASKVSSHYVPISQ 360

Query: 351 LELSGYYDFNKTAAESYKKGDYHAAFQDYLKSLNTLPLAHPLRIIALSNIITTQLKIGEH 410
           +E+SGY +FN    + ++ GDYH A Q Y+KSLNTLP+ HPLRI+A SNIITTQLKIGEH
Sbjct: 361 IEMSGYQEFNINGKQYFRNGDYHNAHQQYIKSLNTLPVGHPLRIVAYSNIITTQLKIGEH 420

Query: 411 TESMKNINSAVELLQDVPFDAQIQDTSPPRTYKEFWQKILAKKAEVLESQDNYEAALSVY 470
           TES+KNI  A +LL     D  IQ T+PP+TYKEFW KI++KKAEVLE  ++Y+ AL+VY
Sbjct: 421 TESLKNIEKACDLLDGSSLDGIIQGTNPPKTYKEFWNKIISKKAEVLEYLEHYDEALAVY 480

Query: 471 QQLISRGYTPKLILNGKARCQKACNSQKGNVSSNPT------ATTQGDRKNPRKQTATA- 523
           + LIS+G   K I+ GK RCQK        ++S P       A  Q D K P+   ++  
Sbjct: 481 RCLISKGVFDKKIIEGKTRCQK-----HSKITSEPATEDSALAPVQKD-KVPKSNNSSIP 534

Query: 524 --KGKTEEVKRLKAQNHAIEKQENERFGLHDKVESRIRTWTAGKSTDXXXXXXXXXXXXX 581
             + ++++ + L  +   +++ E ++F LHDKV S+I++W  GK TD             
Sbjct: 535 ERRIRSQKAEELIKKRQEMKELEKQKFRLHDKVHSKIQSWIDGKETDLRHLLSRLSLVLT 594

Query: 582 XXNSDQMIASDLVMPKRVKLSYLKAVSKTHPDKLPQTLELEEKMVAEHVFITLTKAWGVF 641
             N + + A+DLV+PK+VK+ Y+KA+SK HPDK+P TL+LE KM+AE +F  L  AW VF
Sbjct: 595 WTNWNHIGANDLVIPKKVKIIYMKAISKVHPDKVPSTLDLESKMLAEDIFSVLGNAWNVF 654

Query: 642 KEENSLS 648
           K  N ++
Sbjct: 655 KLNNDIN 661

 Score = 35.4 bits (80), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 22/34 (64%)

Query: 1  MSDPFANLLTKFKGKEKPADAQTSKNRSLNDLLA 34
          M DPFA LL+ FKG++K     + +N SLN +L 
Sbjct: 1  MGDPFATLLSNFKGEKKELVQSSPRNASLNAILC 34

>ZYRO0D10186g Chr4 complement(856401..858308) [1908 bp, 635 aa] {ON}
           similar to uniprot|Q06677 Saccharomyces cerevisiae
           YDR320C SWA2 auxilin-like protein
          Length = 635

 Score =  274 bits (701), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 214/682 (31%), Positives = 334/682 (48%), Gaps = 81/682 (11%)

Query: 1   MSDPFANLLTKFKGKE--------KPADAQTSKNRSLNDLLAQHSVSSLSEPPATLYTPR 52
           M DPFA+LLT+FKG E        KP  AQ S+N +      + + SSLS  P  + T  
Sbjct: 1   MGDPFADLLTQFKGGESKPQNQGNKPLAAQYSENNT------RETSSSLSLQPEPVTTAS 54

Query: 53  DTRPAAGLVDLGRESPNLPGETSGIYQSGRGNPSTEGYKSQSLIDLEDAQPHPAASVSSF 112
           + +       L     N     S +  + R N +T   +  S IDL   Q  P     S 
Sbjct: 55  NYKIDDDFEQLFGIKSNTNTNNSDV--NNRPN-TTNQNEFDSAIDL--LQITPEKQRQSA 109

Query: 113 EDKTTTIADEEQDFELAKLMSLGLDIGAANDYYHRGGRYEQLRMRRAESDGTRMHRGSNL 172
           E +   + DE +D E+AKLMSLG  I  AN  Y +G  Y+ +   R +    ++HR    
Sbjct: 110 EREPEQLVDEVRDMEVAKLMSLGYSIDGANTSYEQGMLYDDVIEERKKK---KLHR---- 162

Query: 173 GRNSDFCRSRDFGRGSDLGRSGDFERGSDLGRAESSETPQWSSLRSGHSN-RLVSAASNL 231
                    R+  R   L    ++ER          ETP+ ++  SG +N  L S AS +
Sbjct: 163 ---------RELQR---LMAETNWER----------ETPETNNDESGKNNVDLFSIASGI 200

Query: 232 FNRGRDFIEDQXXXXXXXXXXXXXXXXXXNERFSNHTQ-----ESDYSVN-------QTN 279
           FN+G+  ++                     +R +   +       D + N       Q  
Sbjct: 201 FNKGKKIVDHLSLFPDEENDLLPYRSERLKQRQTFEPELPRRPRKDPTPNPRTQGTPQVE 260

Query: 280 DQAHLIHTQPT--AAEVDLLEGFADTEVVQHQSTLEVPRMQAAGVKSEESLIDFSSEGPS 337
            ++ L + QPT  A E DLL  F D   ++ Q        Q+    S E+L+DF +   +
Sbjct: 261 YESTLQYQQPTIQAQEGDLLGDFQDKLSLRSQGNKSTSASQSP---SNETLLDFDAPSAN 317

Query: 338 KSAAQLNY---------VSITPLELSGYYDFNKTAAESYKKGDYHAAFQDYLKSLNTLPL 388
            ++A ++          V IT +ELSGY +F   A E +K GDY AA Q+Y KS NTLP 
Sbjct: 318 STSASVSVSRQGSVVPTVPITEIELSGYNEFKDRAGELFKTGDYVAALQEYEKSANTLPH 377

Query: 389 AHPLRIIALSNIITTQLKIGEHTESMKNINSAVELLQD--VPFDAQIQDTSPPRTYKEFW 446
            HPLRII+ SN++ +QLK G++ ES+   + A++L  +    +   IQ++ P +TY++ W
Sbjct: 378 GHPLRIISYSNLMASQLKTGQYKESLHVASMALKLFPEDTTQWTQLIQNSEPSKTYRDMW 437

Query: 447 QKILAKKAEVLESQDNYEAALSVYQQLISRGYTPKLILNGKARCQKACNSQKGNVSSNPT 506
            KI+ ++AE  E  +N++ A + YQ LI + +    I++GK RCQK  N +K  V     
Sbjct: 438 PKIVQRRAEAFEHSENFQEAFNAYQSLIEKNFCTNKIMDGKRRCQKVLNPEKPKV----V 493

Query: 507 ATTQGDRKNPRKQTATAKGKTEEVKRLKAQNHAIEKQENERFGLHDKVESRIRTWTAGKS 566
                  K+P      +  K + ++++K  N    +++ +R  L+D+V  +I+ W +GK+
Sbjct: 494 QKKPASSKSPSPSPNHSDKKYKNLQKVKEDNRKQAEEDTQRHALYDRVYDQIKLWESGKA 553

Query: 567 TDXXXXXXXXXXXXXXXNSDQMIASDLVMPKRVKLSYLKAVSKTHPDKLPQTLELEEKMV 626
            D               +   +  +DLVMPK+VK++YL+AV+KTHPDK+  +L L++KM+
Sbjct: 554 NDIRHLLSNLQTVLTWVDWKPVSPADLVMPKKVKITYLRAVAKTHPDKISDSLPLDKKMI 613

Query: 627 AEHVFITLTKAWGVFKEENSLS 648
           AE VF +L+ AW  FK EN ++
Sbjct: 614 AESVFSSLSSAWEKFKSENDIN 635

>Kpol_339.13 s339 complement(21257..23317) [2061 bp, 686 aa] {ON}
           complement(21257..23317) [2061 nt, 687 aa]
          Length = 686

 Score =  273 bits (699), Expect = 7e-82,   Method: Compositional matrix adjust.
 Identities = 223/710 (31%), Positives = 347/710 (48%), Gaps = 86/710 (12%)

Query: 1   MSDPFANLLTKFKGKEKPADAQTSK-----NRSLNDLL-AQHSVSSLSEPPATLYTPRDT 54
           M+DPFA+LL+ FK      + Q  K      + + +LL AQ  V+++     TL     +
Sbjct: 1   MADPFADLLSSFKSGSTTKNEQADKKVNIATKPMAELLTAQKPVNNV-----TLIENEVS 55

Query: 55  RPAAGLVDLGRESPNLPGETSGIYQSGRGN---PSTEGYKSQSLIDLEDAQ------PHP 105
             + G+ D   +   L  E+  I  S   N   P      S+ + DL+ A       P  
Sbjct: 56  ISSNGIHDDIADLFGLSSESKPINASKPINASKPINTSKPSEGIDDLDAAMNFFNDSPQE 115

Query: 106 A---ASVSSFEDKTTTIADEEQDFELAKLMSLGLDIGAANDYYHRGGRYEQLRMRRAESD 162
           +   ++V++  +    + DE +D E+AKLMSLGLDI  A  +Y  G  YE L  +   S+
Sbjct: 116 SLRGSTVTTSPEVQDIVVDEVKDMEIAKLMSLGLDIDEATTHYDNGILYETLVSKIRTSN 175

Query: 163 GTRMHRGSNLGRN---SDFCRSRDFGRGSDLGRSGDFERGSDLGRAESSETPQWSSLRSG 219
                + ++ GRN   ++  R      GS    +G F++G  L         QW+     
Sbjct: 176 SRITAQRNDSGRNDIRAEPMRKPRTSNGS-FTFTGLFDKGKQL-------VDQWTVYHEE 227

Query: 220 ------HSNRLVSAASNLFNRGRDFIEDQXXXXXXXXXXXXXXXXXXNERFSNHTQESDY 273
                 ++N  V  ++N +    D+                      ++  S  +Q  +Y
Sbjct: 228 DDRLFRNTNFKVDPSTNTYQPSGDY----DTSDENPFNQQSRYDIASSKTTSTDSQTRNY 283

Query: 274 SVNQT--NDQAH-------LIHTQPTAAEVDLLEG------FADTEVVQHQSTLEVPRMQ 318
              +T  N++AH        I+ QP  A +DLL         +   V  + + LE  + +
Sbjct: 284 HDKKTSINNKAHERIAKETPINNQP--ANLDLLNDDFISIKLSSENVSTNLTNLEQAKSK 341

Query: 319 AA-------------GVKSEESLIDFSSEGPS--KSAAQLNYVSITPLELSGYYDFNKTA 363
            A               K+  +L+DF S   +    AA L  V I+ +EL GY +F +  
Sbjct: 342 QATSKQAISKPIVNVAPKANNTLLDFDSPTTAVHSPAASLPKVPISEIELLGYKEFKERG 401

Query: 364 AESYKKGDYHAAFQDYLKSLNTLPLAHPLRIIALSNIITTQLKIGEHTESMKNINSAVEL 423
            E++K GDY  A + Y KSLNTLP+ HPLRIIA SNI+ +  K GE+ +S++   SA+E 
Sbjct: 402 TENFKTGDYVTALEAYQKSLNTLPIKHPLRIIASSNILASMSKTGEYRKSIEISTSALEQ 461

Query: 424 LQDVPFDAQ-----IQDTSPPRTYKEFWQKILAKKAEVLESQDNYEAALSVYQQLISRGY 478
               P D +     IQD+ P RTYK+ W KI+ K+AE  E  ++YE AL  YQQ+I + +
Sbjct: 462 F---PGDQKQWNEFIQDSEPQRTYKDIWPKIVLKRAEAFEHIESYENALETYQQMIEKNF 518

