Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
AGR349W5.349ON24224212950.0
Ecym_81845.349ON2482457026e-93
YDR318W (MCM21)5.349ON3682424205e-49
Skud_4.5845.349ON3682424136e-48
Suva_2.4875.349ON3682184092e-47
Smik_4.5775.349ON3682384066e-47
TDEL0E027805.349ON3472433777e-43
ZYRO0D10120g5.349ON3292343706e-42
SAKL0G08888g5.349ON3792383693e-41
KLTH0H14806g5.349ON3462363576e-40
KNAG0C055205.349ON3852423589e-40
Kpol_1051.55.349ON3702493518e-39
Kwal_34.159865.349ON2312383313e-37
KAFR0C018705.349ON3412473271e-35
TBLA0H019805.349ON3591913272e-35
CAGL0H07139g5.349ON3582443212e-34
TPHA0D020705.349ON3732562906e-30
KLLA0B10142g5.349ON2932172324e-22
NCAS0F028505.349ON2811652227e-21
NDAI0I015505.349ON2761551982e-17
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AGR349W
         (242 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AGR349W Chr7 (1379849..1380577) [729 bp, 242 aa] {ON} Syntenic h...   503   0.0  
Ecym_8184 Chr8 complement(382634..383380) [747 bp, 248 aa] {ON} ...   275   6e-93
YDR318W Chr4 (1103758..1103809,1103893..1104947) [1107 bp, 368 a...   166   5e-49
Skud_4.584 Chr4 (1040035..1040086,1040162..1040345,1040376..1041...   163   6e-48
Suva_2.487 Chr2 (861131..861182,861257..861446,861477..862341) [...   162   2e-47
Smik_4.577 Chr4 (1030208..1030259,1030337..1030526,1030557..1031...   160   6e-47
TDEL0E02780 Chr5 complement(534940..535931,535996..536047) [1044...   149   7e-43
ZYRO0D10120g Chr4 (852141..852192,852258..853195) [990 bp, 329 a...   147   6e-42
SAKL0G08888g Chr7 complement(760335..761422,761488..761539) [114...   146   3e-41
KLTH0H14806g Chr8 (1285442..1285493,1285556..1286544) [1041 bp, ...   142   6e-40
KNAG0C05520 Chr3 complement(1072299..1073456) [1158 bp, 385 aa] ...   142   9e-40
Kpol_1051.5 s1051 (10484..11596) [1113 bp, 370 aa] {ON} (10484.....   139   8e-39
Kwal_34.15986 s34 complement(145905..146600) [696 bp, 231 aa] {O...   132   3e-37
KAFR0C01870 Chr3 complement(372621..373594,373748..373799) [1026...   130   1e-35
TBLA0H01980 Chr8 complement(466993..468020,468148..468199) [1080...   130   2e-35
CAGL0H07139g Chr8 complement(703350..704426) [1077 bp, 358 aa] {...   128   2e-34
TPHA0D02070 Chr4 (426798..427919) [1122 bp, 373 aa] {ON} Anc_5.3...   116   6e-30
KLLA0B10142g Chr2 (887476..887527,887649..888478) [882 bp, 293 a...    94   4e-22
NCAS0F02850 Chr6 (571260..572105) [846 bp, 281 aa] {ON} Anc_5.34...    90   7e-21
NDAI0I01550 Chr9 (368193..369023) [831 bp, 276 aa] {ON} Anc_5.34...    81   2e-17

>AGR349W Chr7 (1379849..1380577) [729 bp, 242 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR318W (MCM21)
          Length = 242

 Score =  503 bits (1295), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 242/242 (100%), Positives = 242/242 (100%)

Query: 1   MFDPALAPFLDTELLRSPSKRGKILSTRPEQSKQRELRNFIEVENCYRMCGITFFPLVDP 60
           MFDPALAPFLDTELLRSPSKRGKILSTRPEQSKQRELRNFIEVENCYRMCGITFFPLVDP
Sbjct: 1   MFDPALAPFLDTELLRSPSKRGKILSTRPEQSKQRELRNFIEVENCYRMCGITFFPLVDP 60

Query: 61  GRLGGQDKDNEGIVNEMLGIRLEVFNENTRRFDYPYYVLLRRDAKVATRWQLFKHTLPKM 120
           GRLGGQDKDNEGIVNEMLGIRLEVFNENTRRFDYPYYVLLRRDAKVATRWQLFKHTLPKM
Sbjct: 61  GRLGGQDKDNEGIVNEMLGIRLEVFNENTRRFDYPYYVLLRRDAKVATRWQLFKHTLPKM 120

Query: 121 LDAERIWSTTLNGAICSDSDVYLFAKKCYARLIDMHFRLQFIARLDPYLFENIRTDSYAA 180
           LDAERIWSTTLNGAICSDSDVYLFAKKCYARLIDMHFRLQFIARLDPYLFENIRTDSYAA
Sbjct: 121 LDAERIWSTTLNGAICSDSDVYLFAKKCYARLIDMHFRLQFIARLDPYLFENIRTDSYAA 180

Query: 181 MLSFLISGGAQPLAVTVLLEGREVRSCQLDQQQHDEWAHVLVGALADLPNKVRVLKGNVV 240
           MLSFLISGGAQPLAVTVLLEGREVRSCQLDQQQHDEWAHVLVGALADLPNKVRVLKGNVV
Sbjct: 181 MLSFLISGGAQPLAVTVLLEGREVRSCQLDQQQHDEWAHVLVGALADLPNKVRVLKGNVV 240

Query: 241 PG 242
           PG
Sbjct: 241 PG 242

>Ecym_8184 Chr8 complement(382634..383380) [747 bp, 248 aa] {ON}
           similar to Ashbya gossypii AGR349W
          Length = 248

