Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
AGR351W5.351ON72972939340.0
KLLA0B10175g5.351ON73172828470.0
SAKL0G08844g5.351ON74672827860.0
Kwal_34.159795.351ON72872427740.0
Ecym_81825.351ON73272927550.0
Kpol_339.125.351ON73373027540.0
KLTH0H14850g5.351ON72672327210.0
KAFR0D046705.351ON73172827140.0
TPHA0E011205.351ON73372926970.0
YHR072W (ERG7)5.351ON73172826810.0
KNAG0B045805.351ON72972526680.0
NCAS0H016405.351ON72872726460.0
TDEL0E027605.351ON73172826450.0
Smik_8.1485.351ON73172826440.0
NDAI0C019705.351ON73172726410.0
Suva_15.2625.351ON73172826280.0
TBLA0A031205.351ON74372926250.0
CAGL0J10824g5.351ON73372225890.0
ZYRO0D10164g5.351ON73272925850.0
Skud_8.1315.351ON73172825790.0
YBR213W (MET8)6.105ON27454800.41
AGR380C2.316ON1098123743.2
Smik_11.370singletonON44094733.4
Ecym_28077.533ON321184724.0
TBLA0F041106.338ON55879725.4
Smik_6.1953.452ON47459708.3
Smik_2.3566.105ON27454698.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AGR351W
         (729 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AGR351W Chr7 (1381502..1383691) [2190 bp, 729 aa] {ON} Syntenic ...  1519   0.0  
KLLA0B10175g Chr2 (889538..891733) [2196 bp, 731 aa] {ON} highly...  1101   0.0  
SAKL0G08844g Chr7 complement(757226..759466) [2241 bp, 746 aa] {...  1077   0.0  
Kwal_34.15979 s34 complement(142874..145060) [2187 bp, 728 aa] {...  1073   0.0  
Ecym_8182 Chr8 complement(379402..381600) [2199 bp, 732 aa] {ON}...  1065   0.0  
Kpol_339.12 s339 (18976..21177) [2202 bp, 733 aa] {ON} (18976..2...  1065   0.0  
KLTH0H14850g Chr8 (1287375..1289555) [2181 bp, 726 aa] {ON} high...  1052   0.0  
KAFR0D04670 Chr4 (915691..917886) [2196 bp, 731 aa] {ON} Anc_5.3...  1050   0.0  
TPHA0E01120 Chr5 complement(230336..232537) [2202 bp, 733 aa] {O...  1043   0.0  
YHR072W Chr8 (239098..241293) [2196 bp, 731 aa] {ON}  ERG7Lanost...  1037   0.0  
KNAG0B04580 Chr2 complement(884911..887100) [2190 bp, 729 aa] {O...  1032   0.0  
NCAS0H01640 Chr8 complement(313901..316087) [2187 bp, 728 aa] {O...  1023   0.0  
TDEL0E02760 Chr5 complement(531650..533845) [2196 bp, 731 aa] {O...  1023   0.0  
Smik_8.148 Chr8 (215426..217621) [2196 bp, 731 aa] {ON} YHR072W ...  1023   0.0  
NDAI0C01970 Chr3 complement(442137..444332) [2196 bp, 731 aa] {O...  1021   0.0  
Suva_15.262 Chr15 (440969..443164) [2196 bp, 731 aa] {ON} YHR072...  1016   0.0  
TBLA0A03120 Chr1 (742618..744849) [2232 bp, 743 aa] {ON} Anc_5.3...  1015   0.0  
CAGL0J10824g Chr10 complement(1056204..1058405) [2202 bp, 733 aa...  1001   0.0  
ZYRO0D10164g Chr4 (854166..856364) [2199 bp, 732 aa] {ON} highly...  1000   0.0  
Skud_8.131 Chr8 (212610..214805) [2196 bp, 731 aa] {ON} YHR072W ...   998   0.0  
YBR213W Chr2 (650368..651192) [825 bp, 274 aa] {ON}  MET8Bifunct...    35   0.41 
AGR380C Chr7 complement(1431745..1435041) [3297 bp, 1098 aa] {ON...    33   3.2  
Smik_11.370 Chr11 (653235..654554) [1320 bp, 440 aa] {ON} YKR106...    33   3.4  
Ecym_2807 Chr2 complement(1567027..1567992) [966 bp, 321 aa] {ON...    32   4.0  
TBLA0F04110 Chr6 (1018165..1019841) [1677 bp, 558 aa] {ON} Anc_6...    32   5.4  
Smik_6.195 Chr6 (325513..326937) [1425 bp, 474 aa] {ON} YGR108W ...    32   8.3  
Smik_2.356 Chr2 (636565..637389) [825 bp, 274 aa] {ON} YBR213W (...    31   8.8  

>AGR351W Chr7 (1381502..1383691) [2190 bp, 729 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YHR072W (ERG7)
          Length = 729

 Score = 1519 bits (3934), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 729/729 (100%), Positives = 729/729 (100%)

Query: 1   MLYSDELGLPTTDSRRWRLFCDEVGAERWEYMDEQETSKVPQTTCVQWLLNVPSFPTPEP 60
           MLYSDELGLPTTDSRRWRLFCDEVGAERWEYMDEQETSKVPQTTCVQWLLNVPSFPTPEP
Sbjct: 1   MLYSDELGLPTTDSRRWRLFCDEVGAERWEYMDEQETSKVPQTTCVQWLLNVPSFPTPEP 60

Query: 61  EVSSKDQGFTAANAAYNGARFLGLLQDEASGTFPCSYRGPMFMTIGYVVAMHVGGVVIPE 120
           EVSSKDQGFTAANAAYNGARFLGLLQDEASGTFPCSYRGPMFMTIGYVVAMHVGGVVIPE
Sbjct: 61  EVSSKDQGFTAANAAYNGARFLGLLQDEASGTFPCSYRGPMFMTIGYVVAMHVGGVVIPE 120

Query: 121 PQRRELVRYVVNTAHPVDGGWGLHSEDKSTVMGTALNYVLLRLLGMEREHIVMQRARKTL 180
           PQRRELVRYVVNTAHPVDGGWGLHSEDKSTVMGTALNYVLLRLLGMEREHIVMQRARKTL
Sbjct: 121 PQRRELVRYVVNTAHPVDGGWGLHSEDKSTVMGTALNYVLLRLLGMEREHIVMQRARKTL 180

Query: 181 LRMGGAIGSPYWGKVWLSVLNLYKWEGVNPAPPELWLLPYQFPYHPARWWVHTRAIFLPM 240
           LRMGGAIGSPYWGKVWLSVLNLYKWEGVNPAPPELWLLPYQFPYHPARWWVHTRAIFLPM
Sbjct: 181 LRMGGAIGSPYWGKVWLSVLNLYKWEGVNPAPPELWLLPYQFPYHPARWWVHTRAIFLPM 240

Query: 241 SYLAGVRYQCALTPLLEEIRSEIFTRPFEEIDFAANRNNVCGIDLYYPHTTVLNTLNKCI 300
           SYLAGVRYQCALTPLLEEIRSEIFTRPFEEIDFAANRNNVCGIDLYYPHTTVLNTLNKCI
Sbjct: 241 SYLAGVRYQCALTPLLEEIRSEIFTRPFEEIDFAANRNNVCGIDLYYPHTTVLNTLNKCI 300

Query: 301 VGYEKYLRPNWLLKYSLNRIYELIKMEIQNTDYLCIAPVNNALNAIVTCIEEGPDSAEFG 360
           VGYEKYLRPNWLLKYSLNRIYELIKMEIQNTDYLCIAPVNNALNAIVTCIEEGPDSAEFG
Sbjct: 301 VGYEKYLRPNWLLKYSLNRIYELIKMEIQNTDYLCIAPVNNALNAIVTCIEEGPDSAEFG 360

Query: 361 RFLDRFKEVLFLGPQGMLVMGTNGVQVWDCAFYIQSMFAANLQDKPEFYENIVRAYRFLC 420
           RFLDRFKEVLFLGPQGMLVMGTNGVQVWDCAFYIQSMFAANLQDKPEFYENIVRAYRFLC
Sbjct: 361 RFLDRFKEVLFLGPQGMLVMGTNGVQVWDCAFYIQSMFAANLQDKPEFYENIVRAYRFLC 420

Query: 421 RSQITDDCVPGSYRDPRIGAWPFSTKTQGYAVSDCTAEAAKSVLLVRNSPVFKEVRDEIS 480
           RSQITDDCVPGSYRDPRIGAWPFSTKTQGYAVSDCTAEAAKSVLLVRNSPVFKEVRDEIS
Sbjct: 421 RSQITDDCVPGSYRDPRIGAWPFSTKTQGYAVSDCTAEAAKSVLLVRNSPVFKEVRDEIS 480

Query: 481 SEKLQKAIDALLGLQNLGSFKYGSFASYEKIRAPLSIESLNSAEVFANIMVEHPYVECTD 540
           SEKLQKAIDALLGLQNLGSFKYGSFASYEKIRAPLSIESLNSAEVFANIMVEHPYVECTD
Sbjct: 481 SEKLQKAIDALLGLQNLGSFKYGSFASYEKIRAPLSIESLNSAEVFANIMVEHPYVECTD 540

Query: 541 SSVLGLSFYRKYHDYRQDEVDHAIKIAVKFIKSAQEKDGSWYGCWGICYTYAGMFALEAL 600
           SSVLGLSFYRKYHDYRQDEVDHAIKIAVKFIKSAQEKDGSWYGCWGICYTYAGMFALEAL
Sbjct: 541 SSVLGLSFYRKYHDYRQDEVDHAIKIAVKFIKSAQEKDGSWYGCWGICYTYAGMFALEAL 600

Query: 601 HNAGESYADSEVVKKGCEFLVSKQLPDGGWSETMKSSELHTYVSDKRSYVVQTAWALIGL 660
           HNAGESYADSEVVKKGCEFLVSKQLPDGGWSETMKSSELHTYVSDKRSYVVQTAWALIGL
Sbjct: 601 HNAGESYADSEVVKKGCEFLVSKQLPDGGWSETMKSSELHTYVSDKRSYVVQTAWALIGL 660

Query: 661 LLADYPDRKVIDRGIQLLKERQLPSGEWKYESIEGVFNHSCAIEYPSYRFVFPIKALGIY 720
           LLADYPDRKVIDRGIQLLKERQLPSGEWKYESIEGVFNHSCAIEYPSYRFVFPIKALGIY
Sbjct: 661 LLADYPDRKVIDRGIQLLKERQLPSGEWKYESIEGVFNHSCAIEYPSYRFVFPIKALGIY 720

Query: 721 SKKYAKDAL 729
           SKKYAKDAL
Sbjct: 721 SKKYAKDAL 729

>KLLA0B10175g Chr2 (889538..891733) [2196 bp, 731 aa] {ON} highly
           similar to uniprot|P38604 Saccharomyces cerevisiae
           YHR072W ERG7 Lanosterol synthase an essential enzyme
           that catalyzes the cyclization of squalene 2 3- epoxide
           a step in ergosterol biosynthesis
          Length = 731

 Score = 1101 bits (2847), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 501/728 (68%), Positives = 602/728 (82%)

Query: 2   LYSDELGLPTTDSRRWRLFCDEVGAERWEYMDEQETSKVPQTTCVQWLLNVPSFPTPEPE 61
           LYS+ +GLP TD +RWRL  D++G + WEY+ E ++ KVPQ+T  +WLL    FP P PE
Sbjct: 4   LYSETIGLPRTDPKRWRLITDDLGRQTWEYLSENDSKKVPQSTFARWLLKCEDFPEPHPE 63

Query: 62  VSSKDQGFTAANAAYNGARFLGLLQDEASGTFPCSYRGPMFMTIGYVVAMHVGGVVIPEP 121
           ++SK  GFTA NAA+NGA+F  LLQD  SGTFPC Y+GPMFMTIGYVV M++  + IPE 
Sbjct: 64  INSKTSGFTAWNAAHNGAKFFELLQDPDSGTFPCQYKGPMFMTIGYVVTMYIAKIEIPEH 123

Query: 122 QRRELVRYVVNTAHPVDGGWGLHSEDKSTVMGTALNYVLLRLLGMEREHIVMQRARKTLL 181
           ++ E++RYV N AHPVDGGWGLH  DKSTV+GT LNYV++RLLG+ ++H V  RAR TLL
Sbjct: 124 EKAEMIRYVANYAHPVDGGWGLHHVDKSTVLGTVLNYVMMRLLGLPKDHEVCVRARDTLL 183

Query: 182 RMGGAIGSPYWGKVWLSVLNLYKWEGVNPAPPELWLLPYQFPYHPARWWVHTRAIFLPMS 241
           R+GGAI SP+W K+WLS+LNLYKWEGVNPAPPELW+LPY    HPARWWVHTR I+LP+S
Sbjct: 184 RLGGAIASPHWAKIWLSILNLYKWEGVNPAPPELWMLPYGLNIHPARWWVHTRGIYLPVS 243

Query: 242 YLAGVRYQCALTPLLEEIRSEIFTRPFEEIDFAANRNNVCGIDLYYPHTTVLNTLNKCIV 301
           YL+  +Y C L PLLEEIR+EI+T+PFE IDF  +RN VCG+DLYYPHT VL+T+N  I 
Sbjct: 244 YLSSTQYSCELDPLLEEIRTEIYTQPFETIDFKKHRNTVCGVDLYYPHTKVLDTMNYFIS 303

Query: 302 GYEKYLRPNWLLKYSLNRIYELIKMEIQNTDYLCIAPVNNALNAIVTCIEEGPDSAEFGR 361
            YE+Y+RPNWLLK S NR+YEL+K EI NTDYLCIAPVNNA  AIVT IEEG DS EFGR
Sbjct: 304 KYERYVRPNWLLKKSTNRVYELVKKEIANTDYLCIAPVNNAFCAIVTLIEEGKDSEEFGR 363

Query: 362 FLDRFKEVLFLGPQGMLVMGTNGVQVWDCAFYIQSMFAANLQDKPEFYENIVRAYRFLCR 421
           FL RFK+VLF GPQG+ VMGTNGVQVWDCAFYIQ MF A L + PEF+E IVR+++FLCR
Sbjct: 364 FLYRFKDVLFHGPQGLTVMGTNGVQVWDCAFYIQYMFMAGLAELPEFHETIVRSFKFLCR 423

Query: 422 SQITDDCVPGSYRDPRIGAWPFSTKTQGYAVSDCTAEAAKSVLLVRNSPVFKEVRDEISS 481
           SQ T+DCV GS+RD R+GAWPFSTKTQGY VSDCTAEA K++++V NS  +++V     +
Sbjct: 424 SQFTEDCVEGSFRDKRLGAWPFSTKTQGYTVSDCTAEAIKAIIMVLNSDKYRDVWGVYDT 483

Query: 482 EKLQKAIDALLGLQNLGSFKYGSFASYEKIRAPLSIESLNSAEVFANIMVEHPYVECTDS 541
           EKL+  ID LLGLQNL SF+YGSFA+YEKI+APL +E LN AEVF NIMVE PYVECTDS
Sbjct: 484 EKLKNGIDVLLGLQNLSSFEYGSFATYEKIKAPLLMEKLNPAEVFGNIMVEFPYVECTDS 543

Query: 542 SVLGLSFYRKYHDYRQDEVDHAIKIAVKFIKSAQEKDGSWYGCWGICYTYAGMFALEALH 601
           SVLGL+++R+Y +YR+ ++DHAI  A+ +IK +Q+ +GSWYGCWGICYTYAGMFALEAL+
Sbjct: 544 SVLGLTYFRRYFNYRKKDIDHAIDSAIAYIKKSQQPNGSWYGCWGICYTYAGMFALEALN 603

Query: 602 NAGESYADSEVVKKGCEFLVSKQLPDGGWSETMKSSELHTYVSDKRSYVVQTAWALIGLL 661
             GE+Y +SEVV+KGC+F V+KQLPDGGWSE MKSSELHTYVSDK SYVVQTAW LIGL+
Sbjct: 604 TIGETYENSEVVRKGCDFFVTKQLPDGGWSEKMKSSELHTYVSDKESYVVQTAWVLIGLI 663