Query: 479 TPKLILNGKARCQKACNSQKGNVSSNPTATTQGDRKNPRKQTATAKGKTEEVKRLKAQNH 538
               +++GK RCQ   N  K    SN +A  +     P+K++   K   E V++LK +N 
Sbjct: 519 FNDKVMSGKRRCQHVINPVKP-TKSNSSALPRQTNTKPKKESNQNKA-YENVEKLKQKNK 576

Query: 539 AIEKQENERFGLHDKVESRIRTWTAGKSTDXXXXXXXXXXXXXXXNSDQMIASDLVMPKR 598
              + E++R  L+D VE++I  W A K  D               N + +  SDLVMPK+
Sbjct: 577 LEAEIESQRLALYDSVEAQINKWKANKDDDIRHLLSNLQLILTWGNWNPVPPSDLVMPKK 636

Query: 599 VKLSYLKAVSKTHPDKLPQTLELEEKMVAEHVFITLTKAWGVFKEENSLS 648
           VK++Y+KAV++THPDK+P  LELE+KM+AE++F  L+KAW  FK++N+++
Sbjct: 637 VKITYMKAVARTHPDKIPSDLELEKKMIAENIFSVLSKAWEKFKKDNNMN 686

>TDEL0E02750 Chr5 (529920..531614) [1695 bp, 564 aa] {ON} Anc_5.352
           YDR320C
          Length = 564

 Score =  270 bits (690), Expect = 8e-82,   Method: Compositional matrix adjust.
 Identities = 185/556 (33%), Positives = 264/556 (47%), Gaps = 79/556 (14%)

Query: 104 HPAASVSSFEDKTTTIADEEQDFELAKLMSLGLDIGAANDYYHRGGRYEQL-RMRRAESD 162
            P     S E+    + DE +D E+AKLMSL LDI  A DYY RG  YEQL R RR +  
Sbjct: 77  RPQKVEKSLEESPEMVVDEVKDMEVAKLMSLNLDIDQATDYYERGVLYEQLSRQRREQEL 136

Query: 163 GTRMHRGSNLGRNSDFCRSRDFGRGSDLGRSGDFERGSDLGRAESSETPQWSSLRSGHSN 222
             R  +     +         F  GS                                  
Sbjct: 137 IRRREQMLRQQQQQQQTPEEKFDSGS---------------------------------- 162

Query: 223 RLVSAASNLFNRGRDFIEDQXXXXXXXXXXXXXXXXXXNERFSNHTQESDYSVNQTNDQA 282
              S AS +  +GR F++                      +FS   QE D  + +   + 
Sbjct: 163 -FFSLASGILEKGRQFVD----------------------QFSGFPQEQD-RLTRVRVEQ 198

Query: 283 HLIHTQPTAAE---VDLLEGFADTEVVQHQSTLEVPRMQAAGVKSEESLIDFSSEGPSKS 339
            L   +P + E   V++ EG    E  Q +  LE P+ ++     + +L+DF +  P + 
Sbjct: 199 DLPVERPKSVEPPTVEVEEGNLLGEF-QEKINLEEPK-RSPTPPPQATLLDFDNGTPPER 256

Query: 340 AAQLNYVSITPLELSGYYDFNKTAAESYKKGDYHAAFQDYLKSLNTLPLAHPLRIIALSN 399
              +  V I+ LE+SGY ++     E +K GDY +A Q+Y KSLN+LP  H LRI+A SN
Sbjct: 257 IKTITPVPISHLEISGYKEYKDRGTEFFKAGDYVSASQEYEKSLNSLPQNHALRIVAYSN 316

Query: 400 IITTQLKIGEHTESMKNINSAVELLQDVP--FDAQIQDTSPPRTYKEFWQKILAKKAEVL 457
           +     K+GE+   + +I SA+E+    P  +D  IQD+ P RT+KE W KI+ ++AE  
Sbjct: 317 LTAALFKVGEYKRCLSDIESALEMFPKDPNLWDEPIQDSQPIRTFKEMWPKIVTRRAEAF 376

Query: 458 ESQDNYEAALSVYQQLISRGYTPKLILNGKARCQKACN-----SQKGNVSSNPTATTQGD 512
           E  +NYE AL  YQ LI +      I+ GK RCQK  N     +   N S  P      D
Sbjct: 377 EHIENYERALQDYQSLIEKNNFNDKIMGGKRRCQKVLNPTEPKATSPNRSPTPVPKVSED 436

Query: 513 RKNPRKQTATAKGKTEEVKRLKAQNHAIEKQENERFGLHDKVESRIRTWTAGKSTDXXXX 572
            K P+            V+R+K +N   E QE E+  L+D V  +I +W AGK  D    
Sbjct: 437 TKQPKTYA--------NVERVKQENQRNELQEAEKAALYDTVFQQIESWKAGKGDDIRHL 488

Query: 573 XXXXXXXXXXXNSDQMIASDLVMPKRVKLSYLKAVSKTHPDKLPQTLELEEKMVAEHVFI 632
                      +   +  SDLVMPK+VK++Y+KAV+KTHPDK+P +LELE++M+AE VF 
Sbjct: 489 LANLSTVLTWCDWKPVSTSDLVMPKKVKITYMKAVAKTHPDKIPSSLELEKRMIAEDVFS 548

Query: 633 TLTKAWGVFKEENSLS 648
           +L+ AW  FK  N ++
Sbjct: 549 SLSVAWEKFKLANDIN 564

>KLLA0B10197g Chr2 complement(891842..893707) [1866 bp, 621 aa] {ON}
           similar to uniprot|Q06677 Saccharomyces cerevisiae
           YDR320C SWA2 auxilin-like protein
          Length = 621

 Score =  271 bits (694), Expect = 9e-82,   Method: Compositional matrix adjust.
 Identities = 215/690 (31%), Positives = 329/690 (47%), Gaps = 112/690 (16%)

Query: 1   MSDPFANLLTKFKGKEKPA--DAQTSKNRSLNDLLAQHSVSSLSEP-----PATL--YTP 51
           MSDPFA+LL+ FKG       ++  +KN SLNDLL+ HS  +L+ P     P+ +   TP
Sbjct: 1   MSDPFADLLSSFKGVNSSTGNNSSANKNASLNDLLSSHS--ALTSPLSRKSPSNVPSKTP 58

Query: 52  R---------------DTRPAAGLVDLGRESPNLPGETSGIYQSGRGNPSTEGYKSQSLI 96
                           D   A   V   RESP+    ++   +    + + E + S   +
Sbjct: 59  ESISITSMTASQDFFDDLLAAPSQVTPLRESPSQVAPSTAT-EKDDFDLAFESFNSTPHV 117

Query: 97  DLEDAQPHPAASVSSFEDKTTTIADEEQDFELAKLMSLGLDIGAANDYYHRGGRYEQLRM 156
           DL   QP P         +   + DE +D E+A+LMSLGL    A  YY +G  YE+L  
Sbjct: 118 DLVQPQPDPIP-------EPQPLVDEVKDMEIARLMSLGLSFDKAVHYYDKGIMYEEL-- 168

Query: 157 RRAESDGTRMHRGSNLGRNSDFCRSRDFGRGSDLGRSGDFERGSDLGRAESSETPQWSSL 216
              ES   R    SN+          DFG+               L + ES ++      
Sbjct: 169 --IESQKKRKQSRSNVNN--------DFGQ-------------QQLRKQESRDS------ 199

Query: 217 RSGHSNRLVSAASNLFNRGRDFIEDQXXXXXXXXXXXXXXXXXXNERFSNHTQESDYS-- 274
               S   +S ASNLFN G++FIED+                    +++N +Q S +S  
Sbjct: 200 ----SPAFISVASNLFNMGKEFIEDKLKPTLQ-------------PQYANSSQRSQFSDD 242

Query: 275 ------VNQTNDQAHLIHTQP------TAAEVDLLEGFADTEVVQHQSTLEVPRMQAAGV 322
                   + + + H +  Q        + E+  +   +          + V     A V
Sbjct: 243 IPLRRDYTRPHSRPHSMQFQSERTSPQPSPELPSIHQLSINNASSAPPPVSVENQDTASV 302

Query: 323 KSEESLIDFSSEGPSKSAAQLNYVSITPLELSGYYDFNKTAAESYKKGDYHAAFQDYLKS 382
            ++E+L+DF +  P  SA+  + +S    EL+ + +F     + +  GDYH A  ++ KS
Sbjct: 303 INQETLVDFGA-APQTSASPQHRIS--DFELTSFNEFKNNGVKYFSSGDYHNALLEFEKS 359

Query: 383 LNTLPLAHPLRIIALSNIITTQLKIGEHTESMKNINSAVELLQDVPFDAQIQDTS-PPRT 441
            NTLP  HPLRII+LSNI++ QLK+GE++++++++  A++L    P  + I + S P RT
Sbjct: 360 FNTLPFKHPLRIISLSNIVSCQLKLGENSKALESVKLALDLSDLAPNASDIIEHSVPERT 419

Query: 442 YKEFWQKILAKKAEVLESQDNYEAALSVYQQLISRGYTPKLILNGKARCQKACNSQKGNV 501
           +K+   KI  K AE+ E  +NYE ALS+Y  LIS G T + +++GK RC+K  N +K   
Sbjct: 420 FKQMINKIQLKHAEIQEHLENYEKALSLYANLISNGITEQKVMDGKRRCEKIVNPEKFKP 479

Query: 502 S----SNPTATTQGDRKNPRKQTATAKGKTEEVKRLKAQNHAIEKQENERFGLHDKVESR 557
           +    S+PT         P +   +    T  V R+K +N   E++E ER  L DKV+ +
Sbjct: 480 AKEKISSPTI--------PVRSKTSISADTVAVNRVKEENKKQEEEEEERLRLRDKVDEK 531

Query: 558 IRTWTAGKSTDXXXXXXXXXXXXXXXNSDQMIASDLVMPKRVKLSYLKAVSKTHPDKLPQ 617
           I  WT     D               +  ++   DLVM K+VK+ YLKA++KTHPDK+P 
Sbjct: 532 ISEWTKNNENDLRYLLANLEPLLWWASWKEVSPQDLVMTKKVKICYLKAIAKTHPDKIPA 591

Query: 618 TLELEEKMVAEHVFITLTKAWGVFKEENSL 647
              LE  M+AE+V+  L KAW  FK +N++
Sbjct: 592 DASLETIMIAENVYTILNKAWEYFKSQNNI 621

>NCAS0F02870 Chr6 complement(573068..575170) [2103 bp, 700 aa] {ON}
           Anc_5.352 YDR320C
          Length = 700

 Score =  269 bits (688), Expect = 4e-80,   Method: Compositional matrix adjust.
 Identities = 141/313 (45%), Positives = 204/313 (65%), Gaps = 5/313 (1%)

Query: 341 AQLNYVSITPLELSGYYDFNKTAAESYKKGDYHAAFQDYLKSLNTLPLAHPLRIIALSNI 400
           + L  + I+ +ELSGY +F     + +K GDY ++FQ+Y KSLNTLP+ HPLRIIA SNI
Sbjct: 388 SSLPVIPISHIELSGYAEFRNRGTQYFKNGDYVSSFQEYEKSLNTLPVNHPLRIIAYSNI 447