 Score =  275 bits (702), Expect = 6e-93,   Method: Compositional matrix adjust.
 Identities = 127/245 (51%), Positives = 175/245 (71%), Gaps = 11/245 (4%)

Query: 1   MFDPALAPFLDTELLRSPSKRGKIL-----STRPEQSKQRELRNFIEVENCYRMCGITFF 55
           MFDP +A F DTE++RSPSKR K++     S RP+     EL  F+E+ENCYRM GITFF
Sbjct: 9   MFDPTIASFFDTEIVRSPSKRNKLMKSSATSIRPDN----ELEKFVEIENCYRMSGITFF 64

Query: 56  PLVDPGRLGGQ-DKDNEGIVNEMLGIRLEVFNENTRRFDYPYYVLLRRDAKVATRWQLFK 114
           PLVDPG+L      D+  +V E+LGIRLEVFNE T +++ PYY++L+R  K    W L+K
Sbjct: 65  PLVDPGKLASNTHHDSTSLVAELLGIRLEVFNETTLKYEPPYYIILKRRPKANQIWDLYK 124

Query: 115 HTLPKMLDAERIWSTTLNGAICSDSDVYLFAKKCYARLIDMHFRLQFIARLDPYLFENIR 174
           HT+PK++D E+IWSTT +G I  D +VY+FAKKCY  L+ +H+RLQFI  LDP LFENI+
Sbjct: 125 HTIPKVIDIEQIWSTTGHGIISMDKEVYIFAKKCYMELLAIHYRLQFICNLDPQLFENIK 184

Query: 175 TDSYAAMLSFLISGGAQPLAVTVLLEGREVRSCQLDQQQHDEWAHVLVGALADLPNKVRV 234
            DSYA MLSF ++ G + + V   L  R +  C +D ++H+EW+ +++G L DLP+K+ +
Sbjct: 185 VDSYAVMLSFQLT-GEEIITVVAQLRDRSIIDCDIDIERHNEWSKIILGPLVDLPDKILI 243

Query: 235 LKGNV 239
           L+G+V
Sbjct: 244 LQGSV 248

>YDR318W Chr4 (1103758..1103809,1103893..1104947) [1107 bp, 368 aa]
           {ON}  MCM21Protein involved in minichromosome
           maintenance; component of the COMA complex (Ctf19p,
           Okp1p, Mcm21p, Ame1p) that bridges kinetochore subunits
           that are in contact with centromeric DNA and the
           subunits bound to microtubules
          Length = 368

 Score =  166 bits (420), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 96/242 (39%), Positives = 142/242 (58%), Gaps = 15/242 (6%)

Query: 1   MFDPALAPFLDTELLRSPSKRGKILSTRPEQSKQR-ELRNFIEVENCYRMCGITFFPLVD 59
           MFDP +A  LDT++L SPSKR + L      +  R EL ++I +EN YRM GITFFPLVD
Sbjct: 123 MFDPGVADLLDTDILTSPSKRKRKLKIDDISTSDRSELEDYIVLENVYRMFGITFFPLVD 182

Query: 60  PGRLGGQDKDNEGIVN-EMLGIRLEVFNENTRRFDYPYYVLLRRDAKVATRWQLFKHTLP 118
           P  L  +D   E  V+ EMLGIRLEVF+E T +F+ P+YVLL++  K +  W LFKHT+P
Sbjct: 183 PIDLKIKDASGEIFVDREMLGIRLEVFSERTSQFEKPHYVLLKKRIK-SNSWFLFKHTIP 241

Query: 119 KMLDAERIWSTTLNGAICSDSDVYLFAKKCYARLIDMHFRLQFIARLDP-YLFENIRTDS 177
             +D + I+  T  G + S  D YLFAK+ + +L+++  R Q    L+   +  ++  D 
Sbjct: 242 SFIDVQGIFDDTNGGLVISHDDAYLFAKRVFLQLVEVQKRRQIFKDLEAKKIIHDLDLDL 301

Query: 178 YAAMLSFLISGGAQPLAVTVLLEGREVRSCQLDQQQHD-------EWAHVLVGALADLPN 230
            ++M+SF +      + V + ++  E+ SC +    HD       +W   L+G+L DL  
Sbjct: 302 ESSMVSFFVKD----IKVELFVKQNEIVSCSILDDIHDFSQNNKSKWEIALLGSLDDLEL 357

Query: 231 KV 232
           K+
Sbjct: 358 KL 359

>Skud_4.584 Chr4
           (1040035..1040086,1040162..1040345,1040376..1041246)
           [1107 bp, 368 aa] {ON} YDR318W (REAL)
          Length = 368

 Score =  163 bits (413), Expect = 6e-48,   Method: Compositional matrix adjust.
 Identities = 94/242 (38%), Positives = 147/242 (60%), Gaps = 15/242 (6%)

Query: 1   MFDPALAPFLDTELLRSPSKRGKILSTRP-EQSKQRELRNFIEVENCYRMCGITFFPLVD 59
           MFD A+A  LDT++L SPSKR + L     + S + +L + I +EN YRM GITFFPLVD
Sbjct: 123 MFDSAVADLLDTDILTSPSKRKRKLKIADIDTSDRNDLEDSIIMENVYRMFGITFFPLVD 182

Query: 60  PGRLGGQDKDNEGIVN-EMLGIRLEVFNENTRRFDYPYYVLLRRDAKVATRWQLFKHTLP 118
           P  L  +D  +E  V+ EMLGIRLEVF+E   +F+ P+Y+LL++  K +  W LFKHT+P
Sbjct: 183 PADLKIKDVSDEIFVDREMLGIRLEVFSERKSKFEKPHYILLKKRIK-SNSWFLFKHTIP 241