Query: 662 LADYPDRKVIDRGIQLLKERQLPSGEWKYESIEGVFNHSCAIEYPSYRFVFPIKALGIYS 721
           LA +PD+ VIDR I LLK+RQ PSGEWKYE++EGVFNHSCAIEYPSYRF+FPIKALG+Y 
Sbjct: 664 LAKFPDKSVIDRAINLLKQRQQPSGEWKYEAVEGVFNHSCAIEYPSYRFLFPIKALGLYV 723

Query: 722 KKYAKDAL 729
           K+Y   A+
Sbjct: 724 KEYGHSAI 731

>SAKL0G08844g Chr7 complement(757226..759466) [2241 bp, 746 aa] {ON}
           highly similar to uniprot|P38604 Saccharomyces
           cerevisiae YHR072W ERG7 Lanosterol synthase an essential
           enzyme that catalyzes the cyclization of squalene 2 3-
           epoxide a step in ergosterol biosynthesis
          Length = 746

 Score = 1077 bits (2786), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 491/728 (67%), Positives = 604/728 (82%), Gaps = 1/728 (0%)

Query: 2   LYSDELGLPTTDSRRWRLFCDEVGAERWEYMDEQETSKVPQTTCVQWLLNVPSFPTPEPE 61
           LYSD+LGLP TD  RWRL  DE+G E WEY+  ++ +K PQ++ V++LL +P FP P+PE
Sbjct: 20  LYSDQLGLPKTDPTRWRLHTDELGRETWEYLSTEQAAKEPQSSYVKYLLQLPDFPAPKPE 79

Query: 62  VSSKDQGFTAANAAYNGARFLGLLQDEASGTFPCSYRGPMFMTIGYVVAMHVGGVVIPEP 121
            +S+D  FTA +AAYNGA+FL LLQ+E SG FPC Y+GPMF+TIGYV   +  G+ IPE 
Sbjct: 80  RTSEDPEFTAYDAAYNGAQFLQLLQEE-SGIFPCQYKGPMFITIGYVATCYAAGIEIPEH 138

Query: 122 QRRELVRYVVNTAHPVDGGWGLHSEDKSTVMGTALNYVLLRLLGMEREHIVMQRARKTLL 181
           +R E+VRY+VN AHPVDGGWGLHSEDKST  GT++NYV+LRLLG+  +HIV +RAR TLL
Sbjct: 139 ERHEIVRYIVNMAHPVDGGWGLHSEDKSTAFGTSINYVILRLLGLPSDHIVCRRARSTLL 198

Query: 182 RMGGAIGSPYWGKVWLSVLNLYKWEGVNPAPPELWLLPYQFPYHPARWWVHTRAIFLPMS 241
           ++GGAIG+P+WGK+WLS+LNLY WEGVNPAPPELWLLPY  P HP RWWVHTRA+++P+ 
Sbjct: 199 KLGGAIGAPHWGKIWLSILNLYGWEGVNPAPPELWLLPYALPIHPGRWWVHTRAVYMPVG 258

Query: 242 YLAGVRYQCALTPLLEEIRSEIFTRPFEEIDFAANRNNVCGIDLYYPHTTVLNTLNKCIV 301
           YL+  ++ C LTPLL+EIR+EI+T+ ++ IDF+ +RN VCGIDLYYPHT +L+  N  +V
Sbjct: 259 YLSAKKFCCELTPLLKEIRTEIYTKEYDTIDFSKHRNTVCGIDLYYPHTKLLDVANWGMV 318

Query: 302 GYEKYLRPNWLLKYSLNRIYELIKMEIQNTDYLCIAPVNNALNAIVTCIEEGPDSAEFGR 361
            YEKYLRPNW L Y+  ++YELIK EI NTDYLCIAPVN A  A+VT IEEG DS EF R
Sbjct: 319 FYEKYLRPNWFLNYTNKKVYELIKKEITNTDYLCIAPVNMAFCAVVTLIEEGVDSHEFNR 378

Query: 362 FLDRFKEVLFLGPQGMLVMGTNGVQVWDCAFYIQSMFAANLQDKPEFYENIVRAYRFLCR 421
           F DRFK+VLF GPQGM +MGTNGVQVWDCAF +Q +F A L + PEF   IV+AY+FLCR
Sbjct: 379 FRDRFKDVLFHGPQGMTLMGTNGVQVWDCAFAVQYLFLAELAELPEFRGIIVKAYKFLCR 438

Query: 422 SQITDDCVPGSYRDPRIGAWPFSTKTQGYAVSDCTAEAAKSVLLVRNSPVFKEVRDEISS 481
           SQ   +C PGS+RD R+G WPFSTKTQGY VSDCTAEA K++++VRNSP F E R+EIS 
Sbjct: 439 SQFDTECEPGSFRDKRVGGWPFSTKTQGYTVSDCTAEAVKAIIMVRNSPAFVEYRNEISD 498

Query: 482 EKLQKAIDALLGLQNLGSFKYGSFASYEKIRAPLSIESLNSAEVFANIMVEHPYVECTDS 541
           E+L KA+D LL LQN+GSF+YGSFASYEKI+A   IE LN AEVF NIMVE PYVECTDS
Sbjct: 499 ERLYKAMDILLNLQNVGSFEYGSFASYEKIKASTLIEKLNPAEVFGNIMVEFPYVECTDS 558

Query: 542 SVLGLSFYRKYHDYRQDEVDHAIKIAVKFIKSAQEKDGSWYGCWGICYTYAGMFALEALH 601
           SVLGL+++ K++DYR+D++ HAIKIA+ +IK +Q K+GSWYG WG+C+TYAGMFALEAL+
Sbjct: 559 SVLGLTYFHKHYDYRKDDIAHAIKIAIDYIKRSQAKNGSWYGSWGVCFTYAGMFALEALY 618

Query: 602 NAGESYADSEVVKKGCEFLVSKQLPDGGWSETMKSSELHTYVSDKRSYVVQTAWALIGLL 661
             GE+Y +SEVV+KGC+FLVS+Q+ DGGW E+ KSSELH YVS ++S VVQTAW++IGLL
Sbjct: 619 TVGENYENSEVVRKGCDFLVSRQMEDGGWGESPKSSELHNYVSSEQSLVVQTAWSVIGLL 678

Query: 662 LADYPDRKVIDRGIQLLKERQLPSGEWKYESIEGVFNHSCAIEYPSYRFVFPIKALGIYS 721
           LA+YPD+KVIDRGIQLLK RQLPSGEWK+ESIEGVFNHSC IEYPSY+F+FPIKALG+Y+
Sbjct: 679 LAEYPDKKVIDRGIQLLKSRQLPSGEWKFESIEGVFNHSCMIEYPSYKFLFPIKALGLYA 738

Query: 722 KKYAKDAL 729
           K+Y  DA+
Sbjct: 739 KRYGNDAI 746

>Kwal_34.15979 s34 complement(142874..145060) [2187 bp, 728 aa] {ON}
           YHR072W (ERG7) - 2,3-oxidosqualene-lanosterol cyclase
           [contig 272] FULL
          Length = 728

 Score = 1073 bits (2774), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 485/724 (66%), Positives = 599/724 (82%), Gaps = 1/724 (0%)

Query: 1   MLYSDELGLPTTDSRRWRLFCDEVGAERWEYMDEQETSKVPQTTCVQWLLNVPSFPTPEP 60
           MLYS+ELGLP TDS+RWRL  D +G+E+WEY+ E E  + PQ+  V++LL +P F  P+P
Sbjct: 1   MLYSEELGLPKTDSKRWRLKTDALGSEKWEYLSEIEAKQQPQSAYVKYLLQLPDFEAPKP 60

Query: 61  EVSSKDQGFTAANAAYNGARFLGLLQDEASGTFPCSYRGPMFMTIGYVVAMHVGGVVIPE 120
            V+     FTA +AA+NGA+F  LLQ++ SG FPC Y+GPMFMTIGYV A++   V IP 
Sbjct: 61  AVNKNSAHFTAKDAAFNGAQFFSLLQED-SGIFPCQYKGPMFMTIGYVAALYCAEVPIPT 119

Query: 121 PQRRELVRYVVNTAHPVDGGWGLHSEDKSTVMGTALNYVLLRLLGMEREHIVMQRARKTL 180
           P ++E++RY+VN++HPVDGGWGLH  DKST  GT +NYV+LRLLG++ ++IV QRAR+TL
Sbjct: 120 PVKQEIIRYIVNSSHPVDGGWGLHEVDKSTTFGTVINYVILRLLGLKPDNIVCQRARRTL 179

Query: 181 LRMGGAIGSPYWGKVWLSVLNLYKWEGVNPAPPELWLLPYQFPYHPARWWVHTRAIFLPM 240
            R+GGA+G+P+WGK WLS+LNLYKWEGVNPAPPELWLLPY  P HP RWWVHTRAI+  +
Sbjct: 180 HRLGGAVGAPHWGKAWLSILNLYKWEGVNPAPPELWLLPYALPIHPGRWWVHTRAIYQAL 239

Query: 241 SYLAGVRYQCALTPLLEEIRSEIFTRPFEEIDFAANRNNVCGIDLYYPHTTVLNTLNKCI 300
            YL+  +Y C +TPLLEEIR+EI+T+PFE IDF+  +NNVCG+DLYYPHT +LN  N  +
Sbjct: 240 GYLSAAKYSCPVTPLLEEIRNEIYTQPFESIDFSKQKNNVCGVDLYYPHTRLLNIANASM 299

Query: 301 VGYEKYLRPNWLLKYSLNRIYELIKMEIQNTDYLCIAPVNNALNAIVTCIEEGPDSAEFG 360
           + YEKYL+P+W LKYS  ++YELIK EI+NTDYLCIAPV+ A  AIVT IEEG DS EF 
Sbjct: 300 IFYEKYLKPDWFLKYSNRKVYELIKKEIKNTDYLCIAPVSMAFCAIVTLIEEGRDSYEFK 359

Query: 361 RFLDRFKEVLFLGPQGMLVMGTNGVQVWDCAFYIQSMFAANLQDKPEFYENIVRAYRFLC 420
           RFL+RF++VLFLGPQGM VMGTNGVQVWDCAF IQ  F A L + PEF+E I +AY+FLC
Sbjct: 360 RFLERFEDVLFLGPQGMTVMGTNGVQVWDCAFAIQYYFVAGLAELPEFHETIEKAYKFLC 419

Query: 421 RSQITDDCVPGSYRDPRIGAWPFSTKTQGYAVSDCTAEAAKSVLLVRNSPVFKEVRDEIS 480
           RSQ   +C PGS+RD RIGAWPFSTKTQGY VSDCTAE+ K++++VRNSP F  +RDEIS
Sbjct: 420 RSQFDTECEPGSFRDKRIGAWPFSTKTQGYTVSDCTAESVKAIIMVRNSPSFANLRDEIS 479

Query: 481 SEKLQKAIDALLGLQNLGSFKYGSFASYEKIRAPLSIESLNSAEVFANIMVEHPYVECTD 540
            E+L KA+D LL LQN GSF+YGSFA+YEKI+A   +E LN AEVF NIMVE PYVECTD
Sbjct: 480 DERLYKAMDVLLALQNTGSFEYGSFATYEKIKATTKLEKLNPAEVFGNIMVEFPYVECTD 539

Query: 541 SSVLGLSFYRKYHDYRQDEVDHAIKIAVKFIKSAQEKDGSWYGCWGICYTYAGMFALEAL 600
           SSVLGL+++ K++ YRQ+E+  AI+IA+++IK+AQ+ DGSWYGCWGIC+TYAGMFALEAL
Sbjct: 540 SSVLGLTYFSKHYTYRQEEIKKAIEIAIQYIKNAQKPDGSWYGCWGICFTYAGMFALEAL 599

Query: 601 HNAGESYADSEVVKKGCEFLVSKQLPDGGWSETMKSSELHTYVSDKRSYVVQTAWALIGL 660
           H   E+Y +SEVV+KGC+FLVSKQ PDGGWSE+MKSSELH+YV    S  VQTAWALIGL
Sbjct: 600 HTVDETYENSEVVQKGCDFLVSKQRPDGGWSESMKSSELHSYVESANSQAVQTAWALIGL 659

Query: 661 LLADYPDRKVIDRGIQLLKERQLPSGEWKYESIEGVFNHSCAIEYPSYRFVFPIKALGIY 720
           LLA+YP++++ID+GI LLK+RQL SGEWK+E +EGVFNHSCAIEYPSY+F+FPIKALG+Y
Sbjct: 660 LLAEYPNKEIIDKGINLLKKRQLESGEWKFEEVEGVFNHSCAIEYPSYKFLFPIKALGLY 719

Query: 721 SKKY 724
           +KKY
Sbjct: 720 AKKY 723

>Ecym_8182 Chr8 complement(379402..381600) [2199 bp, 732 aa] {ON}
           similar to Ashbya gossypii AGR351W
          Length = 732

 Score = 1065 bits (2755), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 483/729 (66%), Positives = 595/729 (81%), Gaps = 1/729 (0%)

Query: 2   LYSDELGLPTTDSRRWRLFCDEVGAERWEYMDEQETSKVPQTTCVQWLLNVPSFPTPEPE 61
           LYSD LGLP+TD  RWRL C  +G   W+Y+ E ++ K+PQ  C +WLLN  +F TPEP+
Sbjct: 4   LYSDYLGLPSTDPSRWRLNCTSLGETSWKYISEADSKKIPQCNCTKWLLNADNFSTPEPD 63

Query: 62  VSSKDQGFTAANAAYNGARFLGLLQDEASGTFPCSYRGPMFMTIGYVVAMHVGGVVIPEP 121
           V + D  F A NAAYNGA FL LLQ++ SGTFP  Y+GPMFMTI YV +M+VG   IPE 
Sbjct: 64  VGNGDANFKAYNAAYNGASFLKLLQNQDSGTFPNQYKGPMFMTICYVGSMYVGRKEIPEC 123

Query: 122 QRRELVRYVVNTAHPVDGGWGLHSEDKSTVMGTALNYVLLRLLGMEREHIVMQRARKTLL 181
           ++ E++RY+VNTAHPVDGGWGLH+  KSTV GT LNY++LRLLGM ++H+V +RAR TL 
Sbjct: 124 EKIEIIRYIVNTAHPVDGGWGLHTTGKSTVFGTVLNYIVLRLLGMSKDHVVCRRARSTLH 183

Query: 182 RMGGAIGSPYWGKVWLSVLNLYKWEGVNPAPPELWLLPYQFPYHPARWWVHTRAIFLPMS 241
           R+GGAIG+P+WGK+WLS+LNLYKWEGVNPAP E W LPY  P HPARWW+HTRAI+LPMS
Sbjct: 184 RLGGAIGAPHWGKIWLSILNLYKWEGVNPAPAEFWTLPYIVPIHPARWWIHTRAIYLPMS 243

Query: 242 YLAGVRYQCALTPLLEEIRSEIFTRPFEEIDFAANRNNVCGIDLYYPHTTVLNTLNKCIV 301
           YL G+ Y C LTPLL+EIR+EI+T  F+EI F+ +RN VC +DLY+PH+T+LN +N  IV
Sbjct: 244 YLCGISYACELTPLLQEIRNEIYTTNFDEIQFSKHRNTVCQVDLYFPHSTILNVINSAIV 303

Query: 302 GYEKYLRPNWLLKYSLNRIYELIKMEIQNTDYLCIAPVNNALNAIVTCIEEGPDSAEFGR 361
            Y+ YLRP+WL+KYS  ++YELI+ EI NT+YLC+APV+ A  +IVTCIEEG DS EF R
Sbjct: 304 WYQNYLRPDWLVKYSNKKVYELIRKEIVNTEYLCVAPVSAAFCSIVTCIEEGADSPEFER 363

Query: 362 FLDRFKEVLFLGPQGMLVMGTNGVQVWDCAFYIQSMFAANLQDKPEFYENIVRAYRFLCR 421
            ++ F   +F GPQGM VMGTNG QVWDC+F++Q +F ANL + PEF + +  AY+FLCR
Sbjct: 364 LMEAFAGNVFHGPQGMTVMGTNGSQVWDCSFFVQYLFMANLAELPEFQDAVTNAYKFLCR 423

Query: 422 SQITDDCVPGSYRDPRIGAWPFSTKTQGYAVSDCTAEAAKSVLLVRNSPVFKEVRDEISS 481
           SQ T +CV GSYRD R+G WPFSTKTQGY VSDCTAEA K+V++V+ SPVF  + DEIS 
Sbjct: 424 SQFTHECVSGSYRDKRVGGWPFSTKTQGYTVSDCTAEALKAVIMVKRSPVFAAIHDEISE 483