Query: 401 ITTQLKIGEHTESMKNINSAVELLQD--VPFDAQIQDTSPPRTYKEFWQKILAKKAEVLE 458
           I ++LKIGE+++S+KN +SA+E+  D    + A IQD+ P RTYK+ W K+  ++AE LE
Sbjct: 448 IASELKIGEYSKSLKNSSSALEMFPDDTAQWTAVIQDSDPQRTYKDIWPKVKLRQAEALE 507

Query: 459 SQDNYEAALSVYQQLISRGYTPKLILNGKARCQKACNSQKGNVSSNPTATT--QGDRKNP 516
             ++++AALS YQ+LI +G+    I++GK RCQK  N     V   P  +T  Q     P
Sbjct: 508 HIESFKAALSSYQELIEKGFANDKIMDGKRRCQKVLNPTPPPVVKTPRISTPKQSPSPVP 567

Query: 517 RKQTATAKGKT-EEVKRLKAQNHAIEKQENERFGLHDKVESRIRTWTAGKSTDXXXXXXX 575
           RK T+ +K    E V+RLK +N   ++ E ++  L+DKV +++ TW   K TD       
Sbjct: 568 RKATSNSKDAVYESVERLKKENATSQEVEKQKLALYDKVFAKVETWKNRKDTDIRHLLAN 627

Query: 576 XXXXXXXXNSDQMIASDLVMPKRVKLSYLKAVSKTHPDKLPQTLELEEKMVAEHVFITLT 635
                   +   + ASDLVMPK+VK++Y+KAV+KTHPDK+P++LELE KM+AE+VF  L+
Sbjct: 628 LSIVLTWCDWKPVAASDLVMPKKVKITYMKAVAKTHPDKVPESLELENKMIAENVFSVLS 687

Query: 636 KAWGVFKEENSLS 648
            AW  FK EN++S
Sbjct: 688 VAWDKFKIENNMS 700

 Score = 58.9 bits (141), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 54/172 (31%), Positives = 79/172 (45%), Gaps = 30/172 (17%)

Query: 1   MSDPFANLLTKFK-----GKEKPADAQ---TSKNRSLNDLLAQHSVSSLSEPPATLYTPR 52
           MSDPFA+LLT FK      K +P  +    T K  S +  ++Q S++ L   P+   +  
Sbjct: 1   MSDPFADLLTSFKNGKDNAKSEPTKSNISATQKPASASPNISQLSITPLVPSPSPNVSIH 60

Query: 53  DTRPAAGLVDLGRESPN--LPGET--------SGIYQSGRGNPSTEGYKSQSLIDLEDAQ 102
           D       V LG+   N  +P +T           +   +  PS      QS+      +
Sbjct: 61  DDFDDLFGVSLGQNGTNTIVPKQTVKTETDDIDAAFNVFQATPS------QSI------K 108

Query: 103 PHPAASVSSFEDKTTTIADEEQDFELAKLMSLGLDIGAANDYYHRGGRYEQL 154
           P  +A      D+   + DE +D E+A+LMSLGL I  AND+Y +G  YE L
Sbjct: 109 PEASAPNDIDRDEEEYVVDEVKDMEVARLMSLGLSIDEANDHYDKGILYENL 160

>KNAG0C05500 Chr3 (1069670..1071427) [1758 bp, 585 aa] {ON}
           Anc_5.352 YDR320C
          Length = 585

 Score =  265 bits (677), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 207/677 (30%), Positives = 306/677 (45%), Gaps = 121/677 (17%)

Query: 1   MSDPFANLLTKFKGKEKPADAQTSKNRSLNDLLAQHSVSSLSEPPATLYTPRDTRPAAGL 60
           M+DPFA+LLT FK   K   A+                   SE P  +       PA   
Sbjct: 1   MADPFASLLTSFKESSKKPAAK-------------------SESPEPVTVKGGGEPATAS 41

Query: 61  VDLGRESPNLP-GETSGIYQSGRGNPSTEGYKSQSLIDLEDAQPHPAASVSSFE------ 113
                  P +P G   G +Q     P+    K   + DL +++P  AA V   +      
Sbjct: 42  THAVFMEPLIPSGGGQGSFQQ---KPAGSDDKFDDVFDLFNSEP--AAEVKEPDRVPSDE 96

Query: 114 --DKTTTIADEEQDFELAKLMSLGLDIGAANDYYHRGGRYEQLRMRRAESDGTRMHRGSN 171
              +   + DE +D E+AK+MSLG  I  A ++Y  G  Y++L  RR      R H    
Sbjct: 97  SVHENVAVVDEVRDMEVAKIMSLGFGIDKAVEFYDSGVLYDELVERR-----DRRHIRHT 151

Query: 172 LGRNSDFCRSRDFGRGSDLGRSGDFERGSDLGRAESSETPQWSSLRSGHSNRLVSAASNL 231
             R+S                             E +E P+ +       N   SAA  L
Sbjct: 152 HTRHS---------------------------VREVTEVPKHTG------NSFFSAAVGL 178

Query: 232 FNRGRDFIEDQXXXXXXXXXXXXXXXXXXNERFSNHTQESDYSVNQTNDQAHLIHTQPTA 291
            N+G+DF++                     +R + + QE         D AH     P  
Sbjct: 179 LNKGKDFVD-----------HLTAYPDEEGDRLARYRQEH-------ADAAHFGDFTPGE 220

Query: 292 AEVDLLEGFADTEVV---QHQSTLEVPRMQAAGVKSEESLIDFSSEGPSKSAA------- 341
            E DLL    +++V    +H   L            +E+L+DF  +  SKS +       
Sbjct: 221 REQDLLIDDFESKVSITDKHNPPL--------AQTPDETLLDFGEDDSSKSGSRTHVNNS 272

Query: 342 ---QLNYVSITPLELSGYYDFNKTAAESYKKGDYHAAFQDYLKSLNTLPLAHPLRIIALS 398
              +L  V I+ +ELSGY +F     E +KKGDY AA  +Y KSLNTLP  HPLRIIA+S
Sbjct: 273 PSIELPIVPISTMELSGYNEFRAKGTELFKKGDYSAAVLEYEKSLNTLPEKHPLRIIAMS 332

Query: 399 NIITTQLKIGEHTESMKNINSAVELLQD--VPFDAQIQDTSPPRTYKEFWQKILAKKAEV 456
           N++   LKIGE+T+ +K    A+EL+ +    + + IQ + P RTY++ W K++ + AE 
Sbjct: 333 NMMLPYLKIGEYTKCLKLAPLALELIPEDRSTWRSVIQQSEPKRTYRDIWSKLVMRLAEA 392

Query: 457 LESQDNYEAALSVYQQLISRGYTPKLILNGKARCQKACN-----SQKGNVSSNPTATTQG 511
            E  +NY  A   YQ L++ G T + +++GK RCQK  N      +KG  +  P   T  
Sbjct: 393 QEHAENYTGAFDNYQLLVANGITNEKVMDGKRRCQKVLNPPSKVERKGTPTPTPQVVTPA 452

Query: 512 DRKNPRKQTATAKGKTEEVKRLKAQNHAIEKQENERFGLHDKVESRIRTWTAGKSTDXXX 571
              +P    AT+K   E  +R+K  N   E++E  +   +D VE+++  W   K  D   
Sbjct: 453 RTPDP----ATSKTVYENAERVKRANAKSEQEEAAKMEFYDVVETKVNNWKGDKEGDIRY 508

Query: 572 XXXXXXXXXXXXNSDQMIASDLVMPKRVKLSYLKAVSKTHPDKLPQTLELEEKMVAEHVF 631
                         + +  +DLVMPKRVK++YLKA++K HPDK+P  L LE +M+A+ VF
Sbjct: 509 LLSHLTEIVTWVEWNSVSQADLVMPKRVKITYLKAIAKIHPDKIPADLPLEYRMIADTVF 568

Query: 632 ITLTKAWGVFKEENSLS 648
             L  AW  FK +N+++
Sbjct: 569 SVLNNAWEKFKLDNNIN 585

>Kwal_34.15977 s34 (141005..142798) [1794 bp, 597 aa] {ON} YDR320C
           (SWA2) - auxilin-like protein [contig 272] FULL
          Length = 597

 Score =  264 bits (674), Expect = 4e-79,   Method: Compositional matrix adjust.
 Identities = 181/560 (32%), Positives = 273/560 (48%), Gaps = 86/560 (15%)

Query: 119 IADEEQDFELAKLMSLGLDIGAANDYYHRGGRYEQLRMRRAESDGTRMHRGSNLGRNSDF 178
           + DE +D E+A+LMSLGL    A  YY RG  Y+ L  R+      R  R          
Sbjct: 94  LVDEIKDMEIARLMSLGLSCTKATSYYERGLLYDDLLERK------RQQR---------- 137

Query: 179 CRSRDFGRGSDLGRSGDFERGSDLGRAESSETPQWSSLRSGHSNRLVSAASNLFNRGRDF 238
            R     + SD GR   F +GS+                      L+S AS+  NRGR F
Sbjct: 138 TREEAPQKTSDEGR---FTQGSEPD--------------------LLSVASSWLNRGRTF 174

Query: 239 IEDQXXXXXXXXXXXXXXXXXXNERFSNHTQE-SDYSVNQTNDQAH----LIHTQPTAAE 293
           ++ +                       N TQ  SDY  ++    AH    L  T      
Sbjct: 175 LDSKLKQIQN----------------DNGTQSYSDYISSRMESSAHTGSRLRPTSDIPTN 218

Query: 294 VDLLEGFADTEVVQHQSTLEVPRMQAAGVKSE--ESLI----DFSSEGPSKSAAQLNY-- 345
           +D    F D  +    +   VP  Q + + SE    L+    D    GP +++A L    
Sbjct: 219 IDRSISFQDLSLADQPNESSVP-AQVSPMNSEILPPLVNIGDDVPVSGPEEASADLLVDF 277

Query: 346 ----------------VSITPLELSGYYDFNKTAAESYKKGDYHAAFQDYLKSLNTLPLA 389
                           ++++ LE   Y +F +    S+  GDYH AFQ++ KS+N+LP +
Sbjct: 278 DAPSGHDAVSSPVAASIAMSALEFHSYQEFKEKGTLSFSAGDYHTAFQNFEKSVNSLPHS 337

Query: 390 HPLRIIALSNIITTQLKIGEHTESMKNINSAVELLQDVPFDAQIQDTSPPRTYKEFWQKI 449
           HPLR I+LSN+I  +LK+GE+ +++++ + A++L+     D  I  + PP+T+KE W KI
Sbjct: 338 HPLRAISLSNMIICRLKLGEYRKAIEDSSVALKLISCAKLDDVIPASDPPKTFKEIWCKI 397

Query: 450 LAKKAEVLESQDNYEAALSVYQQLISRGYTPKLILNGKARCQKACNSQK-GNVSSNPTAT 508
           +  KAE  E  ++Y+ AL  YQ LI RG   + ++ G+ RCQK    +K    S  P +T
Sbjct: 398 VGNKAEAYEHIEDYDKALKEYQLLIKRGAASRKVMEGRRRCQKIVEPEKFVQRSKTPLST 457

Query: 509 TQGDRKNPRKQTATAKGKTEEVKRLKAQNHAIEKQENERFGLHDKVESRIRTWTAGKSTD 568
           +    +      AT++  +E+++R++  N   ++ E ++F LHDKV+ R+R W      D
Sbjct: 458 SPSVSRKDVAVAATSQVPSEKLERVQNINKKEKELERQKFLLHDKVQDRVREWCQNSEDD 517