Query: 119 KMLDAERIWSTTLNGAICSDSDVYLFAKKCYARLIDMHFRLQFIARLD-PYLFENIRTDS 177
             +D + I++ T  G + S  +VYLFAK+ + +L+++  R Q    L+   +  ++  D 
Sbjct: 242 SFIDVQGIFNETNGGLVISHDNVYLFAKRVFLQLVEIQKRQQKFKDLEAKKIIHDLDLDL 301

Query: 178 YAAMLSFLISGGAQPLAVTVLLEGREVRSCQLDQQQHD-------EWAHVLVGALADLPN 230
            ++M+SF +    + + V + ++  E+ SC +  + HD       +W  VL+G+L DL  
Sbjct: 302 QSSMVSFFV----KDVKVELFVKQNEIVSCSILDEIHDFSRKNKSKWEIVLLGSLDDLEL 357

Query: 231 KV 232
           K+
Sbjct: 358 KL 359

>Suva_2.487 Chr2 (861131..861182,861257..861446,861477..862341)
           [1107 bp, 368 aa] {ON} YDR318W (REAL)
          Length = 368

 Score =  162 bits (409), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 90/218 (41%), Positives = 133/218 (61%), Gaps = 8/218 (3%)

Query: 1   MFDPALAPFLDTELLRSPSKRGKILSTRP-EQSKQRELRNFIEVENCYRMCGITFFPLVD 59
           MFD  +A  LDTE+L SPSKR + L+      S +  L + I +EN YRM GITFFPLVD
Sbjct: 123 MFDSDVADLLDTEILTSPSKRKRKLNLEEINTSDKSMLEDSIILENIYRMFGITFFPLVD 182

Query: 60  PGRLGGQDKDNEGIVN-EMLGIRLEVFNENTRRFDYPYYVLLRRDAKVATRWQLFKHTLP 118
           P  L  +D  +E +V+ EMLGIRLEVFNE T +F+ P+Y+LL++  K +  W LFKHT+P
Sbjct: 183 PIDLKMKDSSDEIVVDREMLGIRLEVFNERTSKFEKPHYILLKKRIK-SNSWFLFKHTIP 241

Query: 119 KMLDAERIWSTTLNGAICSDSDVYLFAKKCYARLIDMHFRLQFIARLD-PYLFENIRTDS 177
             +D + I++ T  G + S  D YLFAK+ + +L+++  R Q    L+   +  N+  D 
Sbjct: 242 SYIDVQAIFNDTNGGLVISPDDAYLFAKRVFVQLVEIQKRQQSFKDLEAKKIIHNLDLDL 301

Query: 178 YAAMLSFLISGGAQPLAVTVLLEGREVRSCQLDQQQHD 215
            ++M+SF +      + V + L+  E+ SC +  + HD
Sbjct: 302 QSSMVSFFVKD----VKVELFLKQNEIVSCSILDEIHD 335

>Smik_4.577 Chr4
           (1030208..1030259,1030337..1030526,1030557..1031421)
           [1107 bp, 368 aa] {ON} YDR318W (REAL)
          Length = 368

 Score =  160 bits (406), Expect = 6e-47,   Method: Compositional matrix adjust.
 Identities = 93/238 (39%), Positives = 140/238 (58%), Gaps = 15/238 (6%)

Query: 1   MFDPALAPFLDTELLRSPSKRGKILSTRPEQSKQR-ELRNFIEVENCYRMCGITFFPLVD 59
           MFDP +A  LDT++L SPSKR + L      S  + +L + I VEN YR+ GITFFPLVD
Sbjct: 123 MFDPEVADLLDTDILTSPSKRKRKLKIEDINSIDKGKLEDSIVVENVYRIFGITFFPLVD 182

Query: 60  PGRLGGQDKDNEGIVN-EMLGIRLEVFNENTRRFDYPYYVLLRRDAKVATRWQLFKHTLP 118
           P  L  +D  +E  V+ EMLGIRLEVF+E T +F+ P+Y+LL++  K +  W LFKHT+P
Sbjct: 183 PIDLKIKDDSDEIFVDREMLGIRLEVFSERTSKFEKPHYILLKKRIK-SNSWFLFKHTVP 241

Query: 119 KMLDAERIWSTTLNGAICSDSDVYLFAKKCYARLIDMHFRLQFIARLDP-YLFENIRTDS 177
             +D + I+  T  G + S  D YLFAK+ + +L+++  R Q    L+   +  ++  D 
Sbjct: 242 SFIDVQGIFDDTNGGLVVSYDDAYLFAKRVFLQLVEIQKRQQIFKDLEAKKIIHDLNLDL 301

Query: 178 YAAMLSFLISGGAQPLAVTVLLEGREVRSCQLDQQQHD-------EWAHVLVGALADL 228
            ++M SF +    + + V + ++  E+ SC +    HD       +W   L+G+L DL
Sbjct: 302 ESSMASFFV----KDVKVELFVKQNEIVSCSILDDIHDFSHNNKNKWEIALLGSLDDL 355

>TDEL0E02780 Chr5 complement(534940..535931,535996..536047) [1044
           bp, 347 aa] {ON} Anc_5.349 YDR318W
          Length = 347

 Score =  149 bits (377), Expect = 7e-43,   Method: Compositional matrix adjust.
 Identities = 91/243 (37%), Positives = 141/243 (58%), Gaps = 16/243 (6%)

Query: 1   MFDPALAPFLDTELLRSPSK-RGKILSTRPEQSKQRELRNFIEVENCYRMCGITFFPLVD 59
           MFD ++A F+DT +L SPSK R ++  T+ ++   R   N + +EN YRM GIT+FP+VD
Sbjct: 110 MFDESIAQFIDTNILTSPSKARRRMKDTKYDEDAPR---NQVLLENVYRMFGITYFPVVD 166