Query: 482 EKLQKAIDALLGLQNLGSFKYGSFASYEKIRAPLSIESLNSAEVFANIMVEHPYVECTDS 541
           E LQKAID LL LQN+GS +YGSFA+YEKIRAPL +E LN AEVF NIMVE+PYVECTDS
Sbjct: 484 EALQKAIDVLLSLQNVGSIEYGSFATYEKIRAPLIMEKLNPAEVFENIMVEYPYVECTDS 543

Query: 542 SVLGLSFYRKYHDYRQDEVDHAIKIAVKFIKSAQEKDGSWYGCWGICYTYAGMFALEALH 601
            +LGL+++ +Y+DYR+D++DH++KIA  +IK  Q KDGSWYGCWGICYTYAGMFALEAL+
Sbjct: 544 CILGLTYFSEYYDYRKDDIDHSVKIAADYIKKVQGKDGSWYGCWGICYTYAGMFALEALY 603

Query: 602 NAGESYADSEVVKKGCEFLVSKQLPDGGWSETMKSSELHTYVS-DKRSYVVQTAWALIGL 660
             GE+Y +SEVV++GC+FLV KQL DGGWSE++KS+EL  Y++ DK S VV T+WALIGL
Sbjct: 604 TIGENYENSEVVRRGCDFLVKKQLSDGGWSESIKSAELMCYINDDKGSLVVPTSWALIGL 663

Query: 661 LLADYPDRKVIDRGIQLLKERQLPSGEWKYESIEGVFNHSCAIEYPSYRFVFPIKALGIY 720
           LLADYPD++VIDRGIQLLK RQL SGEWK+E IEG+FNHSCAIEYP+YRF+FPIKALGIY
Sbjct: 664 LLADYPDKEVIDRGIQLLKSRQLRSGEWKFEQIEGIFNHSCAIEYPTYRFLFPIKALGIY 723

Query: 721 SKKYAKDAL 729
           +KKY K A+
Sbjct: 724 AKKYGKRAI 732

>Kpol_339.12 s339 (18976..21177) [2202 bp, 733 aa] {ON}
           (18976..21177) [2202 nt, 734 aa]
          Length = 733

 Score = 1065 bits (2754), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 484/730 (66%), Positives = 592/730 (81%), Gaps = 2/730 (0%)

Query: 2   LYSDELGLPTTDSRRWRLFCDEVGAERWEYMDEQETSKVPQTTCVQWLLNVPSFPTPEP- 60
            YS+E+GL  TD + WRL  D++G E WEY+  ++  K PQ++  QWLL VP FPTP P 
Sbjct: 4   FYSEEIGLEKTDPKLWRLRTDKLGRESWEYLTPEDADKDPQSSYTQWLLQVPEFPTPSPL 63

Query: 61  -EVSSKDQGFTAANAAYNGARFLGLLQDEASGTFPCSYRGPMFMTIGYVVAMHVGGVVIP 119
              S+K++ +TA +A +NGA F  LLQDE SG FPC Y+GPMFMTIGY+   ++ GV IP
Sbjct: 64  KNSSNKNENYTAYDACHNGASFFKLLQDENSGIFPCQYKGPMFMTIGYIAVNYIAGVKIP 123

Query: 120 EPQRRELVRYVVNTAHPVDGGWGLHSEDKSTVMGTALNYVLLRLLGMEREHIVMQRARKT 179
           + +R EL+RY+VNTAHPVDGGWGLHS DKSTV GT LNYV LRLLG+ ++H V  +AR T
Sbjct: 124 DHERIELIRYIVNTAHPVDGGWGLHSVDKSTVFGTVLNYVNLRLLGLSKDHPVCVKARDT 183

Query: 180 LLRMGGAIGSPYWGKVWLSVLNLYKWEGVNPAPPELWLLPYQFPYHPARWWVHTRAIFLP 239
           L+++GGAIG+P+WGK WLS LNLYKWEGVNPAPPE WLLPY    HP RWWVHTR ++LP
Sbjct: 184 LIKLGGAIGAPHWGKTWLSTLNLYKWEGVNPAPPETWLLPYSLSIHPGRWWVHTRGVYLP 243

Query: 240 MSYLAGVRYQCALTPLLEEIRSEIFTRPFEEIDFAANRNNVCGIDLYYPHTTVLNTLNKC 299
           +SYL+ VRY C LTPLL E+R EI+T+PF+ IDF+ +RN VCG+DLYYPH+ VL+  N C
Sbjct: 244 ISYLSLVRYSCELTPLLAELREEIYTKPFDSIDFSRHRNTVCGVDLYYPHSKVLDVANDC 303

Query: 300 IVGYEKYLRPNWLLKYSLNRIYELIKMEIQNTDYLCIAPVNNALNAIVTCIEEGPDSAEF 359
           IV YEKYLRP W+   S   +Y+LIK EI+NTDYLCIAPVN A  A+VT IEEG DS  F
Sbjct: 304 IVFYEKYLRPQWVHDKSKETVYDLIKKEIENTDYLCIAPVNQAFCALVTLIEEGRDSQAF 363

Query: 360 GRFLDRFKEVLFLGPQGMLVMGTNGVQVWDCAFYIQSMFAANLQDKPEFYENIVRAYRFL 419
            RF  RFK+ LF GPQGM VMGTNGVQVWDCAF IQ  F A L +KPEFY+ IVRAY FL
Sbjct: 364 KRFEFRFKDALFHGPQGMTVMGTNGVQVWDCAFAIQYFFVAGLAEKPEFYDTIVRAYEFL 423

Query: 420 CRSQITDDCVPGSYRDPRIGAWPFSTKTQGYAVSDCTAEAAKSVLLVRNSPVFKEVRDEI 479
           CRSQ   +CVPGS+RD R+GAW FSTKTQGY VSDCTAEA K++++VRNS VF+ V D+I
Sbjct: 424 CRSQFDTECVPGSFRDKRVGAWGFSTKTQGYTVSDCTAEAIKAIIMVRNSDVFRAVHDKI 483

Query: 480 SSEKLQKAIDALLGLQNLGSFKYGSFASYEKIRAPLSIESLNSAEVFANIMVEHPYVECT 539
           S E+L K ID L+ LQNLGSF+YGSFA+YEKI+APL +E+LN AEVF NIMVE+PYVECT
Sbjct: 484 SDERLNKGIDVLMSLQNLGSFEYGSFATYEKIKAPLFMEALNPAEVFGNIMVEYPYVECT 543

Query: 540 DSSVLGLSFYRKYHDYRQDEVDHAIKIAVKFIKSAQEKDGSWYGCWGICYTYAGMFALEA 599
           DSSVLGL+F+ K+  YR++E+ + IK+A+ +IKS Q++DGSWYGCWGIC+TYAGMFA+EA
Sbjct: 544 DSSVLGLTFFHKHSSYRKEEIANRIKLAIDYIKSCQQEDGSWYGCWGICFTYAGMFAMEA 603

Query: 600 LHNAGESYADSEVVKKGCEFLVSKQLPDGGWSETMKSSELHTYVSDKRSYVVQTAWALIG 659
           L+  GE+Y++SE V+KGC+FLVSKQ+ DGGW E+MKSSELH+YV  ++S VVQTAW L+ 
Sbjct: 604 LYTVGENYSNSETVRKGCDFLVSKQMEDGGWGESMKSSELHSYVDSEKSLVVQTAWVLVA 663

Query: 660 LLLADYPDRKVIDRGIQLLKERQLPSGEWKYESIEGVFNHSCAIEYPSYRFVFPIKALGI 719
           LLLA+YPD+ VIDRGIQLLK+RQLPSGEWK+ES+EGVFNHSCAIEYPSYRF+FPIKALG+
Sbjct: 664 LLLAEYPDKDVIDRGIQLLKDRQLPSGEWKFESVEGVFNHSCAIEYPSYRFLFPIKALGL 723

Query: 720 YSKKYAKDAL 729
           Y+K Y+ + +
Sbjct: 724 YTKAYSDNGI 733

>KLTH0H14850g Chr8 (1287375..1289555) [2181 bp, 726 aa] {ON} highly
           similar to uniprot|P38604 Saccharomyces cerevisiae
           YHR072W ERG7 Lanosterol synthase an essential enzyme
           that catalyzes the cyclization of squalene 2 3- epoxide
           a step in ergosterol biosynthesis
          Length = 726

 Score = 1052 bits (2721), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 481/723 (66%), Positives = 587/723 (81%), Gaps = 1/723 (0%)

Query: 2   LYSDELGLPTTDSRRWRLFCDEVGAERWEYMDEQETSKVPQTTCVQWLLNVPSFPTPEPE 61
           LY+DELGLPTTD   WRL  DE+G+E+WEY+ E+E    PQ++ V++LL  P F  PEP 
Sbjct: 3   LYADELGLPTTDKTLWRLRTDELGSEKWEYLSEEEAKADPQSSYVKYLLQNPDFEAPEPL 62

Query: 62  VSSKDQGFTAANAAYNGARFLGLLQDEASGTFPCSYRGPMFMTIGYVVAMHVGGVVIPEP 121
            SSK   FTA +AA+NGA+F  LLQ++ +G FPC Y+GPMF+TIGYV  ++   + +PE 
Sbjct: 63  RSSKCDEFTAGDAAFNGAQFFSLLQED-TGIFPCQYKGPMFLTIGYVATLYCARIPVPEH 121

Query: 122 QRRELVRYVVNTAHPVDGGWGLHSEDKSTVMGTALNYVLLRLLGMEREHIVMQRARKTLL 181
            + E++RY+VN+AHPVDGGWGLH  DKST  GTA+NYV+LRLLG+E +HIV QRARKTL 
Sbjct: 122 IKIEIIRYIVNSAHPVDGGWGLHEVDKSTTFGTAINYVILRLLGLEADHIVCQRARKTLH 181

Query: 182 RMGGAIGSPYWGKVWLSVLNLYKWEGVNPAPPELWLLPYQFPYHPARWWVHTRAIFLPMS 241
           R+GGAIG+P+WGK WLS+LNLY+WEGVNPAPPELWLLPY  P HP RWWVHTRA++  + 
Sbjct: 182 RLGGAIGAPHWGKAWLSILNLYRWEGVNPAPPELWLLPYALPIHPGRWWVHTRAVYQALG 241

Query: 242 YLAGVRYQCALTPLLEEIRSEIFTRPFEEIDFAANRNNVCGIDLYYPHTTVLNTLNKCIV 301
           YL+  +Y C LTPLL+EIR EI+ +PFE IDF+ ++N V G+DLYYPHT +LN  N  + 
Sbjct: 242 YLSAAKYCCELTPLLQEIRKEIYVKPFESIDFSKHKNTVGGVDLYYPHTKLLNIANVALT 301

Query: 302 GYEKYLRPNWLLKYSLNRIYELIKMEIQNTDYLCIAPVNNALNAIVTCIEEGPDSAEFGR 361
            YE YL+PNW LKYS  ++YELIK EI+NTDYLCIAPV+ A  A+VT IEEG DS EF R
Sbjct: 302 LYENYLKPNWFLKYSNRKVYELIKKEIKNTDYLCIAPVSMAFCAVVTLIEEGRDSYEFKR 361

Query: 362 FLDRFKEVLFLGPQGMLVMGTNGVQVWDCAFYIQSMFAANLQDKPEFYENIVRAYRFLCR 421
           F+D F+EVLF+GPQGM VMGTNGVQVWDCAF IQ  F A L + PEF + I +AY+FLCR
Sbjct: 362 FVDGFQEVLFMGPQGMTVMGTNGVQVWDCAFAIQYYFVAGLAELPEFRDTIEKAYKFLCR 421

Query: 422 SQITDDCVPGSYRDPRIGAWPFSTKTQGYAVSDCTAEAAKSVLLVRNSPVFKEVRDEISS 481
           SQ   +C PGS+RD R+GAWPFSTKTQGY VSDCTAEA K++++VRNSP F  +R EIS 
Sbjct: 422 SQFDTECEPGSFRDKRVGAWPFSTKTQGYTVSDCTAEAVKAIIMVRNSPKFTYLRGEISD 481

Query: 482 EKLQKAIDALLGLQNLGSFKYGSFASYEKIRAPLSIESLNSAEVFANIMVEHPYVECTDS 541
           E+L KA+D LLGLQN GSF+YGSFA+YEKI+A  ++E LN AEVF NIMVE PYVECTDS
Sbjct: 482 ERLYKAVDILLGLQNTGSFEYGSFATYEKIKATTALEKLNPAEVFGNIMVEFPYVECTDS 541

Query: 542 SVLGLSFYRKYHDYRQDEVDHAIKIAVKFIKSAQEKDGSWYGCWGICYTYAGMFALEALH 601
           SVLGL+++ KY++YR+DE+  AI+IA+++IK  Q  DGSWYGCWG+C+TYAGMFALEAL+
Sbjct: 542 SVLGLTYFAKYYNYRKDEITKAIEIAIQYIKRVQNPDGSWYGCWGVCFTYAGMFALEALY 601

Query: 602 NAGESYADSEVVKKGCEFLVSKQLPDGGWSETMKSSELHTYVSDKRSYVVQTAWALIGLL 661
             GE+Y +SEVV+KGC+F  S+Q  DGGWSE+MKSSELHTYV    S VVQTAWALIGLL
Sbjct: 602 TVGENYENSEVVRKGCDFFASRQRSDGGWSESMKSSELHTYVEADNSQVVQTAWALIGLL 661

Query: 662 LADYPDRKVIDRGIQLLKERQLPSGEWKYESIEGVFNHSCAIEYPSYRFVFPIKALGIYS 721
           LA YP+R VIDRGI LLK+RQLPSGEWK+E +EGVFNHSCAIEYPSY+F+FPIKALG+YS
Sbjct: 662 LAKYPNRDVIDRGIALLKKRQLPSGEWKFEDVEGVFNHSCAIEYPSYKFLFPIKALGLYS 721

Query: 722 KKY 724
           K+Y
Sbjct: 722 KRY 724

>KAFR0D04670 Chr4 (915691..917886) [2196 bp, 731 aa] {ON} Anc_5.351
           YHR072W
          Length = 731

 Score = 1050 bits (2714), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 474/728 (65%), Positives = 584/728 (80%)

Query: 2   LYSDELGLPTTDSRRWRLFCDEVGAERWEYMDEQETSKVPQTTCVQWLLNVPSFPTPEPE 61
            YSDE+GL  TD R WRL  D++G + W+Y+D+ +    PQTT VQWLL +P FP+P P+
Sbjct: 4   FYSDEVGLEKTDPRLWRLRTDDLGRQTWDYIDQLDAESDPQTTFVQWLLQLPGFPSPNPD 63

Query: 62  VSSKDQGFTAANAAYNGARFLGLLQDEASGTFPCSYRGPMFMTIGYVVAMHVGGVVIPEP 121
           + + D  FTA +A YNGA F  LLQD  SG FPC Y+GPMFMTIGYV   ++ G+ IPE 
Sbjct: 64  IKNGDDSFTAKDACYNGATFFKLLQDGNSGIFPCQYKGPMFMTIGYVAVNYIAGIEIPEH 123

Query: 122 QRRELVRYVVNTAHPVDGGWGLHSEDKSTVMGTALNYVLLRLLGMEREHIVMQRARKTLL 181
           ++ EL+RY+VNTAHPVDGGWGLHS DKST  GTA+NYV+LRLLG+ + H V  RAR TLL
Sbjct: 124 EKIELIRYIVNTAHPVDGGWGLHSVDKSTAFGTAINYVILRLLGLSKHHTVCVRARDTLL 183

Query: 182 RMGGAIGSPYWGKVWLSVLNLYKWEGVNPAPPELWLLPYQFPYHPARWWVHTRAIFLPMS 241
           R+GGAIG P+WGK+WLSVLNLY WEGVNPAPPE WLLPY  P HP RWWVHTR ++LP+S
Sbjct: 184 RLGGAIGVPHWGKIWLSVLNLYSWEGVNPAPPETWLLPYYLPIHPGRWWVHTRGVYLPIS 243