Query: 569 XXXXXXXXXXXXXXXNSDQMIASDLVMPKRVKLSYLKAVSKTHPDKLPQTLELEEKMVAE 628
                          +   +  +DLVMPKRVK+ YLKAV+KTHPDK+  +  LE KMVAE
Sbjct: 518 LRELLSRFHLIVDWVDWKNVSTADLVMPKRVKIVYLKAVTKTHPDKIQDSWPLERKMVAE 577

Query: 629 HVFITLTKAWGVFKEENSLS 648
           +VF+ L+KAW +FKE+N LS
Sbjct: 578 NVFVILSKAWELFKEQNKLS 597

>YDR320C Chr4 complement(1106095..1108101) [2007 bp, 668 aa] {ON}
           SWA2Auxilin-like protein involved in vesicular
           transport; clathrin-binding protein required for
           uncoating of clathrin-coated vesicles
          Length = 668

 Score =  255 bits (651), Expect = 4e-75,   Method: Compositional matrix adjust.
 Identities = 212/730 (29%), Positives = 324/730 (44%), Gaps = 144/730 (19%)

Query: 1   MSDPFANLLTKFKGKE-----KPADAQTSKNRSLN----------DLLAQHSVSSLSEPP 45
           MSDPFA+LLT  K K+     K    Q+S + S+           D     S+ S+S PP
Sbjct: 1   MSDPFAHLLTSLKNKDSASASKETTPQSSNSPSITGSAVADVARTDKSPNDSLHSISAPP 60

Query: 46  ATLYTPRDTRPAAGLVDLGRES---------PNLPGETSGIYQS--GRGNPSTE------ 88
             + +P+    A  LV     +         P+    T   +    G G  +T       
Sbjct: 61  L-IPSPKVDFSAPPLVPTNSTTKSNTANNTPPSALANTDDDFNQLFGMGTVTTTDTIQKP 119

Query: 89  -----GYKSQSLIDLEDAQPHPAASVSSFEDKTTTIADEEQDFELAKLMSLGLDIGAAND 143
                G K   L + +DA                 + DE +D E+A+LMSLGL I  A +
Sbjct: 120 DEDYYGSKEDHLYNGDDA-----------------LVDEVKDMEIARLMSLGLSIEEATE 162

Query: 144 YYHRGGRYEQ----LRMRRAESDGTRMHRGSNLGRNSDFCRSRDFGRGSDLGRSGDFERG 199
           +Y     YE+    L+ ++ E             RN    R ++   G  + +SG     
Sbjct: 163 FYENDVTYERYLEILKSKQKE-------------RNDLAIRKKE--SGIKMEKSG----- 202

Query: 200 SDLGRAESSETPQWSSLRSGHSNRLVSAASNLFNRGRDFIEDQXXXXXXXXXXXXXXXXX 259
                         S++    SN L S A++ FN+G+  ++                   
Sbjct: 203 -------------LSNIVGTDSNNLFSMATDFFNKGKKLVD-----------QWTSFPPE 238

Query: 260 XNERFSN----HTQESDYSVNQTNDQAH--------LIHTQPTA--AEVDLLEGFADTEV 305
            N+R +N    H +  DY + Q ND  +        ++   P A   + DLL  F     
Sbjct: 239 ANDRLNNYSKTHDKVEDYDLPQVNDSPNRILFEDNEVVENLPPADNPDQDLLTDFETKID 298

Query: 306 VQHQSTLEVPRMQA--AGVKSEE-----------SLIDFSSEGPSKSAAQLN-------- 344
           +  ++  +V    +  +G+  EE           SL+DFS    + S +  +        
Sbjct: 299 ITKRTAPDVSHSSSPTSGILIEENSRRNEPLIEDSLLDFSEGNLTNSKSNEDSTLFNENS 358

Query: 345 ----YVSITPLELSGYYDFNKTAAESYKKGDYHAAFQDYLKSLNTLPLAHPLRIIALSNI 400
                + I+ +ELSGY +F       +K GDY  + Q+Y KSLNTLPL HPLRIIALSNI
Sbjct: 359 NTDSTIPISDIELSGYNEFKAKGTSLFKNGDYINSLQEYEKSLNTLPLNHPLRIIALSNI 418

Query: 401 ITTQLKIGEHTESMKNINSAVELL--QDVPFDAQIQDTSPPRTYKEFWQKILAKKAEVLE 458
           I +QLKIGE+++S++N + A+EL       +  +I ++ P R++ + W KI+ ++AE  E
Sbjct: 419 IASQLKIGEYSKSIENSSMALELFPSSKAKWKNKISNSDPERSFNDIWPKIMIRRAESFE 478

Query: 459 SQDNYEAALSVYQQLISRGYTPKLILNGKARCQKACNSQKGNVSSNPTATTQGDRKNPRK 518
             ++++ AL  YQ+LI + +    I+ GK RCQ   N      S      T       +K
Sbjct: 479 HLESFKKALETYQELIKKNFFDDKIMQGKRRCQDFINPPPVKKSMPVKKKTTTTSPATKK 538

Query: 519 QTATAKGKTEEVKRLKAQNHAIEKQENERFGLHDKVESRIRTWTAGKSTDXXXXXXXXXX 578
           Q  TA      +           + EN +  L+DKV  +I +W  GK  D          
Sbjct: 539 QNLTASSSNSPISVDSTSEIKKRELENAKLALYDKVFEKISSWKDGKDDDIRHLLANLSS 598

Query: 579 XXXXXNSDQMIASDLVMPKRVKLSYLKAVSKTHPDKLPQTLELEEKMVAEHVFITLTKAW 638
                N   +   DLVMPKRVK++Y+KAV+KTHPDK+P++L LE KM+AE++F TL+ AW
Sbjct: 599 LLTWCNWKDVSMQDLVMPKRVKITYMKAVAKTHPDKIPESLSLENKMIAENIFSTLSIAW 658

Query: 639 GVFKEENSLS 648
             FK +N ++
Sbjct: 659 DKFKLQNDIN 668

>KAFR0C01850 Chr3 (369596..371536) [1941 bp, 646 aa] {ON} Anc_5.352
           YDR320C
          Length = 646

 Score =  254 bits (650), Expect = 4e-75,   Method: Compositional matrix adjust.
 Identities = 209/717 (29%), Positives = 328/717 (45%), Gaps = 140/717 (19%)

Query: 1   MSDPFANLLTKFK--GKEK--------PADAQTSKNRSLNDLLAQHSVSSLSEPPATLYT 50
           MSDPFANLL  FK  GK+         P  +    + SLN  L    ++ ++   +TL T
Sbjct: 1   MSDPFANLLESFKENGKKPDIEKKNPVPVKSNDVSSISLNSTLQPKKLNGINTKVSTLST 60

Query: 51  PRDTRPAAGLVDLGRESPNLPGETSGIYQSGRGNPSTEGYKSQSLIDLEDAQPHPAASVS 110
             ++ P    V         P      ++   G+ ++  +            P P  +  
Sbjct: 61  --NSVPTFANVSSLNSLQTTPIHDD--FEELFGSSTSNNF---------SVSPEPTNNFK 107

Query: 111 S--------FEDKTTTIADEEQDFELAKLMSLGLDIGAANDYYHRGGRYEQLRMRRAESD 162
           +        +E K  ++ DE +D E+A+LMSLGL I  AN YY +G  Y+ L +++ E  
Sbjct: 108 TVTDVPNVTYEAKQDSVVDEVKDMEIAQLMSLGLSIEKANSYYSKGISYDTL-LKKLE-- 164

Query: 163 GTRMHRGSNLGRNSDFCRSRDFGRGSDLGRSGDFERGSDLGRAESSETPQWSSLRSGHSN 222
             R   GS  GR++       FG                 G     +        S  + 
Sbjct: 165 --RRRYGSRKGRDTP-----TFG-----------------GNTNKDDKAYAKLFDSSENT 200

Query: 223 RLVSAASNLFNRGRDFIEDQXXXXXXXXXXXXXXXXXXNERFSNHTQESDYSVNQTNDQA 282
            L S AS LFN+G++FI+                      + + + +E+D  +++  D +
Sbjct: 201 NLFSMASGLFNKGKEFID----------------------QMTAYPEETD-RLSRYRDIS 237

Query: 283 HLIHTQPTAAEVDLLEGFADTEVVQHQS-------TLEVPRMQAAGVKSEESLIDF---- 331
            +   +P      +++GF    + QHQ        T EV   Q +   S + L +F    
Sbjct: 238 EISSMKPLRKSPGIVDGFDMDRISQHQDTDKGKAPTREV--QQESPPPSHDLLDNFQNNL 295

Query: 332 ----SSEGPSKSAAQLNY---------------------------------VSITPLELS 354
               + E  SK +  L+                                  + I+ +ELS
Sbjct: 296 KLDDNKEELSKESVLLDIDNDDSTLLKSKSLTSDSLLFQDENVLENSNIPKIPISSIELS 355

Query: 355 GYYDFNKTAAESYKKGDYHAAFQDYLKSLNTLPLAHPLRIIALSNIITTQLKIGEHTESM 414
           GY ++N   +  +K GDY +A ++Y KSLNTLP +HPLRIIA SNI   +LKIGE++  +
Sbjct: 356 GYNEYNSRGSSFFKNGDYISALEEYEKSLNTLPQSHPLRIIAYSNITAAELKIGEYSNLV 415

Query: 415 KNINSAVELL--QDVPFDAQIQDTSPPRTYKEFWQKILAKKAEVLESQDNYEAALSVYQQ 472
           K  + A++L   +++ ++  IQD+ P ++YK+ W K++ +KAE LE  +N+E A   Y  
Sbjct: 416 KKADKALKLFPKENLKWNLIIQDSEPHKSYKDIWSKLVLRKAEALEHLENFELAYKQYHS 475

Query: 473 LISRGYTPKLILNGKARCQKACNSQKG-NVSSNPTATTQGDRKNPRKQTATAKGKTEEVK 531
           LI        I++GK RCQK  N +        P+++       P  Q      K E V+
Sbjct: 476 LIENNVFSDKIMDGKRRCQKVLNPEIAKKTQQKPSSSKPAAVPTPSTQ------KYESVE 529

Query: 532 RLKAQNHAIEKQENERFGLHDKVESRIRTWTAGKSTDXXXXXXXXXXXXXXXNSDQMIAS 591
           R+K QN   E+ E E+  L+D VE++I  W + K  D                   +  +
Sbjct: 530 RIKEQNRQEEENEAEKLKLYDIVEAKINAWKSNKPEDIRHLLANLPTILTWTEWKPISVN 589

Query: 592 DLVMPKRVKLSYLKAVSKTHPDKLPQTLELEEKMVAEHVFITLTKAWGVFKEENSLS 648
           DLVMPK+VK++YLKA++KTHPDK+  +L LE KM+AE+ F TL+ AW  FKEEN+++
Sbjct: 590 DLVMPKKVKVTYLKAIAKTHPDKISSSLNLESKMIAENAFSTLSVAWDKFKEENNMN 646

>KLTH0H14872g Chr8 complement(1289638..1291509) [1872 bp, 623 aa]
           {ON} weakly similar to uniprot|Q06677 Saccharomyces
           cerevisiae YDR320C SWA2 auxilin-like protein
          Length = 623

 Score =  248 bits (633), Expect = 7e-73,   Method: Compositional matrix adjust.
 Identities = 134/334 (40%), Positives = 196/334 (58%), Gaps = 7/334 (2%)