Query: 60  PGRLGGQDKDNEGIVN-EMLGIRLEVFNENTRRFDYPYYVLLRRDAKVATRWQLFKHTLP 118
           P  L    + N+  +N EM+GIRLEVFNE+  RF+ PYY+LL++  K +  W LFKHT+P
Sbjct: 167 PTDLKVNKETNKTEINREMIGIRLEVFNESIARFEKPYYILLKKKIK-SDSWLLFKHTVP 225

Query: 119 KMLDAERIWSTTLNGAICSDSDVYLFAKKCYARLIDMHFRLQFIARL-DPYLFENIRTDS 177
             +D   +++ T  GAI S  ++YLFAK  Y +LI++  R+Q +  L    + +N+  D 
Sbjct: 226 IFIDVHALFNKTNGGAIISHENIYLFAKTVYRQLIELTARMQNLEDLMSSGVIDNLDLDL 285

Query: 178 YAAMLSFLISGGAQPLAVTVLLEGREVRSCQ-----LDQQQHDEWAHVLVGALADLPNKV 232
            AA +SF        +   ++L   ++ SC      LD     +   + +G L +L  K+
Sbjct: 286 EAAAVSF----SKNEVQFRLMLHKDQIVSCSLVGEALDGNVKPQLETIFLGPLHELEIKL 341

Query: 233 RVL 235
           + L
Sbjct: 342 KHL 344

>ZYRO0D10120g Chr4 (852141..852192,852258..853195) [990 bp, 329 aa]
           {ON} similar to uniprot|Q06675 Saccharomyces cerevisiae
           YDR318W MCM21 Protein involved in minichromosome
           maintenance component of the COMA complex that bridges
           kinetochore subunits that are in contact with
           centromeric DNA and the subunits bound to microtubules
          Length = 329

 Score =  147 bits (370), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 94/234 (40%), Positives = 133/234 (56%), Gaps = 17/234 (7%)

Query: 1   MFDPALAPFL-DTELLRSPSKRGKILSTRPEQSKQRELRNFIEVENCYRMCGITFFPLVD 59
           MFD ++A  L DT    SP KR      R +    + L + + +EN YR+ GITFFPLVD
Sbjct: 105 MFDKSIADLLGDTSSSTSPGKR------RSKLQNFKGLESQVSIENAYRLFGITFFPLVD 158

Query: 60  PGRLGGQDKDNEGIVNEMLGIRLEVFNENTRRFDYPYYVLLRRDAKVATRWQLFKHTLPK 119
           P  +  Q  D   I  +MLGIRLEVFNE  R+F+ P+Y+LL+++ K+ + W LFKHT+P 
Sbjct: 159 PSDINFQRND---INRKMLGIRLEVFNEGLRQFEKPHYILLKQNLKLNS-WSLFKHTIPA 214

Query: 120 MLDAERIWSTTLNGAICSDSDVYLFAKKCYARLIDMHFRLQFIARL-DPYLFENIRTDSY 178
            +D E I+    NG I +   VYLFAK+ Y +L+ +  R+Q I  L D  L  N+  D  
Sbjct: 215 FIDLESIFQKIDNGIITTYDQVYLFAKQVYIQLLCVSQRVQIIEELQDIRLISNLEIDLQ 274

Query: 179 AAMLSFLISGGAQPLAVTVLLEGREVRSCQLDQQQHDEWAHVLVGALADLPNKV 232
            A +SF I G  +   V + L+  +V SC  D    DE   +L+G + +L  K+
Sbjct: 275 IAAVSFDIQGMKR---VRLFLQDDQVISC--DTFDDDELKMLLLGPVKELKLKL 323

>SAKL0G08888g Chr7 complement(760335..761422,761488..761539) [1140
           bp, 379 aa] {ON} similar to uniprot|Q06675 Saccharomyces
           cerevisiae YDR318W MCM21 Protein involved in
           minichromosome maintenance component of the COMA complex
           that bridges kinetochore subunits that are in contact
           with centromeric DNA and the subunits bound to
           microtubules
          Length = 379

 Score =  146 bits (369), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 86/238 (36%), Positives = 133/238 (55%), Gaps = 10/238 (4%)

Query: 1   MFDPALAPFLDTELLRSPSKRGKILSTRPEQSKQRELRNFIEVENCYRMCGITFFPLVDP 60
           MFD  +A  +DTE+L SPSKR + LS     + ++ L +++ +EN YRM GIT FP+VDP
Sbjct: 132 MFDSDIADLIDTEILTSPSKRKEKLSKV--HNNKQNLIDYVRLENVYRMTGITVFPVVDP 189

Query: 61  GRLGGQDKDNE-GIVNEMLGIRLEVFNENTRRFDYPYYVLLRRDAKVATRWQLFKHTLPK 119
             L    +  E  I+ EM+G+RLEVFNE    F+ PYYVLL++ +K  + W +FKHT+P 
Sbjct: 190 SDLKVNKETKEYEILREMMGVRLEVFNEVLSTFEKPYYVLLKKSSKRDS-WDIFKHTIPN 248

Query: 120 MLDAERIWSTTLNGAICSDSDVYLFAKKCYARLIDMHFRLQ---FIARLDPYLFENIRTD 176
            +D + ++  T  G I   S  YLFAKK Y  L+    + Q    +AR D  + + I +D
Sbjct: 249 YIDIQLLFEKTNGGIITDYSGTYLFAKKVYQLLLQTSLKAQVFEVLAREDSRISQ-IESD 307