Query: 242 YLAGVRYQCALTPLLEEIRSEIFTRPFEEIDFAANRNNVCGIDLYYPHTTVLNTLNKCIV 301
           YL+ VRY    TPLLEEIR EI+ +PF++I+F+ +RN VCG+DLYYPH+T+L+T NK IV
Sbjct: 244 YLSLVRYSTECTPLLEEIRKEIYVKPFDDINFSQHRNTVCGVDLYYPHSTLLDTANKAIV 303

Query: 302 GYEKYLRPNWLLKYSLNRIYELIKMEIQNTDYLCIAPVNNALNAIVTCIEEGPDSAEFGR 361
            YEK+LRP WL + S   IYELI+ E QNTDYLCIAPVN A  A+ T IEEG +S  F +
Sbjct: 304 LYEKFLRPTWLAEKSRKAIYELIEKEAQNTDYLCIAPVNQAFCALATLIEEGVESKPFRK 363

Query: 362 FLDRFKEVLFLGPQGMLVMGTNGVQVWDCAFYIQSMFAANLQDKPEFYENIVRAYRFLCR 421
           + +RFK+ LF GPQGM V GTNGVQ WDCAF IQ +F A L ++PEFY+ +  A++FLCR
Sbjct: 364 YQERFKDALFHGPQGMTVTGTNGVQTWDCAFAIQYLFIAGLAEQPEFYDAVSAAFKFLCR 423

Query: 422 SQITDDCVPGSYRDPRIGAWPFSTKTQGYAVSDCTAEAAKSVLLVRNSPVFKEVRDEISS 481
           SQ   +CVPGS+RD R+GAW FSTKTQGY VSDCTAE+ K++++VRNSPVF ++ DEI+ 
Sbjct: 424 SQFDTECVPGSFRDKRVGAWGFSTKTQGYTVSDCTAESIKAIIMVRNSPVFAKIHDEITD 483

Query: 482 EKLQKAIDALLGLQNLGSFKYGSFASYEKIRAPLSIESLNSAEVFANIMVEHPYVECTDS 541
           E+L K ID LL LQN+GSF++GSFA+YEKI+APL +E LN AEVF NIMVE+PYVECTDS
Sbjct: 484 ERLCKGIDILLDLQNMGSFEFGSFATYEKIKAPLILEKLNPAEVFGNIMVEYPYVECTDS 543

Query: 542 SVLGLSFYRKYHDYRQDEVDHAIKIAVKFIKSAQEKDGSWYGCWGICYTYAGMFALEALH 601
           SVLGL+++ +++ YR +E+   I++A+++IK+AQ+ DGSWYG WGIC+TYAGMFA+EAL 
Sbjct: 544 SVLGLTYFHRHYKYRHEEISDRIQLAIRYIKNAQQDDGSWYGSWGICFTYAGMFAMEALQ 603

Query: 602 NAGESYADSEVVKKGCEFLVSKQLPDGGWSETMKSSELHTYVSDKRSYVVQTAWALIGLL 661
           + GE Y +S+ V KGC+FLVSKQ+PDGGWSE+MKSSELHTYVS K S VVQTAW LI LL
Sbjct: 604 SVGELYENSDAVHKGCDFLVSKQMPDGGWSESMKSSELHTYVSTKESLVVQTAWVLIALL 663

Query: 662 LADYPDRKVIDRGIQLLKERQLPSGEWKYESIEGVFNHSCAIEYPSYRFVFPIKALGIYS 721
           LA YPD++VIDRGI LLK RQ PSGEWK+ES+EGVFNHSCAIEYPSYRF+FPIKALG+Y 
Sbjct: 664 LAKYPDKQVIDRGISLLKSRQEPSGEWKFESVEGVFNHSCAIEYPSYRFLFPIKALGLYV 723

Query: 722 KKYAKDAL 729
           K+Y    +
Sbjct: 724 KEYGAQGI 731

>TPHA0E01120 Chr5 complement(230336..232537) [2202 bp, 733 aa] {ON}
           Anc_5.351 YHR072W
          Length = 733

 Score = 1043 bits (2697), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 471/729 (64%), Positives = 579/729 (79%), Gaps = 1/729 (0%)

Query: 2   LYSDELGLPTTDSRRWRLFCDEVGAERWEYMDEQETS-KVPQTTCVQWLLNVPSFPTPEP 60
            YS+++GLP TD + WRL  DE+G E WEY+ E E      Q+T  +WLL VP FP P P
Sbjct: 5   FYSEQIGLPKTDPKSWRLRTDELGRESWEYLKEGEVDLNDEQSTYTKWLLQVPDFPAPNP 64

Query: 61  EVSSKDQGFTAANAAYNGARFLGLLQDEASGTFPCSYRGPMFMTIGYVVAMHVGGVVIPE 120
            ++S+   F A NA +NGA F  LLQD  SG FPC Y+GPMFM IGY+   ++ G+ IP+
Sbjct: 65  AINSESANFKAENACHNGASFYKLLQDPTSGMFPCQYKGPMFMAIGYIAVNYIAGIEIPD 124

Query: 121 PQRRELVRYVVNTAHPVDGGWGLHSEDKSTVMGTALNYVLLRLLGMEREHIVMQRARKTL 180
            +R E++RY+VNT+HPVDGGWGLHS DKSTV GTALNYV LRLLG+ ++H V  +AR TL
Sbjct: 125 HERIEMIRYIVNTSHPVDGGWGLHSVDKSTVFGTALNYVNLRLLGLSKDHPVCVKARDTL 184

Query: 181 LRMGGAIGSPYWGKVWLSVLNLYKWEGVNPAPPELWLLPYQFPYHPARWWVHTRAIFLPM 240
           +R+GGAIG+P+WGK+WLS LNLYKWEGVNPAPPE WLLPY  P HP RWWVHTR +++P+
Sbjct: 185 MRLGGAIGAPHWGKIWLSALNLYKWEGVNPAPPETWLLPYSLPIHPGRWWVHTRGVYIPV 244

Query: 241 SYLAGVRYQCALTPLLEEIRSEIFTRPFEEIDFAANRNNVCGIDLYYPHTTVLNTLNKCI 300
           SYL+  +Y C LTPLL EIR+EI+T+ FE IDF+ +RN VCG+DLYYPH+ +L+  N C+
Sbjct: 245 SYLSLTKYTCELTPLLAEIRTEIYTKDFESIDFSKHRNTVCGVDLYYPHSKLLDVANDCL 304

Query: 301 VGYEKYLRPNWLLKYSLNRIYELIKMEIQNTDYLCIAPVNNALNAIVTCIEEGPDSAEFG 360
           V YE YLRP W+ + S   +YELIK EI+NTDYLCIAPVN A  A+VT IEEG +S +F 
Sbjct: 305 VFYENYLRPEWVYEKSRKSVYELIKKEIENTDYLCIAPVNQAFCALVTLIEEGKNSKQFE 364

Query: 361 RFLDRFKEVLFLGPQGMLVMGTNGVQVWDCAFYIQSMFAANLQDKPEFYENIVRAYRFLC 420
           RF  R K+ LF GPQGM VMGTNG QVWDCAF+IQ  F A L +KPEFY+ I  AY+FLC
Sbjct: 365 RFQYRMKDALFHGPQGMTVMGTNGTQVWDCAFFIQYYFVAGLAEKPEFYDAISAAYKFLC 424

Query: 421 RSQITDDCVPGSYRDPRIGAWPFSTKTQGYAVSDCTAEAAKSVLLVRNSPVFKEVRDEIS 480
           RSQ   +C PGS+RD R+GAW FSTKTQGY VSDCTAE+ K++++VRNSP F ++ +E S
Sbjct: 425 RSQFDTECEPGSFRDKRVGAWGFSTKTQGYTVSDCTAESIKAIIMVRNSPTFAKIHNEFS 484

Query: 481 SEKLQKAIDALLGLQNLGSFKYGSFASYEKIRAPLSIESLNSAEVFANIMVEHPYVECTD 540
            E+L K ID L+ LQNLGSF+YGSFA+YEKI+APL +E+LN AEVF NIMVE+PYVECTD
Sbjct: 485 DERLYKGIDILMSLQNLGSFEYGSFATYEKIKAPLFMEALNPAEVFGNIMVEYPYVECTD 544

Query: 541 SSVLGLSFYRKYHDYRQDEVDHAIKIAVKFIKSAQEKDGSWYGCWGICYTYAGMFALEAL 600
           SSVLGL+++ K++DY+++E+   IK+A+ +IKS Q+KDGSWYGCWGIC+TYAGMFA+EAL
Sbjct: 545 SSVLGLTYFHKHYDYKKEEISKRIKLAIDYIKSCQQKDGSWYGCWGICFTYAGMFAMEAL 604

Query: 601 HNAGESYADSEVVKKGCEFLVSKQLPDGGWSETMKSSELHTYVSDKRSYVVQTAWALIGL 660
              GE+Y +SEVV+KGC+FLV KQ+ DGGWSE+MKSSELHTYVS +RS VVQTAW LI L
Sbjct: 605 ETVGENYKNSEVVRKGCDFLVKKQMEDGGWSESMKSSELHTYVSSERSLVVQTAWVLIAL 664

Query: 661 LLADYPDRKVIDRGIQLLKERQLPSGEWKYESIEGVFNHSCAIEYPSYRFVFPIKALGIY 720
           LLA YP + VIDRGIQLLK RQ PSGEWK+E +EGVFNHSCAIEY SYRF+FPIKALG+Y
Sbjct: 665 LLAKYPHKDVIDRGIQLLKSRQQPSGEWKFEEVEGVFNHSCAIEYQSYRFLFPIKALGLY 724

Query: 721 SKKYAKDAL 729
            K Y  D++
Sbjct: 725 VKNYGNDSI 733

>YHR072W Chr8 (239098..241293) [2196 bp, 731 aa] {ON}
           ERG7Lanosterol synthase, an essential enzyme that
           catalyzes the cyclization of squalene 2,3-epoxide, a
           step in ergosterol biosynthesis
          Length = 731

 Score = 1037 bits (2681), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 472/728 (64%), Positives = 576/728 (79%)

Query: 2   LYSDELGLPTTDSRRWRLFCDEVGAERWEYMDEQETSKVPQTTCVQWLLNVPSFPTPEPE 61
            YSD +GLP TD R WRL  DE+G E WEY+  Q+ +  P +T  QWLL  P FP P PE
Sbjct: 4   FYSDTIGLPKTDPRLWRLRTDELGRESWEYLTPQQAANDPPSTFTQWLLQDPKFPQPHPE 63

Query: 62  VSSKDQGFTAANAAYNGARFLGLLQDEASGTFPCSYRGPMFMTIGYVVAMHVGGVVIPEP 121
            +     F+A +A +NGA F  LLQ+  SG FPC Y+GPMFMTIGYV   ++ G+ IPE 
Sbjct: 64  RNKHSPDFSAFDACHNGASFFKLLQEPDSGIFPCQYKGPMFMTIGYVAVNYIAGIEIPEH 123

Query: 122 QRRELVRYVVNTAHPVDGGWGLHSEDKSTVMGTALNYVLLRLLGMEREHIVMQRARKTLL 181
           +R EL+RY+VNTAHPVDGGWGLHS DKSTV GT LNYV+LRLLG+ ++H V  +AR TLL
Sbjct: 124 ERIELIRYIVNTAHPVDGGWGLHSVDKSTVFGTVLNYVILRLLGLPKDHPVCAKARSTLL 183

Query: 182 RMGGAIGSPYWGKVWLSVLNLYKWEGVNPAPPELWLLPYQFPYHPARWWVHTRAIFLPMS 241
           R+GGAIGSP+WGK+WLS LNLYKWEGVNPAPPE WLLPY  P HP RWWVHTR +++P+S
Sbjct: 184 RLGGAIGSPHWGKIWLSALNLYKWEGVNPAPPETWLLPYSLPMHPGRWWVHTRGVYIPVS 243

Query: 242 YLAGVRYQCALTPLLEEIRSEIFTRPFEEIDFAANRNNVCGIDLYYPHTTVLNTLNKCIV 301
           YL+ V++ C +TPLLEE+R+EI+T+PF++I+F+ NRN VCG+DLYYPH+T LN  N  +V
Sbjct: 244 YLSLVKFSCPMTPLLEELRNEIYTKPFDKINFSKNRNTVCGVDLYYPHSTTLNIANSLVV 303

Query: 302 GYEKYLRPNWLLKYSLNRIYELIKMEIQNTDYLCIAPVNNALNAIVTCIEEGPDSAEFGR 361
            YEKYLR  ++   S  ++Y+LIK E+QNTD LCIAPVN A  A+VT IEEG DS  F R
Sbjct: 304 FYEKYLRNRFIYSLSKKKVYDLIKTELQNTDSLCIAPVNQAFCALVTLIEEGVDSEAFQR 363

Query: 362 FLDRFKEVLFLGPQGMLVMGTNGVQVWDCAFYIQSMFAANLQDKPEFYENIVRAYRFLCR 421
              RFK+ LF GPQGM +MGTNGVQ WDCAF IQ  F A L ++PEFY  IV AY+FLC 
Sbjct: 364 LQYRFKDALFHGPQGMTIMGTNGVQTWDCAFAIQYFFVAGLAERPEFYNTIVSAYKFLCH 423

Query: 422 SQITDDCVPGSYRDPRIGAWPFSTKTQGYAVSDCTAEAAKSVLLVRNSPVFKEVRDEISS 481
           +Q   +CVPGSYRD R GAW FSTKTQGY V+DCTAEA K++++V+NSPVF EV   ISS
Sbjct: 424 AQFDTECVPGSYRDKRKGAWGFSTKTQGYTVADCTAEAIKAIIMVKNSPVFSEVHHMISS 483

Query: 482 EKLQKAIDALLGLQNLGSFKYGSFASYEKIRAPLSIESLNSAEVFANIMVEHPYVECTDS 541
           E+L + ID LL LQN+GSF+YGSFA+YEKI+APL++E+LN AEVF NIMVE+PYVECTDS
Sbjct: 484 ERLFEGIDVLLNLQNIGSFEYGSFATYEKIKAPLAMETLNPAEVFGNIMVEYPYVECTDS 543

Query: 542 SVLGLSFYRKYHDYRQDEVDHAIKIAVKFIKSAQEKDGSWYGCWGICYTYAGMFALEALH 601
           SVLGL+++ KY DYR++E+   I+IA++FIK +Q  DGSWYG WGIC+TYAGMFALEALH
Sbjct: 544 SVLGLTYFHKYFDYRKEEIRTRIRIAIEFIKKSQLPDGSWYGSWGICFTYAGMFALEALH 603

Query: 602 NAGESYADSEVVKKGCEFLVSKQLPDGGWSETMKSSELHTYVSDKRSYVVQTAWALIGLL 661
             GE+Y +S  V+KGC+FLVSKQ+ DGGW E+MKSSELH+YV  ++S VVQTAWALI LL
Sbjct: 604 TVGETYENSSTVRKGCDFLVSKQMKDGGWGESMKSSELHSYVDSEKSLVVQTAWALIALL 663

Query: 662 LADYPDRKVIDRGIQLLKERQLPSGEWKYESIEGVFNHSCAIEYPSYRFVFPIKALGIYS 721
            A+YP+++VIDRGI LLK RQ  SGEWK+ES+EGVFNHSCAIEYPSYRF+FPIKALG+YS
Sbjct: 664 FAEYPNKEVIDRGIDLLKNRQEESGEWKFESVEGVFNHSCAIEYPSYRFLFPIKALGMYS 723

Query: 722 KKYAKDAL 729
           + Y    L
Sbjct: 724 RAYETHTL 731

>KNAG0B04580 Chr2 complement(884911..887100) [2190 bp, 729 aa] {ON}
           Anc_5.351 YHR072W
          Length = 729

 Score = 1032 bits (2668), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 472/725 (65%), Positives = 580/725 (80%), Gaps = 5/725 (0%)

Query: 1   MLYSDELGLPTTDSRRWRLFCDEVGAERWEYMDEQETSKVPQTTCVQWLLNVPSFPTPEP 60
           +LYS++LGLP TD +RWRL  DE+G E W+Y+ E +    PQ++  QWLL +      + 
Sbjct: 5   VLYSEQLGLPRTDPKRWRLRTDELGRETWDYIPEDQCEMDPQSSFTQWLLQIR-----DT 59