Query: 322 VKSEESLIDFSSEGPSKSAAQLNYV-SITPLELSGYYDFNKTAAESYKKGDYHAAFQDYL 380
           V+  + LIDF +     S     Y  ++T LE   + +F +  A S++ GDYHAAFQ+Y 
Sbjct: 290 VQDNDLLIDFEAPALKTSNVPATYSPNLTELERHSFEEFKEKGANSFRTGDYHAAFQNYE 349

Query: 381 KSLNTLPLAHPLRIIALSNIITTQLKIGEHTESMKNINSAVELLQDVPFDAQIQDTSPPR 440
           KSLN+LPL HPLR+++ SNII  +LK+GE+ E++ + +SA++L+     ++ I + +PP+
Sbjct: 350 KSLNSLPLTHPLRVVSFSNIIICRLKVGEYREALSDASSALKLIPQGSMNSNIPNLNPPK 409

Query: 441 TYKEFWQKILAKKAEVLESQDNYEAALSVYQQLISRGYTPKLILNGKARCQKACNSQKGN 500
           TYKEFW KI+  KA   E  +NYE AL  YQQLI  G T   +L  + +CQKA   +K  
Sbjct: 410 TYKEFWSKIMNNKAVAFERVENYEKALETYQQLIEAGVTSSKVLEARRQCQKAIALEKKP 469

Query: 501 VS----SNPTATTQGDRKNP--RKQTATAKGKTEEVKRLKAQNHAIEKQENERFGLHDKV 554
           VS    S  +       K P  R    T +  +E++ R++  N   +  E +RF LHD+V
Sbjct: 470 VSVARKSETSIPKAAVTKKPSGRPAKVTLENPSEKLARVQDINKKEKDLEAQRFLLHDEV 529

Query: 555 ESRIRTWTAGKSTDXXXXXXXXXXXXXXXNSDQMIASDLVMPKRVKLSYLKAVSKTHPDK 614
            S I+ W  G   +               N  ++  +DLV+PK+ K+ YLKAV+KTHPDK
Sbjct: 530 SSLIQEWCEGHDDNLRELLARFHTIVDWVNWKEVSTADLVVPKKAKVIYLKAVAKTHPDK 589

Query: 615 LPQTLELEEKMVAEHVFITLTKAWGVFKEENSLS 648
           +  +  L+ KM+AE+VFI L+KAW  FKE+N LS
Sbjct: 590 IQDSWPLKRKMIAENVFIVLSKAWETFKEKNQLS 623

 Score = 55.5 bits (132), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 44/139 (31%), Positives = 57/139 (41%), Gaps = 43/139 (30%)

Query: 106 AASVSSFEDKTTTIADEEQDFELAKLMSLGLDIGAANDYYHRGGRYEQL--RMRRAESDG 163
           A  V   E K   + DE +D E+A+LMSLGLD   A +YY RG  YEQ+  R +R  +  
Sbjct: 86  APDVDLVEPKPQPVVDEVKDMEIARLMSLGLDWDKAAEYYERGILYEQVVDRQKRRTART 145

Query: 164 TRMHRGSNLGRNSDFCRSRDFGRGSDLGRSGDFERGSDLGRAESSETPQWSSLRSGHSNR 223
            R  R S                                        PQ S LR   S+ 
Sbjct: 146 ERPLRTS----------------------------------------PQSSQLREEESD- 164

Query: 224 LVSAASNLFNRGRDFIEDQ 242
           L S ASN  N+GR F++ +
Sbjct: 165 LFSVASNWLNKGRTFLDSK 183

>Smik_4.579 Chr4 complement(1032558..1034561) [2004 bp, 667 aa] {ON}
           YDR320C (REAL)
          Length = 667

 Score =  244 bits (623), Expect = 4e-71,   Method: Compositional matrix adjust.
 Identities = 204/719 (28%), Positives = 328/719 (45%), Gaps = 123/719 (17%)

Query: 1   MSDPFANLLTKFKGKEKPADAQTSKNRSLNDL-LAQHSVSSLSEPPATLYTPRDTRPAAG 59
           MSDPFA+LLT FK K+  A+++    RS N   L    V+ +S+   T+     +  A+ 
Sbjct: 1   MSDPFAHLLTSFKNKDSAAESKKETLRSSNSPSLPDSVVADISKTDKTINDSLHSISASP 60

Query: 60  LV---DLGRESPNLPGETSGI-------------------YQSGRGNPSTEGYKSQSLID 97
           L+    +G   P L    + I                   +    GN +T    + +L  
Sbjct: 61  LIPSSKVGFSVPPLVSSNNTISANSTNSSPRPPLDHIDDDFNELFGNGTTAA--TDTLQK 118

Query: 98  LEDAQPHPAASVSSFEDKTTTIADEEQDFELAKLMSLGLDIGAANDYYHRGGRYEQ-LRM 156
           + D          S  D+   + DE +D E+A+LMSLGL I  A  +Y+    YE+ L++
Sbjct: 119 VNDDYCRNNEGRKSNGDEA--LVDEVKDMEIARLMSLGLSIEKATKFYNDDITYERYLKV 176

Query: 157 RRAESDGTRMHRGSNLGRNSDFCRSRDFGRGSDLGRSGDFERGSDLGRAESSETPQWSSL 216
            ++    ++         + +F RS               E  ++ G             
Sbjct: 177 LKSNQKKSKDRTARESPGDVNFERS---------------ELSNNFG------------- 208

Query: 217 RSGHSNRLVSAASNLFNRGRDFIEDQXXXXXXXXXXXXXXXXXXNERFSNH----TQESD 272
               +N L S A+N FN+G++ ++                    N+R +NH     +  D
Sbjct: 209 --SENNNLFSIATNFFNKGKELVDQW-----------TSFPPEENDRLNNHPNLRNKSED 255

Query: 273 YSVNQTNDQAHLIHTQPTAAEVDLL-EGFADTEVV-QHQSTLEVPRMQAAGVKS------ 324
           Y     ND  +    +   +E  LL E   D +++   ++ +E+ +   + V        
Sbjct: 256 YDSPLENDPYNGFSIEDDKSEKGLLSENNLDEDLLTDFETKIEITKRTVSDVDPSPSPSS 315

Query: 325 ---------------EESLIDFSSEGPSKS-AAQLN-----------YVSITPLELSGYY 357
                          E +L+DFS    +KS +++ N            + I+ +ELSGY 
Sbjct: 316 GILIEENPLRKEPLVENNLLDFSEGNVTKSNSSESNSLFNGNRNPNSAIPISDIELSGYN 375

Query: 358 DFNKTAAESYKKGDYHAAFQDYLKSLNTLPLAHPLRIIALSNIITTQLKIGEHTESMKNI 417
           +F    +  +K GDY  + Q+Y KSLN+LP  HPLRIIALSNII +QLK+GE+++S++N 
Sbjct: 376 EFKAKGSNFFKNGDYVNSLQEYEKSLNSLPSNHPLRIIALSNIIASQLKVGEYSKSIENS 435

Query: 418 NSAVELLQDVP--FDAQIQDTSPPRTYKEFWQKILAKKAEVLESQDNYEAALSVYQQLIS 475
           + A+ L       +   I D+ P R++ + W KI+ ++AE  E  +++  AL  YQ+LI+
Sbjct: 436 SMALALFPPTKANWSNMISDSDPQRSFNDIWPKIMIRRAESFEHLESFSNALETYQELIN 495

Query: 476 RGYTPKLILNGKARCQKACNSQKGNVSSNPTATTQGDRKNPRKQTATAKGKTEEVKRLKA 535
           + +  + I+ GK RCQ   N         P       +K    Q+ T K          +
Sbjct: 496 KNFFDEKIMQGKRRCQNFINPP-------PVKKFSPVKKATSTQSPTEKSTPTSSSSTSS 548

Query: 536 QNHA----IEKQ--ENERFGLHDKVESRIRTWTAGKSTDXXXXXXXXXXXXXXXNSDQMI 589
            +      I+KQ  EN +  L+DKV  RI +W   K  D               N   + 
Sbjct: 549 NSPDTTSKIKKQELENAKLALYDKVFERISSWKNDKGDDIRHLLANLSGLLTWCNWKDIP 608

Query: 590 ASDLVMPKRVKLSYLKAVSKTHPDKLPQTLELEEKMVAEHVFITLTKAWGVFKEENSLS 648
             DLVMPKRVK++Y+KAV+KTHPDK+P++L LE KM+AE+VF +L+ AW  FK++N ++
Sbjct: 609 MQDLVMPKRVKITYMKAVAKTHPDKIPESLSLENKMIAENVFSSLSIAWDKFKQQNDIN 667

>NDAI0C04320 Chr3 complement(983914..986034) [2121 bp, 706 aa] {ON}
           Anc_5.352 YDR320C
          Length = 706

 Score =  244 bits (624), Expect = 7e-71,   Method: Compositional matrix adjust.
 Identities = 130/308 (42%), Positives = 192/308 (62%), Gaps = 10/308 (3%)

Query: 346 VSITPLELSGYYDFNKTAAESYKKGDYHAAFQDYLKSLNTLPLAHPLRIIALSNIITTQL 405
           V I+ +ELSG+ +F    +E +K GDY +A Q+Y KSLNTLP  HPLRII+ SNII TQL
Sbjct: 404 VPISHIELSGHIEFKTRGSELFKNGDYVSALQEYEKSLNTLPQYHPLRIISYSNIIATQL 463

Query: 406 KIGEHTESMKNINSAVELLQD----VPFDAQIQDTSPPRTYKEFWQKILAKKAEVLESQD 461
           KIGE+++S+++   A+ L         ++  I D++P R++K+ W K++ ++AE  E  +
Sbjct: 464 KIGEYSKSIEDCKIALSLFPKGKVTSAWNQIIPDSTPQRSFKDIWSKLIMRQAESYEHLE 523

Query: 462 NYEAALSVYQQLISRGYTPKLILNGKARCQKACN-SQKGNVSSNPTATTQGDRKNPRKQT 520
           NY+ AL  YQ+LI  G+T   I++GK RCQK  N       S +PT T     K+  K T
Sbjct: 524 NYKLALDSYQKLIENGFTNSKIMDGKRRCQKILNPPPPPQTSKSPTPTPVSILKHKEKDT 583

Query: 521 ATAKGKTEEVKRLKAQNHAIEKQENERFGLHDKVESRIRTWTAGKSTDXXXXXXXXXXXX 580
            TA      V+RL+ +N    + EN++  L+DKVES+I  W   K TD            
Sbjct: 584 TTA-----SVQRLQDENAKSREIENQKVALYDKVESKINAWKLDKDTDIRHLLSNLSTVL 638

Query: 581 XXXNSDQMIASDLVMPKRVKLSYLKAVSKTHPDKLPQTLELEEKMVAEHVFITLTKAWGV 640
              +   +  +DLVMPK+VK++YLKA++KTHPDK+P++L+LE KM+AE+VF  L+ AW  
Sbjct: 639 TWCDWPSISQADLVMPKKVKITYLKAITKTHPDKIPESLDLENKMIAENVFSILSLAWDK 698

Query: 641 FKEENSLS 648
           FK +N+++
Sbjct: 699 FKLDNNMN 706

 Score = 48.1 bits (113), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 53/196 (27%), Positives = 78/196 (39%), Gaps = 47/196 (23%)

Query: 1   MSDPFANLLTKFKGKE-------------KPADAQTSKNRSLNDLLAQHSVSSLSEPPAT 47
           MSDPFA+LLT FK  +             K   A T    S+   L + S  SL      
Sbjct: 1   MSDPFASLLTSFKNGQNTTNNNTTTDTDTKKLSATTPSQSSIQFNLNKASTPSL------ 54