Query: 177 SYAAMLSFLISGGAQPLAVTVLLEGREVR--SCQLDQQQHDEWAHVLVGALADLPNKV 232
               ++SF +S         + ++   V   S +L+ +    W + L+G + + P K+
Sbjct: 308 LAVNVVSFKVSFKNLSFKTVLQMDWNNVHGASIKLNSEHVRRWENYLLGPVDEFPRKL 365

>KLTH0H14806g Chr8 (1285442..1285493,1285556..1286544) [1041 bp, 346
           aa] {ON} similar to uniprot|Q06675 Saccharomyces
           cerevisiae YDR318W MCM21 Protein involved in
           minichromosome maintenance component of the COMA complex
           that bridges kinetochore subunits that are in contact
           with centromeric DNA and the subunits bound to
           microtubules
          Length = 346

 Score =  142 bits (357), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 77/236 (32%), Positives = 130/236 (55%), Gaps = 9/236 (3%)

Query: 2   FDPALAPFLDTELLRSPSKRGKILSTRPEQSKQRELRNFIEVENCYRMCGITFFPLVDPG 61
           FD A+A  ++T++L SPSKR +   +R  +    EL   +++EN YRM GI+ FP+VDP 
Sbjct: 116 FDSAVADLIETDILTSPSKRKRAAQSRAHE----ELVQKVQIENIYRMLGISTFPVVDPS 171

Query: 62  RLGGQDKDNEGIVNEMLGIRLEVFNENTRRFDYPYYVLLRRDAKVATRWQLFKHTLPKML 121
            L G ++D   I  +MLG+RLE+FNE  R F+ PYY+L +++ K  + W +F+HT+P  +
Sbjct: 172 DLEGTEEDEINIKRKMLGLRLELFNELERSFEPPYYILFKQNPK-NSYWNIFRHTVPSYV 230

Query: 122 DAERIWSTT-LNGAICSDSDVYLFAKKCYARLIDMHFRLQFIARLDPY-LFENIRTDSYA 179
             E+++     NG + + S++Y FAKK Y  L+ +  + Q   R +       +  D   
Sbjct: 231 GVEQMFQQVRSNGLLANQSEIYTFAKKVYKSLLSISVKTQIFRRTEKKEAISQLEIDPSC 290

Query: 180 AMLSFLISGGAQPLAVTVLLEGREVRSCQLDQQQHDEWAHVLVGALADLPNKVRVL 235
             +SF I        V + L+  +V +C     ++  W   ++G +  LP+++  L
Sbjct: 291 TSVSFHIEKLG--CFVKLKLDATDVIACSCIPHENVSWNAQMLGPVVSLPDRIESL 344

>KNAG0C05520 Chr3 complement(1072299..1073456) [1158 bp, 385 aa]
           {ON} Anc_5.349 YDR318W
          Length = 385

 Score =  142 bits (358), Expect = 9e-40,   Method: Compositional matrix adjust.
 Identities = 85/242 (35%), Positives = 136/242 (56%), Gaps = 13/242 (5%)

Query: 1   MFDPALAPFLDTELLRSPSKRGKILSTRPEQ--SKQRELRNFIEVENCYRMCGITFFPLV 58
           MFD ++   LDT++L SPSKR +     P Q  +    L   I +EN YR+ GIT+FP+V
Sbjct: 144 MFDQSVGDLLDTDILSSPSKRKR----NPAQHGADTSRLHEKILLENAYRLFGITYFPVV 199

Query: 59  DPGRLG-GQDKDNEGIVNEMLGIRLEVFNENTRRFDYPYYVLLRRDAKVATRWQLFKHTL 117
           DP  L    +     I  EMLG+R +VFN+   +F+ P+YVLL+++ K A  W++FKHT+
Sbjct: 200 DPADLQLNAETQKMVITREMLGVRFDVFNDQDSKFEKPFYVLLKKNLK-AKVWEIFKHTI 258

Query: 118 PKMLDAERIWSTTLNGAICSDSDVYLFAKKCYARLIDMHFRLQFIARLDPY-LFENIRTD 176
           P  +D   ++ T   G   S++D+YLF+K+ Y RL+    RL+    L    L E++R D
Sbjct: 259 PGNIDVHSLFHTITGGLATSNNDIYLFSKEVYVRLVQSSLRLKHFNSLQERGLIEDLRGD 318

Query: 177 SYAAMLSFLISGGAQPLAVTVLLEGREVRSCQLDQQQHD---EWAHVLVGALADLPNKVR 233
             +  +SF+ +G    + V + ++  EV S  + + + +   + A  L G + DL  K++
Sbjct: 319 LRSTNVSFM-TGPRFMIDVKLTIQNNEVVSVYVKKGKEEVKSKLAMFLTGPIDDLEGKLK 377

Query: 234 VL 235
            L
Sbjct: 378 QL 379

>Kpol_1051.5 s1051 (10484..11596) [1113 bp, 370 aa] {ON}
           (10484..11596) [1113 nt, 371 aa]
          Length = 370

 Score =  139 bits (351), Expect = 8e-39,   Method: Compositional matrix adjust.
 Identities = 84/249 (33%), Positives = 136/249 (54%), Gaps = 15/249 (6%)

Query: 1   MFDPALAPFLDTELLRSPSKRGKIL------STRPEQSKQRELRNFIEVENCYRMCGITF 54
           MF+  ++  ++T++L SPSKR   L      S   + +KQ+ L   I +EN +R+ GITF
Sbjct: 122 MFNSGISDMINTDILTSPSKRKLKLGNIDDDSETSKGNKQKNLNKKIRIENLFRLFGITF 181

