Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
AGR348W5.348ON54254224880.0
Ecym_81855.348ON47138012231e-164
TDEL0E027905.348ON4113864062e-43
SAKL0G08910g5.348ON5053234042e-42
Kwal_34.159895.348ON5064173938e-41
Skud_4.5835.348ON4152333834e-40
Suva_2.4865.348ON4152323819e-40
Smik_4.5765.348ON4152333739e-39
YDR317W (HIM1)5.348ON4142563632e-37
KLTH0H14784g5.348ON5144123631e-36
CAGL0H07161g5.348ON4244113361e-33
ZYRO0F00550g5.348ON4153803308e-33
Kpol_1051.45.348ON4262622724e-25
KAFR0C018805.348ON3451782464e-22
KLLA0B10120g5.348ON3483622368e-21
TPHA0D020605.348ON4962662186e-18
TBLA0A031005.348ON3721631854e-14
ZYRO0D09548g7.148ON2251751282e-07
KLTH0H00264g7.148ON2221181095e-05
NCAS0E02080singletonON2252301061e-04
TBLA0A105007.148ON237991024e-04
Ecym_44797.148ON224103970.002
NDAI0E036407.148ON225188940.004
TDEL0H031107.148ON22491910.008
TBLA0F033107.148ON16174880.012
Kpol_312.97.148ON221139890.014
TPHA0L007607.148ON226150880.023
Smik_5.1187.148ON23174860.042
KNAG0L00930singletonON22998830.10
Skud_5.1037.148ON227117820.11
YER004W (FMP52)7.148ON23174820.12
KAFR0G027507.148ON22574800.21
Suva_5.917.148ON22974790.28
NCAS0E020907.148ON22575770.60
KNAG0L00925singletonON228145741.1
Skud_2.2433.369ON139245715.8
CAGL0F06061g2.604ON33677688.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AGR348W
         (542 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AGR348W Chr7 (1377726..1379354) [1629 bp, 542 aa] {ON} Syntenic ...   962   0.0  
Ecym_8185 Chr8 complement(383906..385321) [1416 bp, 471 aa] {ON}...   475   e-164
TDEL0E02790 Chr5 complement(536193..537428) [1236 bp, 411 aa] {O...   160   2e-43
SAKL0G08910g Chr7 complement(761626..763143) [1518 bp, 505 aa] {...   160   2e-42
Kwal_34.15989 s34 complement(147085..148605) [1521 bp, 506 aa] {...   155   8e-41
Skud_4.583 Chr4 (1038472..1039719) [1248 bp, 415 aa] {ON} YDR317...   152   4e-40
Suva_2.486 Chr2 (859579..860826) [1248 bp, 415 aa] {ON} YDR317W ...   151   9e-40
Smik_4.576 Chr4 (1028647..1029894) [1248 bp, 415 aa] {ON} YDR317...   148   9e-39
YDR317W Chr4 (1102184..1103428) [1245 bp, 414 aa] {ON}  HIM1Prot...   144   2e-37
KLTH0H14784g Chr8 (1283834..1285378) [1545 bp, 514 aa] {ON} weak...   144   1e-36
CAGL0H07161g Chr8 complement(704823..706097) [1275 bp, 424 aa] {...   134   1e-33
ZYRO0F00550g Chr6 complement(51742..52989) [1248 bp, 415 aa] {ON...   131   8e-33
Kpol_1051.4 s1051 (8692..9972) [1281 bp, 426 aa] {ON} (8692..997...   109   4e-25
KAFR0C01880 Chr3 complement(374180..375217) [1038 bp, 345 aa] {O...    99   4e-22
KLLA0B10120g Chr2 (886187..887233) [1047 bp, 348 aa] {ON} some s...    96   8e-21
TPHA0D02060 Chr4 (424797..426287) [1491 bp, 496 aa] {ON} Anc_5.3...    89   6e-18
TBLA0A03100 Chr1 (739771..740889) [1119 bp, 372 aa] {ON} Anc_5.3...    76   4e-14
ZYRO0D09548g Chr4 (812531..813208) [678 bp, 225 aa] {ON} similar...    54   2e-07
KLTH0H00264g Chr8 complement(23047..23715) [669 bp, 222 aa] {ON}...    47   5e-05
NCAS0E02080 Chr5 complement(399088..399765) [678 bp, 225 aa] {ON}      45   1e-04
TBLA0A10500 Chr1 (2585576..2586289) [714 bp, 237 aa] {ON} Anc_7....    44   4e-04
Ecym_4479 Chr4 complement(973594..974268) [675 bp, 224 aa] {ON} ...    42   0.002
NDAI0E03640 Chr5 complement(784609..785286) [678 bp, 225 aa] {ON...    41   0.004
TDEL0H03110 Chr8 (512079..512753) [675 bp, 224 aa] {ON} Anc_7.14...    40   0.008
TBLA0F03310 Chr6 complement(814437..814922) [486 bp, 161 aa] {ON...    39   0.012
Kpol_312.9 s312 (21577..22242) [666 bp, 221 aa] {ON} (21577..222...    39   0.014
TPHA0L00760 Chr12 (143784..144464) [681 bp, 226 aa] {ON} Anc_7.1...    39   0.023
Smik_5.118 Chr5 (163900..164595) [696 bp, 231 aa] {ON} YER004W (...    38   0.042
KNAG0L00930 Chr12 (170496..171185) [690 bp, 229 aa] {ON}               37   0.10 
Skud_5.103 Chr5 (156788..157471) [684 bp, 227 aa] {ON} YER004W (...    36   0.11 
YER004W Chr5 (159580..160275) [696 bp, 231 aa] {ON}  FMP52Protei...    36   0.12 
KAFR0G02750 Chr7 (569916..570593) [678 bp, 225 aa] {ON} Anc_7.14...    35   0.21 
Suva_5.91 Chr5 (135337..136023) [687 bp, 229 aa] {ON} YER004W (R...    35   0.28 
NCAS0E02090 Chr5 complement(400057..400734) [678 bp, 225 aa] {ON}      34   0.60 
KNAG0L00925 Chr12 (169763..170449) [687 bp, 228 aa] {ON}               33   1.1  
Skud_2.243 Chr2 complement(438373..442551) [4179 bp, 1392 aa] {O...    32   5.8  
CAGL0F06061g Chr6 complement(604063..605073) [1011 bp, 336 aa] {...    31   8.0  