Query: 48  LYTPRDTRPAAGLVDLGRES----------PNLPGETSGIYQSGR-----GNPSTEGYKS 92
                DT   A L+   R++          P +  + S ++ S         P+ +    
Sbjct: 55  -----DTFALAPLIPSSRDASKSNSRVTSPPLIEDDFSDLFNSNEQKNITSPPAPKKDDI 109

Query: 93  QSLIDLEDAQP--------HPAASVSSFEDKTTTIADEEQDFELAKLMSLGLDIGAANDY 144
            S  D+  + P        H   +    + +   I DE +D E+A+LMSLGL I  AN Y
Sbjct: 110 DSAFDIFTSTPPLEQQQQQHGLVTEHEKDYEEEIIVDEVKDMEVARLMSLGLSIDQANKY 169

Query: 145 YHRGGRYEQLRMRRAE 160
           Y +G  YE +  ++ E
Sbjct: 170 YDKGILYEDIIRKQRE 185

>Skud_4.586 Chr4 complement(1042397..1044325) [1929 bp, 642 aa] {ON}
           YDR320C (REAL)
          Length = 642

 Score =  243 bits (619), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 174/560 (31%), Positives = 278/560 (49%), Gaps = 86/560 (15%)

Query: 122 EEQDFELAKLMSLGLDIGAANDYYHRGGRYEQ-LRMRRAESDGTRMHRGSNLGRNSDFCR 180
           E +D E+A+LMSLGL +  A ++Y+    YE+ L + +++    + HR   + R     +
Sbjct: 136 EVKDMEIARLMSLGLSVQKATEFYNDDITYERYLEILKSKQ---KKHRD-RIARE----K 187

Query: 181 SRDFGRGSDLGRSGDFERGSDLGRAESSETPQWSSLRSGHSNRLVSAASNLFNRGRDFIE 240
           S D      + + G F                        +N L+S A++ FN+G++ ++
Sbjct: 188 SNDIK----IKKPGLFNN------------------TDSDNNNLLSIATDFFNKGKELMD 225

Query: 241 DQXXXXXXXXXXXXXXXXXXNERFSNHTQESDYSVNQTNDQAHLIHTQPTAA-----EVD 295
                               N R  +H    D    ++ND    +   P  +     + D
Sbjct: 226 QWTSFPPEE-----------NNRLKSHLNLED----ESNDYDLSLEENPCNSGGDNLDED 270

Query: 296 LLEGF-ADTEVVQHQS---------TLEVPRMQAAGVKS---EESLIDFSSEGPSKSAA- 341
           LL  F A  ++ +  S         + ++P  + +G K    ++SL+DFS E  +KS + 
Sbjct: 271 LLTDFEAKIDITKRASKNVASSPSPSFDIPIDEDSGKKESSMDDSLLDFSPENFTKSDST 330

Query: 342 --------QLNYVSITPL---ELSGYYDFNKTAAESYKKGDYHAAFQDYLKSLNTLPLAH 390
                     N VS+ P+   ELSGY +F    A  +K GDY  + Q+Y K+LN+LP  H
Sbjct: 331 ENNTLFGESSNAVSVVPISDIELSGYSEFKAKGATLFKNGDYVNSLQEYEKALNSLPSNH 390

Query: 391 PLRIIALSNIITTQLKIGEHTESMKNINSAVELL--QDVPFDAQIQDTSPPRTYKEFWQK 448
           PLRII LSNII +QLK+GE+++S+ N + A+ L       ++ +I ++ P R++ + W K
Sbjct: 391 PLRIIGLSNIIASQLKVGEYSKSIVNSDLALALFPPAKASWNNKISNSDPQRSFNDIWPK 450

Query: 449 ILAKKAEVLESQDNYEAALSVYQQLISRGYTPKLILNGKARCQKACNSQKGNVSSNPTAT 508
           I+ ++AE  E  ++++ AL  YQ+LISR +    I+ GK RCQ    S      S P   
Sbjct: 451 IMIRRAESFEHLESFKNALETYQELISRNFFDDKIMQGKRRCQNFI-SPPLVRKSTPVKK 509

Query: 509 TQGDRKNPRKQTATAKGKTEEVKRLKAQNHAIEKQENERFGLHDKVESRIRTWTAGKSTD 568
           T    K P    + A    +   ++K Q     + EN +  L+DKV  +I TW  GK  D
Sbjct: 510 TTPTLKKPAPDPSPAP--IDIPSKVKEQ-----ELENAKLALYDKVFGKIGTWKGGKEDD 562

Query: 569 XXXXXXXXXXXXXXXNSDQMIASDLVMPKRVKLSYLKAVSKTHPDKLPQTLELEEKMVAE 628
                          N   +   DLVMPK+VK++Y+KAV+KTHPDK+P++L LE KM+AE
Sbjct: 563 IRHLLSNLSQLLTWCNWKDVSMQDLVMPKKVKIAYMKAVAKTHPDKIPESLSLENKMIAE 622

Query: 629 HVFITLTKAWGVFKEENSLS 648
           ++F TL+ AW  FK++N ++
Sbjct: 623 NIFSTLSIAWDKFKQQNDIN 642

>TPHA0E01110 Chr5 (228116..230197) [2082 bp, 693 aa] {ON} Anc_5.352
           YDR320C
          Length = 693

 Score =  233 bits (593), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 141/393 (35%), Positives = 213/393 (54%), Gaps = 31/393 (7%)

Query: 284 LIHTQPTAAEV-------DLLEGFADTEVVQHQSTLEVPRMQAAGVKSEE-----SLIDF 331
           + H Q + A++       DLL+ F +  V+    T   PR+      ++E     +L+DF
Sbjct: 304 ITHKQKSPADLTSNELEGDLLDSFEENIVIGESFTNIPPRITERQKPNDERIQDNTLLDF 363

Query: 332 SSEGPSKSA---------AQLNYVSITPLELSGYYDFNKTAAESYKKGDYHAAFQDYLKS 382
            +E  S  A           +  +SI  +ELSGY +F     E +KKGDY +A + Y KS
Sbjct: 364 GNEDLSSPANVSISSSGQECIPVISINQIELSGYNEFKDRGTEYFKKGDYVSATEQYEKS 423

Query: 383 LNTLPLAHPLRIIALSNIITTQLKIGEHTESMKNINSAVELL--QDVPFDAQIQDTSPPR 440
           LN+L   HPLRIIA SN++ + LK G++T  +    SA++L   +   +D  IQ++ P +
Sbjct: 424 LNSLSKLHPLRIIASSNLLASLLKTGDYTSMITISTSALDLFPKESKLWDNVIQNSEPSK 483

Query: 441 TYKEFWQKILAKKAEVLESQDNYEAALSVYQQLISRGYTPKLILNGKARCQKACNSQKGN 500
           TYKE W K++A++AE  E  +NY+ A   YQ LI      + I+ GK RCQK  N +  N
Sbjct: 484 TYKEIWSKLVARRAEAFEFIENYQQAYDSYQLLIENNIFNEKIMAGKLRCQKVLNPETHN 543

Query: 501 -----VSSNPTATTQGDRKNPRKQTATAKGKTEEVKRLKAQNHAIEKQENERFGLHDKVE 555
                + +    T     KN     +T+ G    +K+++ QN   EK E E+  L+D VE
Sbjct: 544 KPLKKLVATTAETKTSQTKNIVNTQSTSSGN---LKKIQEQNKRTEKYEEEKEALYDVVE 600

Query: 556 SRIRTWTAGKSTDXXXXXXXXXXXXXXXNSDQMIASDLVMPKRVKLSYLKAVSKTHPDKL 615
            ++  W AGK  D                 +++ +SDLVMPK+VK++YLKAV+KTHPDKL
Sbjct: 601 QKVNAWIAGKDDDIRHLLSRLQRIITWTQWNEVASSDLVMPKKVKITYLKAVAKTHPDKL 660

Query: 616 PQTLELEEKMVAEHVFITLTKAWGVFKEENSLS 648
           P  L+ E +M+AE++F  L+K W  FK +N++S
Sbjct: 661 PSNLDTESRMLAENIFSILSKNWEKFKVDNNIS 693

 Score = 52.4 bits (124), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 56/199 (28%), Positives = 83/199 (41%), Gaps = 51/199 (25%)

Query: 1   MSDPFANLLTKFKG----KEKPADAQ---TSKNRSLNDLLAQHSVSSLSEPPATLYTPRD 53
           M+DPFA+LLT FK     +E    AQ   TS+N S+N+LL   S    S           
Sbjct: 1   MADPFADLLTSFKTGPNERENSGTAQSNTTSRNLSMNELLNSSSNVKNSNLDVL------ 54

Query: 54  TRPAAGLVDLGRESPNLPGET-----------SGIYQSGRGNPSTEGYKS---------Q 93
            +P A  VD+  +S ++P                ++   + + +T  +K           
Sbjct: 55  -QPKAKNVDMLNKSTSVPSNVINNNKNLLDDFDDLFGPSKPSVTTNTFKGTDQGERDDLD 113

Query: 94  SLIDLEDAQPHPA--------------ASVSSFEDKTTTIADEEQDFELAKLMSLGLDIG 139
            ++D+ D  P P+              A  SS   K   I DE +D E+AKLMSLGL I 
Sbjct: 114 DIMDMFDFTPSPSHCNQEVMPSKTNAEAQSSS---KNEVIVDEVKDMEIAKLMSLGLSID 170

Query: 140 AANDYYHRGGRYEQLRMRR 158
            A   +  G  Y+ +  R+
Sbjct: 171 EAIKSFEHGILYDTVASRQ 189

>Suva_2.489 Chr2 complement(863483..865462) [1980 bp, 659 aa] {ON}
           YDR320C (REAL)
          Length = 659

 Score =  228 bits (581), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 124/335 (37%), Positives = 191/335 (57%), Gaps = 16/335 (4%)

Query: 325 EESLIDFSSE--------GPSKSAAQLNYVS-ITPLELSGYYDFNKTAAESYKKGDYHAA 375
           E++L+DFS++          S+     N V+ I+ +ELSGY +F       +K GDY  +
Sbjct: 330 EDNLLDFSTDNISSTNNSAISREDGNTNPVAPISDIELSGYNEFKAKGTSLFKNGDYVNS 389

Query: 376 FQDYLKSLNTLPLAHPLRIIALSNIITTQLKIGEHTESMKNINSAVELL--QDVPFDAQI 433
            Q+Y KSLN+LPL HPLRIIALSNII +QLKIGE+++S++N ++A+ L       ++ +I
Sbjct: 390 LQEYEKSLNSLPLKHPLRIIALSNIIASQLKIGEYSKSIENSDTALALFPANKSSWNDKI 449

Query: 434 QDTSPPRTYKEFWQKILAKKAEVLESQDNYEAALSVYQQLISRGYTPKLILNGKARCQKA 493
             + P R+Y + W KI+ ++AE  E  ++++ AL  YQ+L++R +    I+ GK RCQ  
Sbjct: 450 SKSDPQRSYNDIWPKIMIRRAESFEHLESFKNALETYQELVTRNFFDDKIMQGKRRCQDF 509

Query: 494 CNSQKGNVSSNPTATTQGDRKNPRKQTATAKGKTEEVKRLKAQNHAIEKQENERFGLHDK 553
            N       S    TT       +  +  +    +   R+K Q     + EN +  L+D 
Sbjct: 510 VNPAPARKPSPVKKTTPTPAPMKKPTSTPSPAPVDNASRVKEQ-----ELENAKLALYDN 564