Query: 55  FPLVDPGRLG-GQDKDNEGIVNEMLGIRLEVFNENTRRFDYPYYVLLRRDAKVATRWQLF 113
           FPLVDP  L   ++     I  EMLGIRLE++NE+   F+ P+Y+LL++  K+ + W +F
Sbjct: 182 FPLVDPTDLKMNKELKTMEIKREMLGIRLEIYNEHNSTFEKPHYILLKKKLKIDS-WMIF 240

Query: 114 KHTLPKMLDAERIWSTTLNGAICSDSDVYLFAKKCYARLIDMHFRLQFIARLDPYLFENI 173
           KHT+P  +D E  W    NG + +  ++ +FAK+ Y  LI  + R Q I +L     E I
Sbjct: 241 KHTIPSYIDIESKWFGINNGMLNTYDEINVFAKEVYIELIHGNIREQKIQKLTE--LEYI 298

Query: 174 RTDSYAAMLSFLISGGAQPLAVTVLLEGREVRSCQL--DQQQ---HDEWAHVLVGALADL 228
           R        S +I        + + L+   + SC++  D+ +    ++W  +L+G + +L
Sbjct: 299 RDCQTDVNSSRVILTLIDQYEIELFLKNETIVSCKIPTDRMEPMLKNKWQIILLGTIDEL 358

Query: 229 PNKVRVLKG 237
           PNK+  L  
Sbjct: 359 PNKLSQLNN 367

>Kwal_34.15986 s34 complement(145905..146600) [696 bp, 231 aa] {ON}
           YDR318W (MCM21) - involved in minichromosome maintenance
           [contig 272] FULL
          Length = 231

 Score =  132 bits (331), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 74/238 (31%), Positives = 131/238 (55%), Gaps = 11/238 (4%)

Query: 1   MFDPALAPFLDTELLRSPSKRGKILSTRPEQSKQRELRNFIEVENCYRMCGITFFPLVDP 60
           MFD  +A   +T++L SPSKR K++++R    K +EL   +++EN YR  G++ FP+VDP
Sbjct: 1   MFDSTVADLFNTDILTSPSKRKKVVNSR----KHQELIKKLDIENLYRTIGLSTFPVVDP 56

Query: 61  GRLGGQDKDNEGIVN-EMLGIRLEVFNENTRRFDYPYYVLLRRDAKVATRWQLFKHTLPK 119
             +  QD+D E I    M+G+RLE+FNE  + F+ P+YVL +++ K    W +F+HT+P 
Sbjct: 57  SDVE-QDEDGETIFRRSMIGLRLEIFNELDKTFEPPHYVLFKQNLKTG-HWNIFRHTIPS 114

Query: 120 MLDAERIWSTTLNGAICSD-SDVYLFAKKCYARLIDMHFRLQ-FIARLDPYLFENIRTDS 177
            +  ER++  T      +D   +Y F KK Y  L+ +  + Q F +  +  +   +  D 
Sbjct: 115 YVGVERLFEQTKTINPLADIGKIYTFGKKVYTSLLSISTKQQTFKSLAESGIVSQLVIDP 174

Query: 178 YAAMLSFLISGGAQPLAVTVLLEGREVRSCQLDQQQHDEWAHVLVGALADLPNKVRVL 235
                SF +  G+  ++V + L   ++ +C    +   +W   ++G +  LP +++ L
Sbjct: 175 SCTSASFQMMQGS--VSVKLKLSETDITACSSIPRSSQKWTATILGPVQSLPRRLQTL 230

>KAFR0C01870 Chr3 complement(372621..373594,373748..373799) [1026
           bp, 341 aa] {ON} Anc_5.349 YDR318W
          Length = 341

 Score =  130 bits (327), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 84/247 (34%), Positives = 129/247 (52%), Gaps = 16/247 (6%)

Query: 1   MFDPALAPFLDTELLRSPSKRGKILSTRPEQSKQR----ELRNFIEVENCYRMCGITFFP 56
           +FD ++   LDTE+L SPSKR + L+     S        L + I VEN +R+ GITFFP
Sbjct: 100 LFDKSVGDILDTEILSSPSKRRQRLNGDDRSSIGNLPLDNLHDQIMVENIFRLFGITFFP 159

Query: 57  LVDPGRLGGQDKDNE-GIVNEMLGIRLEVFNENTRRFDYPYYVLLRRDAKVATRWQLFKH 115
           +VDP  L    +  E   + EMLGIRL++F+E ++++D P Y+LL++  K  T W +FKH
Sbjct: 160 VVDPSDLQMNIETQEMDTMREMLGIRLDIFDELSKKYDKPMYILLKKKIKSDT-WDIFKH 218

Query: 116 TLPKMLDAERIWSTTLNGAICSDSDVYLFAKKCYARLIDMHFRLQFIARLDPY-LFENIR 174
           T+P  +  E+I+     G   S  D+YLF+K+ Y +L+    R   + + +   L  N+R
Sbjct: 219 TIPSYIGVEKIFEEVSAGLAISYEDIYLFSKEIYLQLLKESARKGKLKKFEEKGLISNLR 278

Query: 175 TDSYAAMLSFLISGGAQPLAVTVLLEGREVRSCQL-----DQQQHDEWAHVLVGALADLP 229
               +  +SF I        + + L+   + SC       D     +W  +  G L DL 
Sbjct: 279 ISLSSTKVSFSIGT----FEIELYLQDNIIISCSFVKGIRDASVRSKWEVLFNGPLEDLE 334

Query: 230 NKVRVLK 236
            K+R LK
Sbjct: 335 YKLRQLK 341

>TBLA0H01980 Chr8 complement(466993..468020,468148..468199) [1080
           bp, 359 aa] {ON} Anc_5.349 YDR318W
          Length = 359