>AGR348W Chr7 (1377726..1379354) [1629 bp, 542 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR317W
          Length = 542

 Score =  962 bits (2488), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 468/542 (86%), Positives = 468/542 (86%)

Query: 1   MVALRTMHQIQNHPRKSSLNYHELKSKIRTTRDKLFKHECSGEEDRHGSHSRDSAHGSQQ 60
           MVALRTMHQIQNHPRKSSLNYHELKSKIRTTRDKLFKHECSGEEDRHGSHSRDSAHGSQQ
Sbjct: 1   MVALRTMHQIQNHPRKSSLNYHELKSKIRTTRDKLFKHECSGEEDRHGSHSRDSAHGSQQ 60

Query: 61  KLPKEVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 120
           KLPKEV                                                      
Sbjct: 61  KLPKEVKAAQKLVKQQLKLEQELARQEELKKLKLQQQSIALKQQTEQLLKQQHSSPSQSP 120

Query: 121 XXXXXXXXXXXXXXXXXXXXTSSRPCTNSDSRPGSRHSVIRTNPALNDTGENYVLLGSTG 180
                               TSSRPCTNSDSRPGSRHSVIRTNPALNDTGENYVLLGSTG
Sbjct: 121 SQSRPSSQSEHSESQNSGSRTSSRPCTNSDSRPGSRHSVIRTNPALNDTGENYVLLGSTG 180