Query: 554 VESRIRTWTAGKSTDXXXXXXXXXXXXXXXNSDQMIASDLVMPKRVKLSYLKAVSKTHPD 613
           V  +I  W  GK  D               N   +   +LVMPK+VK++Y+KAV+KTHPD
Sbjct: 565 VSDKIGCWKCGKDDDIRHLLANLSGLLTWCNWKDVSVQELVMPKKVKITYMKAVAKTHPD 624

Query: 614 KLPQTLELEEKMVAEHVFITLTKAWGVFKEENSLS 648
           K+P++L LE KM+AE+VF TL+ AW  FK++N ++
Sbjct: 625 KIPKSLSLENKMIAENVFTTLSFAWDKFKQQNDIN 659

 Score = 40.8 bits (94), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 17/36 (47%), Positives = 24/36 (66%)

Query: 118 TIADEEQDFELAKLMSLGLDIGAANDYYHRGGRYEQ 153
            + DE +D E+A+LMSLGL I  A D+Y+    YE+
Sbjct: 136 VLVDEVKDMEIARLMSLGLSIEKATDFYNSDVTYEK 171

>CAGL0H07095g Chr8 (700262..702247) [1986 bp, 661 aa] {ON} similar
           to uniprot|Q06677 Saccharomyces cerevisiae YDR320c SWA2
          Length = 661

 Score =  228 bits (581), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 125/340 (36%), Positives = 199/340 (58%), Gaps = 16/340 (4%)

Query: 325 EESLIDFSSEG----PSKSAAQLNYVSITPL-----ELSGYYDFNKTAAESYKKGDYHAA 375
           E +L+DF ++     P  + +  N VSIT +     E+SGY +F     + +K GDY +A
Sbjct: 322 EGTLLDFDNDNHASSPVVNTSNQNTVSITQIPISHIEISGYNEFKARGTDYFKNGDYASA 381

Query: 376 FQDYLKSLNTLPLAHPLRIIALSNIITTQLKIGEHTESMKNINSAVELL--QDVPFDAQI 433
            ++Y KSLNTLP+ HPLRIIA SNII +++KIG+H++S+ +   A++LL  +   + A I
Sbjct: 382 VEEYEKSLNTLPMKHPLRIIAYSNIIASRIKIGQHSQSVVDAQEAMKLLPEEKSLWTAAI 441

Query: 434 QDTSPPRTYKEFWQKILAKKAEVLESQDNYEAALSVYQQLISRGYTPKLILNGKARCQKA 493
           Q++ P R+Y + W KI+ ++AE  E+ + Y+ AL  YQ L+ +    + ++ GK RCQ A
Sbjct: 442 QNSDPVRSYNDIWPKIILRQAESYEAIEKYKLALDAYQTLLEKNLFSEKVIAGKRRCQHA 501

Query: 494 C---NSQKGNVSSNPTATTQGDRKNP--RKQTATAKGKTEEVKRLKAQNHAIEKQENERF 548
               +  K N  S         R+ P   +QT     K+   ++LK +N  + K E+++ 
Sbjct: 502 LGLDSKPKSNPPSKSATPAPAPRRAPTVNRQTEVVNKKSVNAEKLKKENERLAKLEDQKV 561

Query: 549 GLHDKVESRIRTWTAGKSTDXXXXXXXXXXXXXXXNSDQMIASDLVMPKRVKLSYLKAVS 608
            L+DKVE  I +W  GK  D                   + +S+LV+P++VK++Y+KAV+
Sbjct: 562 ALYDKVEGIINSWKNGKQDDIRYLLSNLQAVITWTQWKPVQSSELVLPRKVKITYMKAVA 621

Query: 609 KTHPDKLPQTLELEEKMVAEHVFITLTKAWGVFKEENSLS 648
           K HPDKLP +L LE++M+AE VF TL+ +W  FK+ N ++
Sbjct: 622 KLHPDKLPSSLTLEQQMIAESVFSTLSDSWENFKKSNDIN 661

 Score = 56.6 bits (135), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 48/94 (51%), Gaps = 4/94 (4%)

Query: 113 EDKTTTIADEEQDFELAKLMSLGLDIGAANDYYHRGGRYEQLRMRRAESDGTRMHRGSNL 172
           E  T  + DE +D ELAKLMSLGL+I  A+ YY RG  +E +  +R +       + SN+
Sbjct: 124 ESPTEEVIDEVRDMELAKLMSLGLNIDKASSYYERGITFEDVLRKRKQKASNGYQQRSNI 183

Query: 173 GRNSDFCRSRDF----GRGSDLGRSGDFERGSDL 202
            R       R+     G GS+   SG   +G +L
Sbjct: 184 DRKQGGGEIRNIFDTRGSGSESLFSGILNKGKEL 217

>TBLA0H01970 Chr8 (464239..466761) [2523 bp, 840 aa] {ON} Anc_5.352
           YDR320C
          Length = 840

 Score =  217 bits (552), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 122/305 (40%), Positives = 176/305 (57%), Gaps = 3/305 (0%)

Query: 346 VSITPLELSGYYDFNKTAAESYKKGDYHAAFQDYLKSLNTLPLAHPLRIIALSNIITTQL 405
           V I+ +ELSGY +F     E +KKGDY +A  +Y KSLNTLP  HPLR+I+ SNI+  QL
Sbjct: 536 VPISTIELSGYTEFRANGTEFFKKGDYDSALSEYKKSLNTLPQKHPLRLISYSNILAAQL 595

Query: 406 KIGEHTESMKNINSAVELL--QDVPFDAQIQDTSPPRTYKEFWQKILAKKAEVLESQDNY 463
           K+GE+++S+K+ + A+EL    D  +   IQD+ P +TYKE W KI+ +KAE  E  + Y
Sbjct: 596 KVGEYSQSVKDCDVALELFPKNDKQWTQFIQDSDPQKTYKEIWPKIVLRKAEACEHMEKY 655

Query: 464 EAALSVYQQLISRGYTPKLILNGKARCQKACNSQKGNVSSNPTATTQGDRKNPRKQTATA 523
           + A   YQ L+ +      I+ GK RCQK  N +   + S+   +     K     T++ 
Sbjct: 656 QIAYDSYQLLLHKNVFNDKIMAGKRRCQKVLNPETPKLKSSANTSRISSAKQSTASTSSI 715

Query: 524 KGKTEEVKRLKAQNHAIEKQENERFGLHDKVESRIRTWTAGKSTDXXXXXXXXXXXXXXX 583
               + V+RLK       ++E ER  L D V ++I+ WT  K  D               
Sbjct: 716 -NVNKNVERLKETRKKEREEEEERLRLLDSVNAKIQKWTNNKEDDIRYLLSNVHIVLTWS 774

Query: 584 NSDQMIASDLVMPKRVKLSYLKAVSKTHPDKLPQTLELEEKMVAEHVFITLTKAWGVFKE 643
           N   + ASDLVMPK+VK++Y+KAV+KTHPDK+ + L +E KM+AE +F  L+ AW  FK 
Sbjct: 775 NWKAINASDLVMPKKVKVNYMKAVAKTHPDKISKDLSIENKMIAESIFSILSVAWEKFKT 834

Query: 644 ENSLS 648
            N ++
Sbjct: 835 ANKMN 839

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 33/123 (26%), Positives = 57/123 (46%), Gaps = 27/123 (21%)

Query: 118 TIADEEQDFELAKLMSLGLDIGAANDYYHRGGRYEQLRMRRAESDGTRMHRGSNLGRNSD 177
           ++ DE +D E+AKLMSLGL I  A+ YY++G   + + +R+ +    +  R SN     D
Sbjct: 215 SVVDEVKDMEIAKLMSLGLSIDKAHMYYNKGYLSDDV-LRKMQ--AQKHKRQSNYSTKYD 271

Query: 178 FCRSRDFGRGSDLGRSGDFERGSDLGRAESSETPQWSSLRSGHSNRLVSAASNLFNRGRD 237
             + R+                  L +  +S +P         +N L S AS+  N+G+ 
Sbjct: 272 DTKIRN-----------------SLDKLNNSASP-------PGNNVLFSIASDFLNKGKG 307

Query: 238 FIE 240
            ++
Sbjct: 308 IVD 310

 Score = 36.6 bits (83), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 28/47 (59%), Gaps = 5/47 (10%)

Query: 1  MSDPFANLLTKFKGKE-KPADAQTSKNRSLNDLL----AQHSVSSLS 42
          MSDPFANLL+ FKG       A  SKN SL+ L     AQ  +SSLS
Sbjct: 1  MSDPFANLLSSFKGDTPNSTSASISKNASLDVLASQRRAQSDLSSLS 47

>Ecym_2374 Chr2 (727001..728986) [1986 bp, 661 aa] {ON} similar to
           Ashbya gossypii AAL103W
          Length = 661

 Score = 36.6 bits (83), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 19/48 (39%), Positives = 28/48 (58%)

Query: 597 KRVKLSYLKAVSKTHPDKLPQTLELEEKMVAEHVFITLTKAWGVFKEE 644
           + V+ SY K   K HPDKL + L  EE++  E  ++ +TKA+    EE
Sbjct: 129 REVRSSYRKLSVKFHPDKLSKDLSQEERLQLEEQYVLITKAYKALTEE 176

>TBLA0C03690 Chr3 (882494..883711) [1218 bp, 405 aa] {ON} Anc_8.817
           YML102W
          Length = 405

 Score = 36.2 bits (82), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 30/64 (46%)

Query: 480 PKLILNGKARCQKACNSQKGNVSSNPTATTQGDRKNPRKQTATAKGKTEEVKRLKAQNHA 539
           P +I N K + +   N Q  + SSN  A  QG   +PR Q    +G    V  L+  N  
Sbjct: 205 PSIIENIKLKGEPQLNGQSSDDSSNHNACIQGIAWDPRDQYIVTQGVDRAVNILRTNNLK 264

Query: 540 IEKQ 543
           +EK+
Sbjct: 265 LEKR 268

>SAKL0G06930g Chr7 complement(569522..570154) [633 bp, 210 aa] {ON}
           weakly similar to uniprot|Q03362 Saccharomyces
           cerevisiae YDR476C Hypothetical ORF
          Length = 210

 Score = 35.4 bits (80), Expect = 0.29,   Method: Composition-based stats.
 Identities = 27/107 (25%), Positives = 47/107 (43%), Gaps = 8/107 (7%)

Query: 371 DYHAAFQDYLKSLNTLPLAHPLRIIALSNIITTQLKIGEHTESMKNINSAVELLQDVPFD 430
           D+  A +DYL    ++P+   +  + LSNI     ++   T    + +   E+ + +PF+
Sbjct: 17  DHKHALEDYLFVYGSVPITDKIAYVRLSNI-----ELDHMTLQFNHFDVEFEIEKPIPFE 71

Query: 431 AQIQDTSPPRTYKEFWQKILAKKAEVLESQDN---YEAALSVYQQLI 474
             +QD S  RT      K  A K  +   Q N   Y + L  Y  ++
Sbjct: 72  PPLQDWSEARTRLVTMAKEAAAKRNLSHLQINEMRYPSTLYEYTVMV 118

>Skud_15.420 Chr15 complement(743976..745973) [1998 bp, 665 aa] {ON}
           YOR254C (REAL)
          Length = 665

 Score = 35.4 bits (80), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 28/48 (58%)

Query: 597 KRVKLSYLKAVSKTHPDKLPQTLELEEKMVAEHVFITLTKAWGVFKEE 644
           + +K +Y K   K HPDKL + L  +EK V E  ++ +TKA+    +E
Sbjct: 139 RDIKSAYRKLSVKFHPDKLAKGLTPDEKNVVEEAYVQITKAYESLTDE 186