 Score =  130 bits (327), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 72/191 (37%), Positives = 112/191 (58%), Gaps = 4/191 (2%)

Query: 1   MFDPALAPFLDTELLRSPSKRGKILS-TRPEQSKQRELRNFIEVENCYRMCGITFFPLVD 59
           +FD  ++  L  E++  PS+R K +   RP    +  L+NF+ +E  YRM GITFFP+VD
Sbjct: 109 LFDDEISRLLSPEVVSLPSQRRKRMKLERPNLHIREILKNFVILEIVYRMVGITFFPVVD 168

Query: 60  PGRLGGQD-KDNEGIVNEMLGIRLEVFNENTRRFDYPYYVLLRRDAKVATRWQLFKHTLP 118
           P  L   D K    I  EMLGIRLE++N+    F+ P+Y+LL++  K +  W +FK+T+P
Sbjct: 169 PTDLEFLDTKKLLSIRREMLGIRLEIYNDLISSFEKPHYILLKQSEK-SKIWSIFKYTIP 227

Query: 119 KMLDAERIWSTTLNGAICSDSDVYLFAKKCYARLIDMHFRLQFIARLDPY-LFENIRTDS 177
             +D   ++    NG I +DSD++LFAK  Y+ L  +  ++Q+  +L+   +FEN+  D 
Sbjct: 228 NYIDIHSLFLKINNGIITTDSDIFLFAKDVYSALSSISKKIQYFKKLENLKVFENLNIDL 287

Query: 178 YAAMLSFLISG 188
               +SFL   
Sbjct: 288 IGIQISFLFKS 298

>CAGL0H07139g Chr8 complement(703350..704426) [1077 bp, 358 aa] {ON}
           some similarities with uniprot|Q06675 Saccharomyces
           cerevisiae YDR318w MCM21
          Length = 358

 Score =  128 bits (321), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 76/244 (31%), Positives = 137/244 (56%), Gaps = 11/244 (4%)

Query: 1   MFDPALAPFLDTELLRSPSKRGKILSTRPEQSKQRELRNFIEVENCYRMCGITFFPLVDP 60
           +FD ++   +DT++L SPSKR + +      S  +  +  I+ EN YR+ GI++FPLVDP
Sbjct: 119 LFDESVRDVIDTDILISPSKRKQKIQQLNPNSTGKVSKEPIQYENIYRLFGISYFPLVDP 178

Query: 61  GRLGGQDKDNEGIVN-EMLGIRLEVFNENTRRFDYPYYVLLRRDAKVATRWQLFKHTLPK 119
             L    K  + IV  +MLGIR ++FNE+++ F+ P+Y+LL++ AK +  W+LFK+T+P 
Sbjct: 179 SDLIFDSKTEKMIVTRDMLGIRFDIFNESSKSFEKPHYILLKKSAK-SDDWKLFKYTVPN 237

Query: 120 MLDAERIWSTTLNGAICSDSDVYLFAKKCYARLIDMHFRLQFIARLDPY-LFENIRTDSY 178
            +D E I++    G I +  DVYLFAK  Y  L+++  R +   +L+   + +++  D  
Sbjct: 238 YIDVEGIFAEVTGGLIRTYDDVYLFAKCIYLLLVEIVIRSELFLQLEKDGIIDDLDMDLQ 297

Query: 179 AAMLSFLISGGAQPLAVTVLLEGREVRSCQLDQQ-----QHDEWAHVLVGALADLPNKVR 233
           + ++   + G  +   +   +    + +C +  +     + +  A +L G+L DL  K+ 
Sbjct: 298 SLVIKCTLQGTTK---IEFHIHQYSIIACTIKSKIMSDDEKERLAMMLQGSLHDLKYKLI 354

Query: 234 VLKG 237
            L+ 
Sbjct: 355 SLRN 358

>TPHA0D02070 Chr4 (426798..427919) [1122 bp, 373 aa] {ON} Anc_5.349
           YDR318W
          Length = 373

 Score =  116 bits (290), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 80/256 (31%), Positives = 134/256 (52%), Gaps = 27/256 (10%)

Query: 1   MFDPALAPFLDTELLRSPSKRGKILS-------------TRPEQSKQRELRNFIEVENCY 47
           +F   L+  ++T++L SPSKR K++                P  +++ E R  I+ EN +
Sbjct: 121 IFASELSENINTDILTSPSKRKKVIEGIEITGNDANMGYKNPNLNEELE-RKIIK-ENTF 178

Query: 48  RMCGITFFPLVDPGRLGGQDKDNEGIVN--EMLGIRLEVFNENTRRFDYPYYVLLRRDAK 105
           R+ GI++FP+VDP  L   DK N  + N  EM+GIRLEVF++    F+ P+Y+LL++  K
Sbjct: 179 RLFGISYFPVVDPCDLV-HDKSNNEVNNKREMIGIRLEVFDDTLGVFEKPHYILLKKKTK 237

Query: 106 VATRWQLFKHTLPKMLDAERIWSTTLNGAICSDSDVYLFAKKCYARLIDMHFRLQFIARL 165
            +  W LFK+T+P  +D   I+    NG + +  D+Y+FAK+ Y +L+ +  R + + +L
Sbjct: 238 -SNNWGLFKYTIPNYIDIYLIFQRINNGILLTYEDIYIFAKQVYIQLLLIQNRKKNLMQL 296

Query: 166 -DPYLFENIRTDSYAAMLSFLISGGAQPLAVTVLLEGREVRSCQ-----LDQQQHDEWAH 219
            +  +  +I  D    ++   I      L  T+ LE  +V S       LD      W  
Sbjct: 297 QEANIVSDILIDLNLKLIKMNIINTTTKL--TLYLEKDKVTSVSIYSETLDIHSQKRWKL 354