Query: 61  EVSSKDQGFTAANAAYNGARFLGLLQDEASGTFPCSYRGPMFMTIGYVVAMHVGGVVIPE 120
           E S+  +  TA ++  NGA F   LQD  SG FPC Y+GPMFMTIGY+   ++ G+ IP+
Sbjct: 60  ETSAPKEPVTAFDSCINGANFFKSLQDPHSGMFPCQYKGPMFMTIGYIAVNYIAGIEIPK 119

Query: 121 PQRRELVRYVVNTAHPVDGGWGLHSEDKSTVMGTALNYVLLRLLGMEREHIVMQRARKTL 180
            +R E++RY+VNT+HPVDGGWGLHS DKSTV GT LNYV+LRLLG++R+H V  +AR TL
Sbjct: 120 HERLEIIRYIVNTSHPVDGGWGLHSVDKSTVFGTVLNYVILRLLGLQRDHPVCLKARDTL 179

Query: 181 LRMGGAIGSPYWGKVWLSVLNLYKWEGVNPAPPELWLLPYQFPYHPARWWVHTRAIFLPM 240
           LR+GGAIG+P+WGK+WLSVLNLYKWEGVNPAPPE WLLPY+ P HP +WWVHTR ++LP+
Sbjct: 180 LRLGGAIGAPHWGKIWLSVLNLYKWEGVNPAPPETWLLPYELPIHPGKWWVHTRGVYLPI 239

Query: 241 SYLAGVRYQCALTPLLEEIRSEIFTRPFEEIDFAANRNNVCGIDLYYPHTTVLNTLNKCI 300
           SYL+ V Y C LTPLLEEIR EI+T+PF+ IDF+ +RN VCG+DLYYPH+ VL+  N  I
Sbjct: 240 SYLSLVHYSCELTPLLEEIRGEIYTKPFDSIDFSKHRNTVCGVDLYYPHSKVLDMANNAI 299

Query: 301 VGYEKYLRPNWLLKYSLNRIYELIKMEIQNTDYLCIAPVNNALNAIVTCIEEGPDSAEFG 360
           + YEKYLRP W+ K S  ++Y LI+ EIQNTDYLCIAPVN A  A+VT IEEG DS  F 
Sbjct: 300 IFYEKYLRPAWIYKKSKAKVYSLIQKEIQNTDYLCIAPVNQAFCALVTLIEEGVDSEAFT 359

Query: 361 RFLDRFKEVLFLGPQGMLVMGTNGVQVWDCAFYIQSMFAANLQDKPEFYENIVRAYRFLC 420
           +F  RFK+ LF GPQGM VMGTNGVQ WDCAF +Q  F A L ++PEFY  IV AYRFL 
Sbjct: 360 KFRTRFKDALFHGPQGMTVMGTNGVQTWDCAFAVQYFFVAGLAERPEFYNFIVAAYRFLI 419

Query: 421 RSQITDDCVPGSYRDPRIGAWPFSTKTQGYAVSDCTAEAAKSVLLVRNSPVFKEVRDEIS 480
           RSQ   +CVPGS+RD R G+W FSTKTQGY VSDCTAEA K++++V+N+P F +V DEI 
Sbjct: 420 RSQFDTECVPGSFRDKRKGSWGFSTKTQGYTVSDCTAEAIKAIIMVKNAPQFSDVHDEIE 479

Query: 481 SEKLQKAIDALLGLQNLGSFKYGSFASYEKIRAPLSIESLNSAEVFANIMVEHPYVECTD 540
             +L + ID LL LQN GSF+YGSFA+YEKI+APL +E LN AEVF NIM+E+PYVECTD
Sbjct: 480 DSRLYEGIDVLLSLQNTGSFEYGSFATYEKIKAPLIMEKLNPAEVFGNIMIEYPYVECTD 539

Query: 541 SSVLGLSFYRKYHDYRQDEVDHAIKIAVKFIKSAQEKDGSWYGCWGICYTYAGMFALEAL 600
           SSVLGL+F+ KY+ YR +E+   I+IA++++K AQE DGSWYGCWGICYTYAGMFALEAL
Sbjct: 540 SSVLGLTFFHKYYKYRTEEISERIRIAIEYLKRAQEPDGSWYGCWGICYTYAGMFALEAL 599

Query: 601 HNAGESYADSEVVKKGCEFLVSKQLPDGGWSETMKSSELHTYVSDKRSYVVQTAWALIGL 660
           H+  E+YA+S +V+KGC+FLVSKQL DGGW E+MKSSELH+YVS   S VVQTAWA+I L
Sbjct: 600 HSVEENYANSAIVRKGCDFLVSKQLIDGGWGESMKSSELHSYVSTPESLVVQTAWAVIAL 659

Query: 661 LLADYPDRKVIDRGIQLLKERQLPSGEWKYESIEGVFNHSCAIEYPSYRFVFPIKALGIY 720
           LLA+YPD+KVI+RGI+LL+ RQLPSGEWK+ES+EGVFNHSCAIEYPSYRF+FPIKALG+Y
Sbjct: 660 LLAEYPDKKVIERGIELLRSRQLPSGEWKFESVEGVFNHSCAIEYPSYRFLFPIKALGLY 719

Query: 721 SKKYA 725
           +K YA
Sbjct: 720 NKTYA 724

>NCAS0H01640 Chr8 complement(313901..316087) [2187 bp, 728 aa] {ON}
           Anc_5.351 YHR072W
          Length = 728

 Score = 1023 bits (2646), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 476/727 (65%), Positives = 575/727 (79%), Gaps = 4/727 (0%)

Query: 2   LYSDELGLPTTDSRRWRLFCDEVGAERWEYMDEQETSKVPQTTCVQWLLNVPSFPTPEPE 61
           LYSDELGL  TD  RWRL  + +G   WEY++ ++ +  PQ+T  +WLL +P FP P P 
Sbjct: 5   LYSDELGLQKTDPTRWRLRTNPLGRHTWEYINSEQKTNDPQSTFTKWLLQLPDFPAPTP- 63

Query: 62  VSSKDQGFTAANAAYNGARFLGLLQDEASGTFPCSYRGPMFMTIGYVVAMHVGGVVIPEP 121
             + ++  TA  A Y+GA F  LLQD+ SGTFPC Y+GPMFMTIGYV   ++ G+ IP  
Sbjct: 64  --TTEEPRTAREACYDGASFFRLLQDKESGTFPCQYKGPMFMTIGYVAVNYIAGLEIPNH 121

Query: 122 QRRELVRYVVNTAHPVDGGWGLHSEDKSTVMGTALNYVLLRLLGMEREHIVMQRARKTLL 181
           +R E++RY+VNTAHPVDGGWGLHS DKSTV GT +NYV+LRLLGM ++HIV +RARKTLL
Sbjct: 122 ERIEIIRYLVNTAHPVDGGWGLHSTDKSTVFGTVINYVILRLLGMSKDHIVCRRARKTLL 181

Query: 182 RMGGAIGSPYWGKVWLSVLNLYKWEGVNPAPPELWLLPYQFPYHPARWWVHTRAIFLPMS 241
            +GGAIG+P+WGKVWLSVLNLYKWEGVNPAPPE WLLPY  P HP RWWVHTR ++LP+S
Sbjct: 182 SLGGAIGAPHWGKVWLSVLNLYKWEGVNPAPPETWLLPYCLPIHPGRWWVHTRGVYLPIS 241

Query: 242 YLAGVRYQCALTPLLEEIRSEIFT-RPFEEIDFAANRNNVCGIDLYYPHTTVLNTLNKCI 300
           YL+ V + C LTPLL+EIR EI+T +PFE I FA NRNNVCG+DLYYPH+ VL+  N CI
Sbjct: 242 YLSLVHFSCELTPLLKEIREEIYTAQPFEAIKFAQNRNNVCGVDLYYPHSQVLDVANACI 301

Query: 301 VGYEKYLRPNWLLKYSLNRIYELIKMEIQNTDYLCIAPVNNALNAIVTCIEEGPDSAEFG 360
           V YE+YLRP WL K S  ++YELIK EI NTDYLCIAPVN A  A+VT IEEG DS  F 
Sbjct: 302 VKYEEYLRPTWLKKLSKRKVYELIKKEISNTDYLCIAPVNQAFCALVTLIEEGVDSNAFQ 361

Query: 361 RFLDRFKEVLFLGPQGMLVMGTNGVQVWDCAFYIQSMFAANLQDKPEFYENIVRAYRFLC 420
           +F  RFK+ LF GPQGM VMGTNGVQVWDCAF IQ  F A L +K EFY+ I  AY FLC
Sbjct: 362 KFSYRFKDSLFHGPQGMTVMGTNGVQVWDCAFAIQYFFVAGLAEKSEFYDTIASAYAFLC 421

Query: 421 RSQITDDCVPGSYRDPRIGAWPFSTKTQGYAVSDCTAEAAKSVLLVRNSPVFKEVRDEIS 480
           RSQ   +CV GS+RD R+G+W FSTKTQGY VSDCTAE+ K++++V+NSPVFK +   I+
Sbjct: 422 RSQFDTECVRGSFRDKRVGSWGFSTKTQGYTVSDCTAESIKAIIMVKNSPVFKAIHHLIT 481

Query: 481 SEKLQKAIDALLGLQNLGSFKYGSFASYEKIRAPLSIESLNSAEVFANIMVEHPYVECTD 540
            EK+ + ID LL LQN+GSF+YGSFA+YEKI+APL +E LN AEVF NIMVE+PYVECTD
Sbjct: 482 DEKIYQGIDVLLSLQNVGSFEYGSFATYEKIKAPLFLEKLNPAEVFGNIMVEYPYVECTD 541

Query: 541 SSVLGLSFYRKYHDYRQDEVDHAIKIAVKFIKSAQEKDGSWYGCWGICYTYAGMFALEAL 600
           SSVLGL+++  Y++YR +E+   IK+AV +IK  Q  DGSWYG WGICYTYAGMFA+EAL
Sbjct: 542 SSVLGLTYFHNYYNYRGNEISQRIKVAVDYIKHLQASDGSWYGSWGICYTYAGMFAMEAL 601

Query: 601 HNAGESYADSEVVKKGCEFLVSKQLPDGGWSETMKSSELHTYVSDKRSYVVQTAWALIGL 660
           H+ GE YA+S VVKKGC+FLV++Q+ DGGW E MKSSELHTYV+ +RS VVQTAW +I L
Sbjct: 602 HSVGECYANSIVVKKGCDFLVNRQMTDGGWGEPMKSSELHTYVNSERSQVVQTAWVVIAL 661

Query: 661 LLADYPDRKVIDRGIQLLKERQLPSGEWKYESIEGVFNHSCAIEYPSYRFVFPIKALGIY 720
           LLA YP + VI +G++LLK RQ PSGEWK+ES EGVFNHSCAIEYPSYR +FPIKALG+Y
Sbjct: 662 LLAKYPRKDVIIKGVELLKSRQEPSGEWKFESPEGVFNHSCAIEYPSYRHLFPIKALGLY 721

Query: 721 SKKYAKD 727
           ++ Y K+
Sbjct: 722 AEIYDKE 728

>TDEL0E02760 Chr5 complement(531650..533845) [2196 bp, 731 aa] {ON}
           Anc_5.351 YHR072W
          Length = 731

 Score = 1023 bits (2645), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 464/728 (63%), Positives = 572/728 (78%)

Query: 2   LYSDELGLPTTDSRRWRLFCDEVGAERWEYMDEQETSKVPQTTCVQWLLNVPSFPTPEPE 61
            YS+ELGL  TD   WRL  DE+G E W Y+  ++     Q T  QWLL    FP P P 
Sbjct: 4   FYSEELGLERTDPDLWRLRTDELGRETWVYLTPEQAKNDEQCTFTQWLLQSEKFPKPSPN 63

Query: 62  VSSKDQGFTAANAAYNGARFLGLLQDEASGTFPCSYRGPMFMTIGYVVAMHVGGVVIPEP 121
             S    F AA+A  NGA F  LLQD  SG FPC Y+GPMF+TIGYV   ++ G  IPE 
Sbjct: 64  RHSGTTDFKAADACENGASFFKLLQDPRSGIFPCQYKGPMFLTIGYVAVHYISGTTIPEH 123

Query: 122 QRRELVRYVVNTAHPVDGGWGLHSEDKSTVMGTALNYVLLRLLGMEREHIVMQRARKTLL 181
           +R E++RY+VNTAHPVDGGWGLHS DKST  GT +NYV+LRLLG+ ++H V  +AR  L+
Sbjct: 124 ERIEIIRYIVNTAHPVDGGWGLHSVDKSTAFGTVVNYVILRLLGLPKDHPVCLKARALLM 183

Query: 182 RMGGAIGSPYWGKVWLSVLNLYKWEGVNPAPPELWLLPYQFPYHPARWWVHTRAIFLPMS 241
           ++GGAIG+P+WGK+WLSVLNLYKWEGVNPAPPE+WLLPY  P HP RWWVHTRAI+LP+S
Sbjct: 184 KLGGAIGAPHWGKIWLSVLNLYKWEGVNPAPPEMWLLPYALPIHPGRWWVHTRAIYLPVS 243

Query: 242 YLAGVRYQCALTPLLEEIRSEIFTRPFEEIDFAANRNNVCGIDLYYPHTTVLNTLNKCIV 301
           YL+ +RY C L  LL E+RSEI+ +PF+ I+F++NRN VCGIDLYYPHTTVLN  N  +V
Sbjct: 244 YLSLIRYSCPLNDLLRELRSEIYVKPFDSINFSSNRNTVCGIDLYYPHTTVLNMANNVMV 303

Query: 302 GYEKYLRPNWLLKYSLNRIYELIKMEIQNTDYLCIAPVNNALNAIVTCIEEGPDSAEFGR 361
            YEK+LRPNWL K + +R+Y LIK EI NTDYLCIAPVN A  A+VT IEEG +S+ F +
Sbjct: 304 FYEKHLRPNWLGKKAKDRVYGLIKKEIANTDYLCIAPVNQAFCALVTYIEEGKESSAFKK 363

Query: 362 FLDRFKEVLFLGPQGMLVMGTNGVQVWDCAFYIQSMFAANLQDKPEFYENIVRAYRFLCR 421
           F DR K+ LF GPQGM +MGTNGVQ WDCAF IQ  F A L +KPE+Y+ I  AY+FLCR
Sbjct: 364 FEDRLKDALFHGPQGMTIMGTNGVQTWDCAFAIQYFFVAGLAEKPEYYDTICAAYKFLCR 423

Query: 422 SQITDDCVPGSYRDPRIGAWPFSTKTQGYAVSDCTAEAAKSVLLVRNSPVFKEVRDEISS 481
           +Q   +CV GS+RD R+GAWPFSTK QGY VSDCTAEA K++++VRNSP F  +R+EI+ 
Sbjct: 424 TQFDTECVEGSFRDKRVGAWPFSTKAQGYTVSDCTAEAIKAIIMVRNSPKFASIRNEITD 483

Query: 482 EKLQKAIDALLGLQNLGSFKYGSFASYEKIRAPLSIESLNSAEVFANIMVEHPYVECTDS 541
           E+L K ID LL LQN+ SF+YGSFA+YEKI+APLS+E LN AEVF NIMVE PYVECTDS
Sbjct: 484 ERLCKGIDVLLSLQNITSFEYGSFATYEKIKAPLSMEKLNPAEVFGNIMVEFPYVECTDS 543

Query: 542 SVLGLSFYRKYHDYRQDEVDHAIKIAVKFIKSAQEKDGSWYGCWGICYTYAGMFALEALH 601
           SVLGL+++  ++DYR++E+   IK+A+ +IK  Q++DGSWYGCWG+CY+YAGMFA+EALH
Sbjct: 544 SVLGLTYFHTFYDYRKEEISKRIKLAIDYIKRDQDEDGSWYGCWGVCYSYAGMFAMEALH 603

Query: 602 NAGESYADSEVVKKGCEFLVSKQLPDGGWSETMKSSELHTYVSDKRSYVVQTAWALIGLL 661
           + GE+Y++SE V+KGC+FLVS+Q+ DGGW E+MKSSELH+YVS + S VVQTAW LI LL
Sbjct: 604 SVGENYSNSEYVRKGCDFLVSRQISDGGWGESMKSSELHSYVSTRESLVVQTAWVLIALL 663