>YOR254C Chr15 complement(805032..807023) [1992 bp, 663 aa] {ON}
           SEC63Essential subunit of Sec63 complex (Sec63p, Sec62p,
           Sec66p and Sec72p); with Sec61 complex, Kar2p/BiP and
           Lhs1p forms a channel competent for SRP-dependent and
           post-translational SRP-independent protein targeting and
           import into the ER
          Length = 663

 Score = 35.0 bits (79), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 28/48 (58%)

Query: 597 KRVKLSYLKAVSKTHPDKLPQTLELEEKMVAEHVFITLTKAWGVFKEE 644
           + +K +Y K   K HPDKL + L  +EK V E  ++ +TKA+    +E
Sbjct: 139 RDIKSAYRKLSVKFHPDKLAKGLTPDEKSVMEETYVQITKAYESLTDE 186

>Suva_8.303 Chr8 complement(544176..546170) [1995 bp, 664 aa] {ON}
           YOR254C (REAL)
          Length = 664

 Score = 35.0 bits (79), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 28/48 (58%)

Query: 597 KRVKLSYLKAVSKTHPDKLPQTLELEEKMVAEHVFITLTKAWGVFKEE 644
           + +K +Y K   K HPDKL + L  +EK V E  ++ +TKA+    +E
Sbjct: 139 RDIKSAYRKLSVKFHPDKLAKGLTTDEKDVMEETYVQITKAYESLTDE 186

>KLTH0D11770g Chr4 complement(961180..963138) [1959 bp, 652 aa] {ON}
           similar to uniprot|P14906 Saccharomyces cerevisiae
           YOR254C SEC63 Essential subunit of Sec63 complex (Sec63p
           Sec62p Sec66p and Sec72p) with Sec61 complex Kar2p/BiP
           and Lhs1p forms a channel competent for SRP-dependent
           and post- translational SRP-independent protein
           targeting and import into the ER
          Length = 652

 Score = 34.7 bits (78), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 28/48 (58%)

Query: 597 KRVKLSYLKAVSKTHPDKLPQTLELEEKMVAEHVFITLTKAWGVFKEE 644
           + ++ +Y K   K HPDKL + L  +E+ V E  ++ +TKA+    +E
Sbjct: 129 REIRSAYRKLSVKFHPDKLSKDLSADERTVLEEQYVMITKAYKALTDE 176

>NDAI0K01230 Chr11 (280525..282567) [2043 bp, 680 aa] {ON} Anc_8.698
           YOR254C
          Length = 680

 Score = 34.3 bits (77), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 26/43 (60%)

Query: 602 SYLKAVSKTHPDKLPQTLELEEKMVAEHVFITLTKAWGVFKEE 644
           +Y K   K HPDKL + L  +E++V E  ++ +TKA+    +E
Sbjct: 141 AYRKLSIKFHPDKLSKDLSADERIVMEEKYVQITKAYEALTDE 183

>KAFR0H02310 Chr8 (441168..443135) [1968 bp, 655 aa] {ON} Anc_8.698
           YOR254C
          Length = 655

 Score = 33.5 bits (75), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 27/48 (56%)

Query: 597 KRVKLSYLKAVSKTHPDKLPQTLELEEKMVAEHVFITLTKAWGVFKEE 644
           + +K +Y K   K HPDKL + L  +E+   E  ++ +TKA+    +E
Sbjct: 133 REIKSAYRKLSVKFHPDKLAKELTEQERTTMEEAYVQITKAYEALTDE 180

>KAFR0K01280 Chr11 (266813..267268) [456 bp, 151 aa] {ON} Anc_5.659
           YKR074W
          Length = 151

 Score = 32.3 bits (72), Expect = 1.9,   Method: Composition-based stats.
 Identities = 21/71 (29%), Positives = 27/71 (38%), Gaps = 5/71 (7%)

Query: 373 HAAFQDYLKSLNTLPLAHPLRIIALSNIITTQLKIGEHTESMKNINSAVELLQDVPFDAQ 432
           H  F D LK +N      P R     N+    +KI  H    K +N  +    D P D  
Sbjct: 54  HDLFNDVLKKINNEGAYRPYR-----NVNYDTMKIYTHAHGSKTVNLVINFTHDNPEDNW 108

Query: 433 IQDTSPPRTYK 443
           + DT  P   K
Sbjct: 109 VLDTKDPNGKK 119

>Smik_15.437 Chr15 complement(754736..756727) [1992 bp, 663 aa] {ON}
           YOR254C (REAL)
          Length = 663

 Score = 33.5 bits (75), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 27/46 (58%)

Query: 599 VKLSYLKAVSKTHPDKLPQTLELEEKMVAEHVFITLTKAWGVFKEE 644
           +K +Y K   K HPDK+ + L  +EK V E  ++ +TKA+    +E
Sbjct: 141 IKSAYRKLSVKFHPDKVAKGLTSDEKSVMEETYVQITKAYESLTDE 186

>ZYRO0D10934g Chr4 complement(921917..923908) [1992 bp, 663 aa] {ON}
           similar to uniprot|P14906 Saccharomyces cerevisiae
           YOR254C SEC63 Essential subunit of Sec63 complex (Sec63p
           Sec62p Sec66p and Sec72p) with Sec61 complex Kar2p/BiP
           and Lhs1p forms a channel competent for SRP-dependent
           and post- translational SRP-independent protein
           targeting and import into the ER
          Length = 663

 Score = 33.1 bits (74), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 27/49 (55%)

Query: 597 KRVKLSYLKAVSKTHPDKLPQTLELEEKMVAEHVFITLTKAWGVFKEEN 645
           + +K +Y K   K HPDKL   L  E +   E +++ +TKA+    +EN
Sbjct: 136 REIKSAYRKLSVKFHPDKLGHDLAPEARTKMEEMYVQITKAYESLTDEN 184

>TPHA0G01480 Chr7 (304449..306431) [1983 bp, 660 aa] {ON} Anc_8.698
           YOR254C
          Length = 660

 Score = 33.1 bits (74), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 15/42 (35%), Positives = 26/42 (61%)

Query: 597 KRVKLSYLKAVSKTHPDKLPQTLELEEKMVAEHVFITLTKAW 638
           K +K +Y     K HPDKL + L  +E++  E +F+ ++KA+
Sbjct: 135 KEIKKAYRNLSLKFHPDKLDRNLSEKERLSMEEIFVQISKAY 176

>Kwal_26.8879 s26 complement(988264..990234) [1971 bp, 656 aa] {ON}
           YOR254C (SEC63) - ER protein translocation subcomplex
           subunit [contig 68] FULL
          Length = 656

 Score = 33.1 bits (74), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 15/48 (31%), Positives = 27/48 (56%)

Query: 597 KRVKLSYLKAVSKTHPDKLPQTLELEEKMVAEHVFITLTKAWGVFKEE 644
           + ++ +Y K   K HPDKL + L   E+ + E  ++ +TKA+    +E
Sbjct: 131 REIRSAYRKLSVKFHPDKLSKDLSANERSILEEQYVMITKAYKALTDE 178

>TBLA0B03730 Chr2 (860167..862248) [2082 bp, 693 aa] {ON} Anc_8.698
           YOR254C
          Length = 693

 Score = 33.1 bits (74), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 27/46 (58%)

Query: 599 VKLSYLKAVSKTHPDKLPQTLELEEKMVAEHVFITLTKAWGVFKEE 644
           +K +Y K   K HPDKL + L  +E+   E +++ +TKA+    +E
Sbjct: 145 IKSAYRKLSVKFHPDKLSKDLSEKERTTMEEMYVQITKAYEALTDE 190

>AAL103W Chr1 (161385..163394) [2010 bp, 669 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR254C (SEC63)
          Length = 669

 Score = 33.1 bits (74), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 15/48 (31%), Positives = 28/48 (58%)

Query: 597 KRVKLSYLKAVSKTHPDKLPQTLELEEKMVAEHVFITLTKAWGVFKEE 644
           + ++ +Y K   K HPDKL + L+  E+ V E  ++ +TKA+    ++
Sbjct: 129 REIRSAYRKLSVKFHPDKLAKDLQDTERSVLEEQYVLITKAYKALTDD 176

>NCAS0C01220 Chr3 (225905..227914) [2010 bp, 669 aa] {ON} Anc_8.698
          Length = 669

 Score = 32.0 bits (71), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 26/46 (56%)

Query: 599 VKLSYLKAVSKTHPDKLPQTLELEEKMVAEHVFITLTKAWGVFKEE 644
           +K +Y K   K HPDKL + L  EE+   E  ++ +TKA+    +E
Sbjct: 137 IKSAYRKLSVKFHPDKLSKDLSQEERTSMEEKYVQITKAYEALTDE 182

>SAKL0H05984g Chr8 (530194..532170) [1977 bp, 658 aa] {ON} similar
           to uniprot|P14906 Saccharomyces cerevisiae YOR254C SEC63
           Essential subunit of Sec63 complex (Sec63p Sec62p Sec66p
           and Sec72p) with Sec61 complex Kar2p/BiP and Lhs1p forms
           a channel competent for SRP-dependent and post-
           translational SRP-independent protein targeting and
           import into the ER
          Length = 658

 Score = 32.0 bits (71), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 27/48 (56%)

Query: 597 KRVKLSYLKAVSKTHPDKLPQTLELEEKMVAEHVFITLTKAWGVFKEE 644
           K V+ +Y K   K HPDKL + L  E++   E  ++ +TKA+    +E
Sbjct: 130 KEVRSAYRKLSVKFHPDKLAKDLTQEQRSELEEQYVLITKAYKALTDE 177

>KLLA0C09823g Chr3 (848641..850650) [2010 bp, 669 aa] {ON} similar
           to uniprot|P14906 Saccharomyces cerevisiae YOR254C SEC63
           Essential subunit of Sec63 complex (Sec63p Sec62p Sec66p
           and Sec72p) with Sec61 complex Kar2p/BiP and Lhs1p forms
           a channel competent for SRP-dependent and post-
           translational SRP-independent protein targeting and
           import into the ER
          Length = 669

 Score = 32.0 bits (71), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 25/48 (52%)

Query: 597 KRVKLSYLKAVSKTHPDKLPQTLELEEKMVAEHVFITLTKAWGVFKEE 644
           K +K +Y K   K HPDKL + L   E+   E  F+ + KA+    +E
Sbjct: 125 KEIKSAYRKLSVKFHPDKLSKDLNEIERTAMEEQFVMINKAYKALTDE 172

>AFR089W Chr6 (590137..593232) [3096 bp, 1031 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YKR028W (SAP190) and
            YJL098W (SAP185)
          Length = 1031

 Score = 31.6 bits (70), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 30/59 (50%), Gaps = 4/59 (6%)

Query: 184  FGRGSDLGRSGDFERGSDLGRAESSETPQWSSLRSGHSNRLVSAASNLFNRGRDFIEDQ 242
            F   ++L +SG       L R  S +   W+S    HS R++   +N+FNR +D  +D+
Sbjct: 977  FDESTELDQSG---TEYALCRTSSKDEKMWTSPEQ-HSTRIIGMNNNMFNRSKDLHKDE 1031

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.310    0.127    0.354 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 64,609,181
Number of extensions: 2699780
Number of successful extensions: 7861
Number of sequences better than 10.0: 83
Number of HSP's gapped: 8082
Number of HSP's successfully gapped: 102
Length of query: 648
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 532
Effective length of database: 40,180,143
Effective search space: 21375836076
Effective search space used: 21375836076
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 69 (31.2 bits)