Query: 220 VLVGALADLPNKVRVL 235
            L+G ++ +  K+R L
Sbjct: 355 TLLGPVSGISRKIRYL 370

>KLLA0B10142g Chr2 (887476..887527,887649..888478) [882 bp, 293 aa]
           {ON} similar to uniprot|Q06675 Saccharomyces cerevisiae
           YDR318W MCM21 Protein involved in minichromosome
           maintenance component of the COMA complex that bridges
           kinetochore subunits that are in contact with
           centromeric DNA and the subunits bound to microtubules
          Length = 293

 Score = 94.0 bits (232), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 58/217 (26%), Positives = 109/217 (50%), Gaps = 24/217 (11%)

Query: 24  ILSTRPEQSKQRELRNFIEVENCYRMCGITFFPLVDPGRLGGQDKDNEGIVNEMLGIRLE 83
           + S   E +  + + +F++ EN  R+ G++ FP+         + DN     E +GIRLE
Sbjct: 94  VSSGHNEVAGFKSITDFVQWENSVRLIGVSLFPV---------NYDNI----EFMGIRLE 140

Query: 84  VFNENTRRFDYPYYVLLRRDAKVATRWQLFKHTLPKMLDAERIWSTTLNGAICSDSDVYL 143
           +F+E + ++D P+YV+L+   K    W+LFKH LPK ++  + W         SDS++  
Sbjct: 141 LFDELSLKYDPPFYVILKPSVKRLGIWELFKHNLPKYINIHQHWQLITKDTDTSDSNIMK 200

Query: 144 FAKKCYARLIDMHFRLQFIARLDPYLFEN-----IRTDSYAAMLSFLISGGAQPLAVTVL 198
           FA  CY  L+ +H R+QF  +L+     +     +  D+    +SF +  GA  + + V 
Sbjct: 201 FANLCYKDLLKVHSRVQFFRKLEGNYVNDKQYSLLHIDNMGLNVSFRL--GADIIKIKVD 258

Query: 199 LEGREVRSCQLDQQQHDEWAHVLVGALADLPNKVRVL 235
               E+  C  + +++      L+G++  + N+ + +
Sbjct: 259 DGDDEIIDCTFNGEKNIS----LLGSIYGITNRFQSI 291

>NCAS0F02850 Chr6 (571260..572105) [846 bp, 281 aa] {ON} Anc_5.349
           YDR318W
          Length = 281

 Score = 90.1 bits (222), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 56/165 (33%), Positives = 90/165 (54%), Gaps = 28/165 (16%)

Query: 1   MFDPALAPFLDTELLRSPSKRGKILST-RPEQSKQREL-RNFIEVENCYRMCGITFFPLV 58
           MFD ++A  L+TE+L SPSKR  IL   + E  + + L + +  +EN +R+ GI+FF  V
Sbjct: 128 MFDTSVADVLNTEMLSSPSKRRLILKNGQDEMEENKHLQKEYRLLENVFRIVGISFFDAV 187

Query: 59  DPGRLGGQDKDNEGIVNEMLGIRLEVFNENTRRFDYPYYVLLRRDAKVATR--WQLFKHT 116
           DP  L            +M+GIRL+ FN+ ++     YY++L+++AK      W + KHT
Sbjct: 188 DPNDLES----------DMIGIRLDPFNQPSK----VYYIILKKEAKNNREGLWTIIKHT 233

Query: 117 LPKMLDA--------ERIWSTTLNGAICSDSDVYLFAKKCYARLI 153
           +PK ++            W T +   I +  D+YL AK+ Y +L+
Sbjct: 234 IPKYINVTNTFGESKRETWRTMI--KIENHDDIYLLAKEVYVKLL 276

>NDAI0I01550 Chr9 (368193..369023) [831 bp, 276 aa] {ON} Anc_5.349
           YDR318W
          Length = 276

 Score = 80.9 bits (198), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 53/155 (34%), Positives = 87/155 (56%), Gaps = 13/155 (8%)

Query: 1   MFDPALAPFLDTELLRSPSKRGKILSTRPEQSKQRELRNFIEVENCYRMCGITFFPLVDP 60
           MFD ++A  L T++L SPSKR  I+ T+  QS   + R  I +E+ Y+  G+ F  L DP
Sbjct: 129 MFDTSVADVLGTDILSSPSKR--IIETKERQSDNLQ-RTLILLEDFYKKLGVNFLQLFDP 185

Query: 61  GRLGGQDK-DNEGIVNEMLGIRLEV-FNENTRRFDYPYYVLLRRDAKVATRWQLFKHTLP 118
             L   +K +   +  +MLG+R E+  +E  ++    YY+LL+++   +  W  +KH+LP
Sbjct: 186 NDLEMNEKMEALQMKGDMLGVRFELPSSEGAQK----YYLLLKKET-ASDYWIPYKHSLP 240

Query: 119 KMLDAERIWSTTLNGAICSDSDVYLFAKKCYARLI 153
            ++D    +   +N A  S  D+YL AK  Y +L+
Sbjct: 241 NIIDVNEYF---VNVAAESHEDIYLIAKDIYLQLL 272

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.324    0.140    0.428 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 25,699,188
Number of extensions: 1058670
Number of successful extensions: 2647
Number of sequences better than 10.0: 21
Number of HSP's gapped: 2630
Number of HSP's successfully gapped: 21
Length of query: 242
Length of database: 53,481,399
Length adjustment: 106
Effective length of query: 136
Effective length of database: 41,326,803
Effective search space: 5620445208
Effective search space used: 5620445208
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 64 (29.3 bits)