Query: 662 LADYPDRKVIDRGIQLLKERQLPSGEWKYESIEGVFNHSCAIEYPSYRFVFPIKALGIYS 721
           L  YP++ VID GI+LLK+RQL +GEWK+E IEGVFNHSCAIEYPSYRF+FPIKALG+Y+
Sbjct: 664 LGKYPNKSVIDAGIKLLKKRQLETGEWKFEGIEGVFNHSCAIEYPSYRFLFPIKALGLYT 723

Query: 722 KKYAKDAL 729
             Y  D++
Sbjct: 724 ATYGDDSI 731

>Smik_8.148 Chr8 (215426..217621) [2196 bp, 731 aa] {ON} YHR072W
           (REAL)
          Length = 731

 Score = 1023 bits (2644), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 462/728 (63%), Positives = 578/728 (79%)

Query: 2   LYSDELGLPTTDSRRWRLFCDEVGAERWEYMDEQETSKVPQTTCVQWLLNVPSFPTPEPE 61
            YS+ +GLP TD R WRL  DE+G E WEY+  ++ +  P +T  QWLL  P FP P+PE
Sbjct: 4   FYSETIGLPKTDPRLWRLRTDEIGRESWEYLTSEQAANEPPSTFTQWLLQDPEFPHPQPE 63

Query: 62  VSSKDQGFTAANAAYNGARFLGLLQDEASGTFPCSYRGPMFMTIGYVVAMHVGGVVIPEP 121
            +     F+A +A +NGA F  LLQ+  SG FPC Y+GPMFMTIGYV   ++ G+ IPE 
Sbjct: 64  RNKHSPNFSAFDACHNGASFFKLLQEPDSGIFPCQYKGPMFMTIGYVAVNYIAGIQIPEH 123

Query: 122 QRRELVRYVVNTAHPVDGGWGLHSEDKSTVMGTALNYVLLRLLGMEREHIVMQRARKTLL 181
           +R E++RY+VNTAHPVDGGWGLHS DKSTV GTALNYV+LRLLG+ ++H V  ++R TLL
Sbjct: 124 ERIEIIRYIVNTAHPVDGGWGLHSVDKSTVFGTALNYVILRLLGLPKDHPVCVKSRNTLL 183

Query: 182 RMGGAIGSPYWGKVWLSVLNLYKWEGVNPAPPELWLLPYQFPYHPARWWVHTRAIFLPMS 241
           R+GGA+GSP+WGK+WLS LNLY+WEGVNPAPPE WLLPY  P HP RWWVHTRA+++P+S
Sbjct: 184 RLGGALGSPHWGKIWLSALNLYRWEGVNPAPPETWLLPYSLPMHPGRWWVHTRAVYIPVS 243

Query: 242 YLAGVRYQCALTPLLEEIRSEIFTRPFEEIDFAANRNNVCGIDLYYPHTTVLNTLNKCIV 301
           YL+ V++ C +TPLLEE+R EI+T+PF++I F+ +RN VCG+DLYYPH+  LN  N  +V
Sbjct: 244 YLSLVKFTCPMTPLLEELREEIYTKPFDKIKFSKHRNTVCGVDLYYPHSKTLNIANNFVV 303

Query: 302 GYEKYLRPNWLLKYSLNRIYELIKMEIQNTDYLCIAPVNNALNAIVTCIEEGPDSAEFGR 361
            YEKYLR  ++   S  ++Y+L++ EIQNTD LCIAPVN A  A+VT IEEG DS  F +
Sbjct: 304 FYEKYLRNRFIYSLSKRKVYDLVRKEIQNTDSLCIAPVNQAFCALVTLIEEGVDSQAFKK 363

Query: 362 FLDRFKEVLFLGPQGMLVMGTNGVQVWDCAFYIQSMFAANLQDKPEFYENIVRAYRFLCR 421
           F  RFK+ LF GPQGM +MGTNGVQ WDCAF IQ +F A L ++ EFY  IV AY+FLCR
Sbjct: 364 FQYRFKDALFHGPQGMTIMGTNGVQSWDCAFAIQYLFIAGLAERSEFYNTIVSAYKFLCR 423

Query: 422 SQITDDCVPGSYRDPRIGAWPFSTKTQGYAVSDCTAEAAKSVLLVRNSPVFKEVRDEISS 481
           +Q   +CVPGS+RD R GAW FSTKTQGY VSDCTAEA K++++V+NSPVF EV + IS+
Sbjct: 424 AQFDTECVPGSFRDKRKGAWGFSTKTQGYVVSDCTAEAIKAIIMVKNSPVFTEVHNMISN 483

Query: 482 EKLQKAIDALLGLQNLGSFKYGSFASYEKIRAPLSIESLNSAEVFANIMVEHPYVECTDS 541
           E+L + ID LL LQN+GSF+YGSFA+YEKI+APL++E+LN AEVF NIMVE+PYVECTDS
Sbjct: 484 ERLFEGIDVLLNLQNIGSFEYGSFATYEKIKAPLAMETLNPAEVFGNIMVEYPYVECTDS 543

Query: 542 SVLGLSFYRKYHDYRQDEVDHAIKIAVKFIKSAQEKDGSWYGCWGICYTYAGMFALEALH 601
           SVLGL+++ KY DY+++E+   I+IA++FIK +Q  +GSWYG WGIC+TYAGMFALEALH
Sbjct: 544 SVLGLTYFHKYFDYKKEEIRARIRIAIEFIKKSQLPNGSWYGSWGICFTYAGMFALEALH 603

Query: 602 NAGESYADSEVVKKGCEFLVSKQLPDGGWSETMKSSELHTYVSDKRSYVVQTAWALIGLL 661
             GE+Y +S  V+KGC+FLVSKQ+ DGGW E+MKSSELH+YV  ++S VVQTAW LI LL
Sbjct: 604 TVGETYENSSTVRKGCDFLVSKQMKDGGWGESMKSSELHSYVDSEKSLVVQTAWVLIALL 663

Query: 662 LADYPDRKVIDRGIQLLKERQLPSGEWKYESIEGVFNHSCAIEYPSYRFVFPIKALGIYS 721
            A+YP + VIDRGI+LLK RQ  SGEWK+E +EGVFNHSCAIEYPSYRF+FPIKALG+YS
Sbjct: 664 FAEYPGKDVIDRGIELLKNRQEESGEWKFEGVEGVFNHSCAIEYPSYRFLFPIKALGMYS 723

Query: 722 KKYAKDAL 729
           K Y + AL
Sbjct: 724 KAYEQHAL 731

>NDAI0C01970 Chr3 complement(442137..444332) [2196 bp, 731 aa] {ON}
           Anc_5.351 YHR072W
          Length = 731

 Score = 1021 bits (2641), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 474/727 (65%), Positives = 575/727 (79%), Gaps = 2/727 (0%)

Query: 2   LYSDELGLPTTDSRRWRLFCDEVGAERWEYMDEQETSKVPQTTCVQWLLNVPSFPTPEPE 61
           LYS+ELGL  TD   WRL  +  G + WEY+ + ++   PQ+   +WLL +P FPTP+  
Sbjct: 5   LYSEELGLEKTDPLLWRLRTNIDGRQSWEYITKDQSPNDPQSNFTKWLLQLPDFPTPQYP 64

Query: 62  VSSKDQGFTAANAAYNGARFLGLLQDEASGTFPCSYRGPMFMTIGYVVAMHVGGVVIPEP 121
            + KD   +A      GA+F  LLQDE SGTFPC Y+GPMFMTIGYV   +V  + IPE 
Sbjct: 65  DNIKD--VSAEAICLKGAKFFRLLQDETSGTFPCQYKGPMFMTIGYVAVNYVADIKIPES 122

Query: 122 QRRELVRYVVNTAHPVDGGWGLHSEDKSTVMGTALNYVLLRLLGMEREHIVMQRARKTLL 181
           +R E++RY+VNTAHPVDGGWGLHSEDKSTV GT LNY++LRLLG++  H V  +AR TLL
Sbjct: 123 ERIEIIRYIVNTAHPVDGGWGLHSEDKSTVFGTVLNYIILRLLGLDANHPVCMKARDTLL 182

Query: 182 RMGGAIGSPYWGKVWLSVLNLYKWEGVNPAPPELWLLPYQFPYHPARWWVHTRAIFLPMS 241
           R+GGAI +P+WGKVWLSVLNLYKWEGVNPAPPE WLLPY  P HP RWWVHTR ++LP+S
Sbjct: 183 RLGGAISAPHWGKVWLSVLNLYKWEGVNPAPPETWLLPYWMPIHPGRWWVHTRGVYLPIS 242

Query: 242 YLAGVRYQCALTPLLEEIRSEIFTRPFEEIDFAANRNNVCGIDLYYPHTTVLNTLNKCIV 301
           YL+ V YQC LT LL+EIRSEI+ +PF+ IDF+ +RN VCG+DLYYPH+  L+  N  IV
Sbjct: 243 YLSLVHYQCELTDLLKEIRSEIYVKPFDSIDFSKHRNTVCGVDLYYPHSKTLDFANSLIV 302

Query: 302 GYEKYLRPNWLLKYSLNRIYELIKMEIQNTDYLCIAPVNNALNAIVTCIEEGPDSAEFGR 361
            YEKYLRPN L  YS +++Y+LIK EI+NTDYLCIAPVN A  A+VT +EEG DS  F R
Sbjct: 303 PYEKYLRPNALRDYSKHKVYDLIKKEIENTDYLCIAPVNQAFCALVTLLEEGADSKAFER 362

Query: 362 FLDRFKEVLFLGPQGMLVMGTNGVQVWDCAFYIQSMFAANLQDKPEFYENIVRAYRFLCR 421
           F  RFK+ LFLGPQGM VMGTNGVQ WDCAF IQ +F A L  +PEFY  I  AY+FLCR
Sbjct: 363 FQYRFKDALFLGPQGMTVMGTNGVQTWDCAFAIQYLFVAGLAKRPEFYNTISNAYKFLCR 422

Query: 422 SQITDDCVPGSYRDPRIGAWPFSTKTQGYAVSDCTAEAAKSVLLVRNSPVFKEVRDEISS 481
           SQ   DCV GS+RD R GAW FSTKTQGY VSDCTAE+ K++++VRNS +FK++ DEIS 
Sbjct: 423 SQFDTDCVTGSFRDKRDGAWGFSTKTQGYTVSDCTAESIKAIIMVRNSVIFKDIHDEISD 482

Query: 482 EKLQKAIDALLGLQNLGSFKYGSFASYEKIRAPLSIESLNSAEVFANIMVEHPYVECTDS 541
           E+L KA+D LL LQN GSF++GSFA+YEKI+APL +E+LN AEVF NIMVE+PYVECTDS
Sbjct: 483 ERLYKAVDILLDLQNTGSFEFGSFATYEKIKAPLFLEALNPAEVFGNIMVEYPYVECTDS 542

Query: 542 SVLGLSFYRKYHDYRQDEVDHAIKIAVKFIKSAQEKDGSWYGCWGICYTYAGMFALEALH 601
           SVLGL+ + K+++YR+DE+   I IA+++IK  QE DGSWYG WGICYTYAGMFA+EALH
Sbjct: 543 SVLGLTSFHKHYNYRKDEISKRINIAIEYIKKVQEDDGSWYGSWGICYTYAGMFAMEALH 602

Query: 602 NAGESYADSEVVKKGCEFLVSKQLPDGGWSETMKSSELHTYVSDKRSYVVQTAWALIGLL 661
           + GE+Y +S VVKKGC+FLV++QL DGGW E+MKSSELHTYVS K S VVQTAW ++ LL
Sbjct: 603 SVGETYGNSFVVKKGCDFLVARQLEDGGWGESMKSSELHTYVSTKESLVVQTAWVVLALL 662

Query: 662 LADYPDRKVIDRGIQLLKERQLPSGEWKYESIEGVFNHSCAIEYPSYRFVFPIKALGIYS 721
           LA YP++ +ID+GI LLK+RQ  SGEWK+ES EGVFNHSCAIEYPSYRF+FPIKALG+YS
Sbjct: 663 LAQYPNKNIIDKGIALLKKRQQVSGEWKFESPEGVFNHSCAIEYPSYRFLFPIKALGLYS 722

Query: 722 KKYAKDA 728
           + Y  +A
Sbjct: 723 QIYEHNA 729

>Suva_15.262 Chr15 (440969..443164) [2196 bp, 731 aa] {ON} YHR072W
           (REAL)
          Length = 731

 Score = 1016 bits (2628), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 460/728 (63%), Positives = 577/728 (79%)

Query: 2   LYSDELGLPTTDSRRWRLFCDEVGAERWEYMDEQETSKVPQTTCVQWLLNVPSFPTPEPE 61
            YS+++GLP TD RRWRL  D++G E WEY+  ++ +  P +T  QWLL  P FP P P 
Sbjct: 4   FYSEKIGLPKTDPRRWRLRTDKLGRESWEYLTPEQAANDPPSTFTQWLLQDPDFPQPHPA 63

Query: 62  VSSKDQGFTAANAAYNGARFLGLLQDEASGTFPCSYRGPMFMTIGYVVAMHVGGVVIPEP 121
            +     F+A +A +NGA F  LLQ+  SG FPC Y+GPMFMTIGYV   ++ G+ IPE 
Sbjct: 64  KNKHSPDFSAFDACHNGASFFKLLQEPDSGIFPCQYKGPMFMTIGYVAVSYIAGIQIPEH 123

Query: 122 QRRELVRYVVNTAHPVDGGWGLHSEDKSTVMGTALNYVLLRLLGMEREHIVMQRARKTLL 181
           +R EL+RY+VNTAHPVDGGWGLHS DKSTV GT LNYV+LRLLG+ ++H V  +AR TLL
Sbjct: 124 ERIELIRYIVNTAHPVDGGWGLHSVDKSTVFGTVLNYVILRLLGLSKDHPVCVKARDTLL 183

Query: 182 RMGGAIGSPYWGKVWLSVLNLYKWEGVNPAPPELWLLPYQFPYHPARWWVHTRAIFLPMS 241
           R+GGAIG+P+WGKVWLS LNLYKWEGVNPAPPE WLLPY  P HP RWWVHTR +++P+S
Sbjct: 184 RLGGAIGAPHWGKVWLSALNLYKWEGVNPAPPETWLLPYSLPIHPGRWWVHTRGVYIPVS 243

Query: 242 YLAGVRYQCALTPLLEEIRSEIFTRPFEEIDFAANRNNVCGIDLYYPHTTVLNTLNKCIV 301
           YL+ V++ C +TPLLEE+R EI+T+PF++I+F+ +RN VCG+DLYYPH+ +LN  N  +V
Sbjct: 244 YLSLVKFVCPMTPLLEELRGEIYTKPFDKINFSNHRNTVCGVDLYYPHSKILNIANNFVV 303

Query: 302 GYEKYLRPNWLLKYSLNRIYELIKMEIQNTDYLCIAPVNNALNAIVTCIEEGPDSAEFGR 361
            YEKYLR  ++   S  ++Y+L+K EI+NTD LCIAPVN A  A+VT IEEG DS  F  
Sbjct: 304 FYEKYLRNRFIYSLSKRKVYDLVKKEIENTDSLCIAPVNQAFCALVTLIEEGVDSQAFKD 363

Query: 362 FLDRFKEVLFLGPQGMLVMGTNGVQVWDCAFYIQSMFAANLQDKPEFYENIVRAYRFLCR 421
           F  RFK+ LF GPQGM +MGTNGVQ WDCAF IQ  F A L ++PEF++ IV AY+FLCR
Sbjct: 364 FQYRFKDALFHGPQGMTIMGTNGVQTWDCAFAIQYFFTAGLAERPEFHDTIVSAYKFLCR 423

Query: 422 SQITDDCVPGSYRDPRIGAWPFSTKTQGYAVSDCTAEAAKSVLLVRNSPVFKEVRDEISS 481
           SQ   +CVPGS+RD R GAW FSTKTQGY VSDCTAE+ K++++VRNSPVF +V   I++
Sbjct: 424 SQFDTECVPGSFRDKRKGAWGFSTKTQGYTVSDCTAESIKAIIMVRNSPVFSDVHHLITN 483

Query: 482 EKLQKAIDALLGLQNLGSFKYGSFASYEKIRAPLSIESLNSAEVFANIMVEHPYVECTDS 541
           E+L + ID LL LQN+GSF+YGSFA+YEKI+APL++E+LN AEVF NIMVE+PYVECTDS
Sbjct: 484 ERLFEGIDVLLNLQNVGSFEYGSFATYEKIKAPLAMENLNPAEVFGNIMVEYPYVECTDS 543

Query: 542 SVLGLSFYRKYHDYRQDEVDHAIKIAVKFIKSAQEKDGSWYGCWGICYTYAGMFALEALH 601
           SVLGL+++ K+ DY+++E+   I+IA+++IK +Q  DG WYG WGIC+TYAGMFALEALH
Sbjct: 544 SVLGLTYFHKFFDYKKEEISTCIRIAIEYIKKSQLPDGGWYGSWGICFTYAGMFALEALH 603

Query: 602 NAGESYADSEVVKKGCEFLVSKQLPDGGWSETMKSSELHTYVSDKRSYVVQTAWALIGLL 661
             GE+Y +S  V+KGC+FLVSKQ+ DGGW E+MKSSELH+YV  + S VVQTAWALI LL
Sbjct: 604 TVGETYENSSTVRKGCDFLVSKQMEDGGWGESMKSSELHSYVDSEESLVVQTAWALIALL 663

Query: 662 LADYPDRKVIDRGIQLLKERQLPSGEWKYESIEGVFNHSCAIEYPSYRFVFPIKALGIYS 721
            A+YP R+VIDRGI+LLK RQ  SGEWK+E +EGVFNHSCAIEYPSYRF+FPIKALG+Y+
Sbjct: 664 FAEYPRREVIDRGIELLKHRQEESGEWKFEGVEGVFNHSCAIEYPSYRFLFPIKALGMYT 723

Query: 722 KKYAKDAL 729
           K Y  ++L
Sbjct: 724 KAYEPESL 731

>TBLA0A03120 Chr1 (742618..744849) [2232 bp, 743 aa] {ON} Anc_5.351
           YHR072W
          Length = 743

 Score = 1015 bits (2625), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 456/729 (62%), Positives = 578/729 (79%), Gaps = 3/729 (0%)

Query: 1   MLYSDELGLPTTDSRRWRLFCDEVGAERWEYMDEQETSKVPQTTCVQWLLNVPSFPTPEP 60
           +LYSDEL LP TD RRWRL  D++G E WEY+ E+++ K+PQ+T V+WLL +P FPTP+P
Sbjct: 13  ILYSDELKLPKTDPRRWRLITDKLGRESWEYLSEEDSKKIPQSTFVKWLLQIPDFPTPKP 72

Query: 61  EVSSKDQGFTAANAAYNGARFLGLLQDEASGTFPCSYRGPMFMTIGYVVAMHVGGVVIPE 120
           ++   D+ FT  +A  NGA F  LLQD  SG FPC Y+GPMF+TIGYV   ++ G+ IPE
Sbjct: 73  KIKQGDKNFTTHDALLNGANFFKLLQDPESGIFPCQYKGPMFLTIGYVAVQYIAGIKIPE 132

Query: 121 PQRRELVRYVVNTAHPVDGGWGLHSEDKSTVMGTALNYVLLRLLGMEREHIVMQRARKTL 180
            +R E++RY+VNTAHPVDGGWGLHS DKSTV GT LNYV+LRLLG+ + H V  +ARKTL
Sbjct: 133 HERLEIIRYIVNTAHPVDGGWGLHSVDKSTVFGTVLNYVILRLLGLPKTHPVCVKARKTL 192

Query: 181 LRMGGAIGSPYWGKVWLSVLNLYKWEGVNPAPPELWLLPYQFPYHPARWWVHTRAIFLPM 240
           +R+GGAIGSP+WGK+WLSVLNLYKWEGVNPAPPE WLLPY  P HP RWWVHTR ++LP+
Sbjct: 193 IRLGGAIGSPHWGKIWLSVLNLYKWEGVNPAPPETWLLPYSLPIHPGRWWVHTRGVYLPV 252

Query: 241 SYLAGVRYQCALTPLLEEIRSEIFTRPFEEIDFAANRNNVCGIDLYYPHTTVLNTLNKCI 300
           SYL   ++ C  TPL+EEIR EI+   ++ IDF+ +RN VCG+DLYYPH+ +L+  N  +
Sbjct: 253 SYLGLTKFACPPTPLIEEIRKEIYATEYDTIDFSKHRNTVCGVDLYYPHSKILDVANNIL 312

Query: 301 VGYEKYLRPNWLLKYSLNRIYELIKMEIQNTDYLCIAPVNNALNAIVTCIEEGPDSAEFG 360
           V YEK++RPN++   S  ++ +LI+ EI NTDYLCIAPVN A  ++V  +E+G +S EF 
Sbjct: 313 VFYEKWIRPNFIYNKSKEKVLDLIEKEIANTDYLCIAPVNQAFCSLVILVEKGVNSKEFE 372

Query: 361 RFLDRFKEVLFLGPQGMLVMGTNGVQVWDCAFYIQSMFAANLQDKPEFYENIVRAYRFLC 420
           R   RFK+ LF GPQGM VMGTNGVQ WDCAF +Q  F A L ++PEF + I+R+Y+FLC
Sbjct: 373 RCQYRFKDALFHGPQGMTVMGTNGVQTWDCAFAVQYFFMAGLAERPEFKDLIIRSYKFLC 432

Query: 421 RSQITDDCVPGSYRDPRIGAWPFSTKTQGYAVSDCTAEAAKSVLLVRNSPVFKEVRDEIS 480
           RSQ   +CVPGS+RD RIG W FSTKTQGY VSDCTAE+ K++++VRNSP FKEV DEIS
Sbjct: 433 RSQFDTECVPGSFRDKRIGGWGFSTKTQGYTVSDCTAESIKAIIMVRNSPAFKEVHDEIS 492

Query: 481 SEKLQKAIDALLGLQNLGSFKYGSFASYEKIRAPLSIESLNSAEVFANIMVEHPYVECTD 540
            E+L + I+ L+ LQNLG F+YGSFA+YEKI+APLS+E LN AEVF NIMVE+PYVECTD
Sbjct: 493 DERLYQGIEILMSLQNLGKFEYGSFATYEKIKAPLSMELLNPAEVFCNIMVEYPYVECTD 552

Query: 541 SSVLGLSFYRKYHDYRQDEVDHAIKIAVKFIKSAQEKDGSWYGCWGICYTYAGMFALEAL 600
           SSVLGL+++ K++DY+ DE+   I++A+ +IK AQ  DGSWYG WGIC+TYA MFALEAL
Sbjct: 553 SSVLGLTYFHKHYDYKYDEIGKRIRLAIDYIKRAQNNDGSWYGSWGICFTYASMFALEAL 612

Query: 601 HNAGESYADSEVVKKGCEFLVSKQLPDGGWSETMKSSELHTYVSD---KRSYVVQTAWAL 657
              GE Y +SE VKKGC+F+VSKQ  DGGWSETMKSSE+H YV     + SYVVQT+W++
Sbjct: 613 ETIGEDYNNSETVKKGCDFIVSKQNKDGGWSETMKSSEIHYYVDSGDLEGSYVVQTSWSV 672

Query: 658 IGLLLADYPDRKVIDRGIQLLKERQLPSGEWKYESIEGVFNHSCAIEYPSYRFVFPIKAL 717
           IGL+LA+YPD+ V+ RGI+ +K +QLPSGEW+++++EGVFNHSC IEYPSYRF+FPIKAL
Sbjct: 673 IGLILANYPDKDVVYRGIEYIKSQQLPSGEWEFQNVEGVFNHSCGIEYPSYRFLFPIKAL 732

Query: 718 GIYSKKYAK 726
           G+Y  +Y +
Sbjct: 733 GLYRTRYCQ 741

>CAGL0J10824g Chr10 complement(1056204..1058405) [2202 bp, 733 aa]
           {ON} highly similar to uniprot|P38604 Saccharomyces
           cerevisiae YHR072w ERG7 lanosterol synthase
          Length = 733

 Score = 1001 bits (2589), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 471/722 (65%), Positives = 566/722 (78%), Gaps = 2/722 (0%)

Query: 2   LYSDELGLPTTDSRRWRLFCDEVGAERWEYMDEQETSKVPQTTCVQWLLNVPSFPTPEPE 61
            YSD +G+P TD +RWRL   E+G E WEY+++ +    PQ+T VQWLL    FPTP P 
Sbjct: 4   FYSDTVGIPRTDPKRWRLRTTELGREAWEYIEQDKVDADPQSTFVQWLLQDEEFPTPSPR 63

Query: 62  VSSKDQGFTAANAAYNGARFLGLLQDEASGTFPCSYRGPMFMTIGYVVAMHVGGVVIPEP 121
               D   ++  A Y GA F  LLQD+ SG FPC Y+GPMFMTIGYV   ++ GV +PE 
Sbjct: 64  KEGDD--LSSEQACYYGASFYKLLQDQKSGIFPCQYKGPMFMTIGYVAVNYIAGVKLPEH 121

Query: 122 QRRELVRYVVNTAHPVDGGWGLHSEDKSTVMGTALNYVLLRLLGMEREHIVMQRARKTLL 181
           +R EL+RY+VNTAHPVDGGWGLHS DKSTV GT LNYV LRLLG+ ++HIV  RAR TL 
Sbjct: 122 ERIELIRYIVNTAHPVDGGWGLHSVDKSTVFGTVLNYVCLRLLGLPKDHIVCVRARHTLH 181

Query: 182 RMGGAIGSPYWGKVWLSVLNLYKWEGVNPAPPELWLLPYQFPYHPARWWVHTRAIFLPMS 241
           R+GGA G+P+WGK+WLS+LNLYKWEGVNPAPPE WLLPY  P HP RWWVHTRA++LP+S
Sbjct: 182 RLGGATGAPHWGKIWLSILNLYKWEGVNPAPPETWLLPYSLPIHPGRWWVHTRAVYLPVS 241

Query: 242 YLAGVRYQCALTPLLEEIRSEIFTRPFEEIDFAANRNNVCGIDLYYPHTTVLNTLNKCIV 301
           YL+ ++Y C LT LL EIR EI+T+ F++I+F+ +RN VCG+DLYYPH+ +L+T N  IV
Sbjct: 242 YLSLIKYSCPLTDLLSEIRQEIYTKSFDKINFSQHRNTVCGVDLYYPHSKILDTANDVIV 301

Query: 302 GYEKYLRPNWLLKYSLNRIYELIKMEIQNTDYLCIAPVNNALNAIVTCIEEGPDSAEFGR 361
            YEKYLRP  +   S   +Y LIK EIQNTD LCIAPVN A  A+VT +EEG DS  F R
Sbjct: 302 FYEKYLRPRLVSMASKKVVYNLIKKEIQNTDSLCIAPVNQAFCALVTYLEEGKDSKAFER 361

Query: 362 FLDRFKEVLFLGPQGMLVMGTNGVQVWDCAFYIQSMFAANLQDKPEFYENIVRAYRFLCR 421
           F  RFK+ LF GPQGM VMGTNGVQ WDCAF IQ  F A L +KPEF E I+ AY+FLCR
Sbjct: 362 FQYRFKDGLFHGPQGMTVMGTNGVQTWDCAFMIQYFFVAGLAEKPEFREMIINAYKFLCR 421

Query: 422 SQITDDCVPGSYRDPRIGAWPFSTKTQGYAVSDCTAEAAKSVLLVRNSPVFKEVRDEISS 481
           SQ   +CV GS+RD R+GAW FSTKTQGY VSDCTAEA K++++VRNSPVF  V DEI+ 
Sbjct: 422 SQFDTECVEGSFRDKRVGAWGFSTKTQGYTVSDCTAEAIKAIIMVRNSPVFSSVHDEITD 481

Query: 482 EKLQKAIDALLGLQNLGSFKYGSFASYEKIRAPLSIESLNSAEVFANIMVEHPYVECTDS 541
           E+L K ID LL LQN+G F+YGSFA+YEKI+APLS+E LN AEVF NIMVE+PYVECTDS
Sbjct: 482 ERLCKGIDVLLSLQNIGKFEYGSFATYEKIKAPLSMEKLNPAEVFGNIMVEYPYVECTDS 541

Query: 542 SVLGLSFYRKYHDYRQDEVDHAIKIAVKFIKSAQEKDGSWYGCWGICYTYAGMFALEALH 601
           SVLGL+++ KY+DYR+DE+ H I+IA+ +IK AQ+ DG WYGCWGIC+TYAGMFA+EALH
Sbjct: 542 SVLGLTYFHKYYDYRKDEISHRIRIAIDYIKQAQQDDGGWYGCWGICFTYAGMFAMEALH 601

Query: 602 NAGESYADSEVVKKGCEFLVSKQLPDGGWSETMKSSELHTYVSDKRSYVVQTAWALIGLL 661
           + GE+Y +S  V+KGC+FL+SKQ+PDGGW E+MKSSELH YV   +S VVQTAWALI LL
Sbjct: 602 SVGETYDNSLTVRKGCDFLLSKQMPDGGWGESMKSSELHDYVDSPKSLVVQTAWALIALL 661

Query: 662 LADYPDRKVIDRGIQLLKERQLPSGEWKYESIEGVFNHSCAIEYPSYRFVFPIKALGIYS 721
           LA  P+   I+RGI LLK RQ PSGEWK+ES EGVFNHSCAIEYPSYRF+FPIKALG+Y+
Sbjct: 662 LAKCPNEDAIERGINLLKSRQQPSGEWKFESAEGVFNHSCAIEYPSYRFLFPIKALGLYN 721

Query: 722 KK 723
            +
Sbjct: 722 GR 723

>ZYRO0D10164g Chr4 (854166..856364) [2199 bp, 732 aa] {ON} highly
           similar to uniprot|P38604 Saccharomyces cerevisiae
           YHR072W ERG7 Lanosterol synthase an essential enzyme
           that catalyzes the cyclization of squalene 2 3- epoxide
           a step in ergosterol biosynthesis
          Length = 732

 Score = 1000 bits (2585), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 455/729 (62%), Positives = 571/729 (78%), Gaps = 1/729 (0%)

Query: 2   LYSDELGLPTTDSRRWRLFCDEVGAERWEYMDEQETSKVPQTTCVQWLLNVPSFPTPEPE 61
           LYS+EL L  TD   WRL  D++G E WEY+ +++    PQ+  VQWLL +PSFP P P+
Sbjct: 4   LYSEELQLERTDPNLWRLRVDKLGRESWEYISKEDAKNDPQSKYVQWLLQLPSFPKPSPK 63

Query: 62  VSSKD-QGFTAANAAYNGARFLGLLQDEASGTFPCSYRGPMFMTIGYVVAMHVGGVVIPE 120
           + S + + F A  A  NGA F  LLQD  SG FPC Y+GPMFMTIGYVV  +V G+ IP+
Sbjct: 64  IHSGNAKKFNALEACKNGASFYQLLQDPDSGIFPCQYKGPMFMTIGYVVVHYVAGIEIPK 123

Query: 121 PQRRELVRYVVNTAHPVDGGWGLHSEDKSTVMGTALNYVLLRLLGMEREHIVMQRARKTL 180
           P+R E++RY+VNT+HPVDGGWGLHS DKSTV GTA+NYV LRLLG+ R+H V  +AR+TL
Sbjct: 124 PKRLEMIRYIVNTSHPVDGGWGLHSTDKSTVFGTAINYVNLRLLGLPRDHPVCVKARRTL 183

Query: 181 LRMGGAIGSPYWGKVWLSVLNLYKWEGVNPAPPELWLLPYQFPYHPARWWVHTRAIFLPM 240
            ++GGA+G+P+WGK+WLSVLNLYKWEGVNPAPPE WLLPY  P HP RWWVHTRAI+LP+
Sbjct: 184 HKLGGALGAPHWGKIWLSVLNLYKWEGVNPAPPETWLLPYFLPIHPGRWWVHTRAIYLPV 243

Query: 241 SYLAGVRYQCALTPLLEEIRSEIFTRPFEEIDFAANRNNVCGIDLYYPHTTVLNTLNKCI 300
           SYL+ +RYQC LTPLL+E+R E++ +PF  IDF +NRN VCG+DLYYPH+ VL+ +N  +
Sbjct: 244 SYLSLIRYQCPLTPLLQELREELYVKPFNSIDFGSNRNTVCGVDLYYPHSKVLDLMNSVL 303

Query: 301 VGYEKYLRPNWLLKYSLNRIYELIKMEIQNTDYLCIAPVNNALNAIVTCIEEGPDSAEFG 360
           V YEK+LR NW+   + NR+Y LIK EI NTDYLCIAPVN A  A+VT IEEG +S +F 
Sbjct: 304 VFYEKHLRFNWINTMAKNRVYGLIKKEIANTDYLCIAPVNQAFCALVTLIEEGVNSPQFK 363

Query: 361 RFLDRFKEVLFLGPQGMLVMGTNGVQVWDCAFYIQSMFAANLQDKPEFYENIVRAYRFLC 420
           RF  RF + LF GPQGM +MGTNGVQ WDCAF IQS+F A L +K ++YE +VRAY FL 
Sbjct: 364 RFQFRFNDALFHGPQGMTMMGTNGVQTWDCAFTIQSLFTAGLAEKEQYYETVVRAYEFLN 423

Query: 421 RSQITDDCVPGSYRDPRIGAWPFSTKTQGYAVSDCTAEAAKSVLLVRNSPVFKEVRDEIS 480
           R+Q  D+CVPGS+RD R GAW FSTKTQGY VSDCTAE+ K++++V+ SP + +V   I 
Sbjct: 424 RAQFQDECVPGSFRDLRKGAWGFSTKTQGYTVSDCTAESIKAIIMVKKSPFYAKVHSLID 483

Query: 481 SEKLQKAIDALLGLQNLGSFKYGSFASYEKIRAPLSIESLNSAEVFANIMVEHPYVECTD 540
            E+L +AID LL LQN+G F+YGSFA+YE I+APL +E LN AEVF NIMVE+PYVECTD
Sbjct: 484 DERLCQAIDVLLSLQNVGPFEYGSFATYEMIKAPLLMEKLNPAEVFGNIMVEYPYVECTD 543

Query: 541 SSVLGLSFYRKYHDYRQDEVDHAIKIAVKFIKSAQEKDGSWYGCWGICYTYAGMFALEAL 600
           S+VLGL+ +  Y DYR+DE+   I IAV +IK  Q +DGSWYGCWG+C+TYAGMFALEAL
Sbjct: 544 SAVLGLTSFHDYCDYRRDEISDRINIAVDYIKKCQNEDGSWYGCWGVCFTYAGMFALEAL 603

Query: 601 HNAGESYADSEVVKKGCEFLVSKQLPDGGWSETMKSSELHTYVSDKRSYVVQTAWALIGL 660
           H+ GE Y +S++V+KGC+FLV +Q+ DGGW ETMKS ELHTYV  + S VVQT+W +I L
Sbjct: 604 HSVGEDYHNSKIVQKGCDFLVDRQMADGGWGETMKSCELHTYVESQESMVVQTSWVIIAL 663

Query: 661 LLADYPDRKVIDRGIQLLKERQLPSGEWKYESIEGVFNHSCAIEYPSYRFVFPIKALGIY 720
           LL+ YP++ VIDR ++ L+ RQ  SGEWK++ +EGVFNHSCAIEYP+YRF+FPIKALG+Y
Sbjct: 664 LLSKYPNKSVIDRAVKFLETRQERSGEWKFDGVEGVFNHSCAIEYPNYRFIFPIKALGLY 723

Query: 721 SKKYAKDAL 729
              + K+A+
Sbjct: 724 VNAFGKEAI 732

>Skud_8.131 Chr8 (212610..214805) [2196 bp, 731 aa] {ON} YHR072W
           (REAL)
          Length = 731

 Score =  998 bits (2579), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 458/728 (62%), Positives = 575/728 (78%)

Query: 2   LYSDELGLPTTDSRRWRLFCDEVGAERWEYMDEQETSKVPQTTCVQWLLNVPSFPTPEPE 61
            YS+ +GLP TD R WRL  DE+G E WEY+  ++ +  P +T  QWLL  P+F  P+P 
Sbjct: 4   FYSERIGLPKTDPRLWRLRTDELGRESWEYLTPEQAANEPPSTFTQWLLQDPNFSQPQPG 63

Query: 62  VSSKDQGFTAANAAYNGARFLGLLQDEASGTFPCSYRGPMFMTIGYVVAMHVGGVVIPEP 121
            +     F+A +A +NGA F  LLQD  SG FPC Y+GPMF+TIGYV   ++ GV IPE 
Sbjct: 64  RNKHSPDFSAFDACHNGASFFQLLQDPKSGIFPCQYKGPMFLTIGYVAVNYIAGVQIPEH 123

Query: 122 QRRELVRYVVNTAHPVDGGWGLHSEDKSTVMGTALNYVLLRLLGMEREHIVMQRARKTLL 181
           +R E++RY+VNTAHPVDGGWGLHS DKSTV GT LNYV+LRLLG+ ++H V  +AR TLL
Sbjct: 124 ERIEIIRYIVNTAHPVDGGWGLHSVDKSTVFGTVLNYVILRLLGLPKDHPVCTKARGTLL 183

Query: 182 RMGGAIGSPYWGKVWLSVLNLYKWEGVNPAPPELWLLPYQFPYHPARWWVHTRAIFLPMS 241
           R+GGAIGSP+WGK+WLS LNLYKWEGVNPAPPE WLLPY  P HP RWWVHTR +++P+S
Sbjct: 184 RLGGAIGSPHWGKIWLSALNLYKWEGVNPAPPETWLLPYSLPMHPGRWWVHTRGVYIPVS 243

Query: 242 YLAGVRYQCALTPLLEEIRSEIFTRPFEEIDFAANRNNVCGIDLYYPHTTVLNTLNKCIV 301
           YL+ V++ C +TPLLEEIR EI+T+PF++IDF+ +RN VCG+DLYYPH+  L+  N  +V
Sbjct: 244 YLSLVKFSCPMTPLLEEIRKEIYTKPFDKIDFSNHRNTVCGVDLYYPHSRTLDIANNFVV 303

Query: 302 GYEKYLRPNWLLKYSLNRIYELIKMEIQNTDYLCIAPVNNALNAIVTCIEEGPDSAEFGR 361
            YEKYLR  ++   S  ++Y+LIK EI+NTD LCIAPVN A  A+VT IEEG DS  F +
Sbjct: 304 FYEKYLRNRFIYSLSKRKVYDLIKTEIENTDSLCIAPVNQAFCALVTFIEEGVDSQAFKK 363

Query: 362 FLDRFKEVLFLGPQGMLVMGTNGVQVWDCAFYIQSMFAANLQDKPEFYENIVRAYRFLCR 421
           F  RFK+ LF GPQGM +MGTNGVQ WDCAF IQ  F A L ++PEFY  IV AY+FLCR
Sbjct: 364 FQYRFKDALFHGPQGMTIMGTNGVQTWDCAFAIQYFFIAGLAERPEFYNTIVSAYKFLCR 423

Query: 422 SQITDDCVPGSYRDPRIGAWPFSTKTQGYAVSDCTAEAAKSVLLVRNSPVFKEVRDEISS 481
           +Q   +CVPGS+R+ R G+W FSTKTQGY V+DCTAE+ K++++V+NSPVF EV   I+S
Sbjct: 424 AQFDTECVPGSFREKRKGSWGFSTKTQGYTVADCTAESIKAIIMVKNSPVFSEVHHLITS 483

Query: 482 EKLQKAIDALLGLQNLGSFKYGSFASYEKIRAPLSIESLNSAEVFANIMVEHPYVECTDS 541
           E+L + ID LL LQN+GSF+YGSFA+YEKI+APL++E LN AEVF NIMVE+PYVECTDS
Sbjct: 484 ERLFEGIDVLLSLQNVGSFEYGSFATYEKIKAPLAMEILNPAEVFGNIMVEYPYVECTDS 543

Query: 542 SVLGLSFYRKYHDYRQDEVDHAIKIAVKFIKSAQEKDGSWYGCWGICYTYAGMFALEALH 601
           SVLGL+++ K+ DY+++E+   I+IA+++IK AQ  DGSWYG WGIC+TYAGMFA+EALH
Sbjct: 544 SVLGLTYFHKFFDYKKEEIRRRIRIAIEYIKRAQSPDGSWYGSWGICFTYAGMFAMEALH 603

Query: 602 NAGESYADSEVVKKGCEFLVSKQLPDGGWSETMKSSELHTYVSDKRSYVVQTAWALIGLL 661
             GE+Y +S  V+KGC+FLVSKQ+ DGGW E+MKSSELH+YV   +S VVQ+AWALI L 
Sbjct: 604 TVGENYENSSTVRKGCDFLVSKQMKDGGWGESMKSSELHSYVDSGKSLVVQSAWALIALF 663

Query: 662 LADYPDRKVIDRGIQLLKERQLPSGEWKYESIEGVFNHSCAIEYPSYRFVFPIKALGIYS 721
            A+YP+++VIDRGI+LLK RQ  SGEWK+ES+EGVFNHSCAIEYPSYRF+FPIKALG+Y+
Sbjct: 664 FAEYPNKEVIDRGIELLKNRQEESGEWKFESVEGVFNHSCAIEYPSYRFLFPIKALGMYA 723

Query: 722 KKYAKDAL 729
           K Y +  L
Sbjct: 724 KAYEQPGL 731

>YBR213W Chr2 (650368..651192) [825 bp, 274 aa] {ON}
           MET8Bifunctional dehydrogenase and ferrochelatase,
           involved in the biosynthesis of siroheme, a prosthetic
           group used by sulfite reductase; required for sulfate
           assimilation and methionine biosynthesis
          Length = 274

 Score = 35.4 bits (80), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 34/54 (62%), Gaps = 3/54 (5%)

Query: 304 EKYLRPNWLLKYSLNRIYELIKMEIQNTDYLCIAPVNNALNAIVTCIEEGPDSA 357
           ++++ PNW    + N IYE I+ + ++ +YL +   N+A   I+TCI + P+SA
Sbjct: 71  KRFINPNW--DPTKNEIYEYIRSDFKD-EYLDLEDENDAWYIIMTCIPDHPESA 121

>AGR380C Chr7 complement(1431745..1435041) [3297 bp, 1098 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGL151W
           (NUT1)
          Length = 1098

 Score = 33.1 bits (74), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 29/123 (23%), Positives = 53/123 (43%), Gaps = 21/123 (17%)

Query: 299 CIVGYEKYLRPNWLLKY----------------SLNRIYELIKMEIQNTDYLC-IAPVNN 341
           C+ GYEK+ R   ++++                S +  +E I   +  T  LC I  V +
Sbjct: 558 CLTGYEKFARA--VIRFIDVIWESNKSKSNDMVSDDSEFENINSAMAYTLSLCFIIHVVD 615

Query: 342 ALNAIVTCIEEGPDSAEFGRFLDRFKEV--LFLGPQGMLVMGTNGVQVWDCAFYIQSMFA 399
                V  + E P  +   RFL +  E+  +F+ P+G L      +Q W    +++++ +
Sbjct: 616 IYGVNVEALVENPSKSTVLRFLSKLGEIPEVFVAPEGDLESSKTLLQQWLRELFVKNLIS 675

Query: 400 ANL 402
            NL
Sbjct: 676 DNL 678

>Smik_11.370 Chr11 (653235..654554) [1320 bp, 440 aa] {ON} YKR106W
           (REAL)
          Length = 440

 Score = 32.7 bits (73), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 28/94 (29%), Positives = 39/94 (41%), Gaps = 10/94 (10%)

Query: 139 GGWGLHSE--DKSTVMG------TALNYVLLRLLGMEREHIVMQRARKTLLRMGGAIGSP 190
           GG+G H      S +MG      +    VLL+ +       VM     T  R+G A+G+ 
Sbjct: 297 GGYGSHGGVISASVIMGFSGLLCSNSVIVLLQAMTTHSRMAVMTGIHYTFSRIGAAVGAS 356

Query: 191 YWGKVWLSVL--NLYKWEGVNPAPPELWLLPYQF 222
             G VW   +   LYK  G +    E +  PY F
Sbjct: 357 VSGGVWTQTMPSRLYKLLGNDTLAAEAYESPYSF 390

>Ecym_2807 Chr2 complement(1567027..1567992) [966 bp, 321 aa] {ON}
           similar to Ashbya gossypii AEL268W
          Length = 321

 Score = 32.3 bits (72), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 47/184 (25%), Positives = 73/184 (39%), Gaps = 26/184 (14%)

Query: 520 LNSAEVFANIMVEHPYVECTDSSVLGLSFYRKY----------------HDYRQDEVDHA 563
           L++++VF    V      C DS   G S Y+ +                +D   +  D  
Sbjct: 45  LDASDVFDRDEVIEFVKSCWDSETGGFSAYKDHDAHLVTTLSALQILATYDALHELSDTE 104

Query: 564 IKIAVKFIKSAQEKDGSWYGC-WGICYTYAGMFALEALHNAGESYADSEVVKKGCEFLVS 622
           +   V+FIK  Q  DGS+ G  +G   T     AL +L   G      EVV    EF+  
Sbjct: 105 VDACVEFIKGNQLADGSFQGDRFGEVDTRFSYTALSSLSILGR--LTPEVVDPAVEFIKR 162

Query: 623 KQLPDGGWSETMKSSELHTYVSDKRSYVVQTAWALIGLLLADYPDRKVIDRGIQLLKERQ 682
               DGG+      +E H      +++    A A++   L+D  + ++      L  ERQ
Sbjct: 163 CYNFDGGFG-LCPGAESHA----AQAFTCVGALAIVN-RLSDLTEEQITTIACWLC-ERQ 215

Query: 683 LPSG 686
           +P G
Sbjct: 216 VPEG 219

>TBLA0F04110 Chr6 (1018165..1019841) [1677 bp, 558 aa] {ON}
           Anc_6.338 YNR030W
          Length = 558

 Score = 32.3 bits (72), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 18/79 (22%), Positives = 34/79 (43%), Gaps = 4/79 (5%)

Query: 404 DKPEFYENIVRAYRFLCRSQITDDCVPGSYRDPRIGAWPFSTKTQGYAVSDCTAEAAKSV 463
           +KPE    +  ++ +L  S+ + D  P    D   G W     T  ++  D  +     +
Sbjct: 458 EKPEQLIELWPSFEYLIMSEPSSDLFPAELNDT--GNWEIINTTTTFSYVD--SSFLMKI 513

Query: 464 LLVRNSPVFKEVRDEISSE 482
           L   N  +F+ ++D + SE
Sbjct: 514 LFTENKNIFRTIKDVVDSE 532

>Smik_6.195 Chr6 (325513..326937) [1425 bp, 474 aa] {ON} YGR108W
           (REAL)
          Length = 474

 Score = 31.6 bits (70), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 31/59 (52%), Gaps = 1/59 (1%)

Query: 606 SYADSEVVKKGCEFLVSKQLPDGGWSETMKSSELHTYVSDKRSYVVQTAWALIGLLLAD 664
           S+ DSE  KK   F   + +P+ G+SE  K  + H Y+ D   +   TA +  GL+ ++
Sbjct: 84  SFNDSEEEKKREMFNNKENIPEYGYSEQRKEQQKH-YLKDDSIHTSSTALSCNGLVYSE 141

>Smik_2.356 Chr2 (636565..637389) [825 bp, 274 aa] {ON} YBR213W
           (REAL)
          Length = 274

 Score = 31.2 bits (69), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 32/54 (59%), Gaps = 3/54 (5%)

Query: 304 EKYLRPNWLLKYSLNRIYELIKMEIQNTDYLCIAPVNNALNAIVTCIEEGPDSA 357
           ++ +  NW    S N IYE I  E ++ +YL +   N+A + I+TCI + P+SA
Sbjct: 71  KRIVNRNW--DSSKNEIYEYICDEFKD-EYLDLDDGNDAWHIILTCIPDHPESA 121

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.137    0.431 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 78,389,402
Number of extensions: 3391964
Number of successful extensions: 7112
Number of sequences better than 10.0: 32
Number of HSP's gapped: 7220
Number of HSP's successfully gapped: 32
Length of query: 729
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 612
Effective length of database: 40,065,477
Effective search space: 24520071924
Effective search space used: 24520071924
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 70 (31.6 bits)