Query: 181 LTGSQVLQDLITPWIGAPLEGVTARTFWCFSRKFQDVEIDISNLPKTWTAIVEFEGEKHV 240
           LTGSQVLQDLITPWIGAPLEGVTARTFWCFSRKFQDVEIDISNLPKTWTAIVEFEGEKHV
Sbjct: 181 LTGSQVLQDLITPWIGAPLEGVTARTFWCFSRKFQDVEIDISNLPKTWTAIVEFEGEKHV 240

Query: 241 IRKNDVRLIRHLSECGGMLGLKCHWDQYNWDVVLTTGEVRNATINVVQVVQPDSRRWPDL 300
           IRKNDVRLIRHLSECGGMLGLKCHWDQYNWDVVLTTGEVRNATINVVQVVQPDSRRWPDL
Sbjct: 241 IRKNDVRLIRHLSECGGMLGLKCHWDQYNWDVVLTTGEVRNATINVVQVVQPDSRRWPDL 300

Query: 301 FNKMFTGGVRTFNAYSEIYMPAVTEIETLISTLGSTSWEARKSKAPRAFVDYTLNMQMAK 360
           FNKMFTGGVRTFNAYSEIYMPAVTEIETLISTLGSTSWEARKSKAPRAFVDYTLNMQMAK
Sbjct: 301 FNKMFTGGVRTFNAYSEIYMPAVTEIETLISTLGSTSWEARKSKAPRAFVDYTLNMQMAK 360

Query: 361 TFAPDPKKGTVKHMVIVTSFNHLALGMVSQYFRTKQRLENDLTYDVPGLTHLTILRPGPL 420
           TFAPDPKKGTVKHMVIVTSFNHLALGMVSQYFRTKQRLENDLTYDVPGLTHLTILRPGPL
Sbjct: 361 TFAPDPKKGTVKHMVIVTSFNHLALGMVSQYFRTKQRLENDLTYDVPGLTHLTILRPGPL 420

Query: 421 LGEHGSKPVISPTNPDTGNMLTRCYTYKKNVMRTQFNWLAQVKEVGPTTKVTELVAKATY 480
           LGEHGSKPVISPTNPDTGNMLTRCYTYKKNVMRTQFNWLAQVKEVGPTTKVTELVAKATY
Sbjct: 421 LGEHGSKPVISPTNPDTGNMLTRCYTYKKNVMRTQFNWLAQVKEVGPTTKVTELVAKATY 480

Query: 481 HLPGNWIVGYSIPAGRVAQIAAQEALVKRNYIKQNLRSSSMIVEVTIWSSQDMDTAETSN 540
           HLPGNWIVGYSIPAGRVAQIAAQEALVKRNYIKQNLRSSSMIVEVTIWSSQDMDTAETSN
Sbjct: 481 HLPGNWIVGYSIPAGRVAQIAAQEALVKRNYIKQNLRSSSMIVEVTIWSSQDMDTAETSN 540

Query: 541 PA 542
           PA
Sbjct: 541 PA 542

>Ecym_8185 Chr8 complement(383906..385321) [1416 bp, 471 aa] {ON}
           similar to Ashbya gossypii AGR348W
          Length = 471

 Score =  475 bits (1223), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 211/380 (55%), Positives = 297/380 (78%), Gaps = 3/380 (0%)

Query: 164 PALNDTGENYVLLGSTGLTGSQVLQDLITPWIGAPLEGVT-ARTFWCFSRKFQDVEIDIS 222
           P +N+ G+N ++LGSTGLTGSQVL+  + PW    L  +   +  WCF+R+ + V+  IS
Sbjct: 93  PKVNEKGDNVIILGSTGLTGSQVLKGCMAPWTSGVLYDLKLTKNIWCFNRRLKTVDFSIS 152

Query: 223 NLPKTWTAIVEFEGEKHVIRKNDVRLIRHLSECGGMLGLKCHWDQYNWDVVLTTGEVRNA 282
            LP TWTA+V + GE H+IRK D+++ +H++E G + GL+  WDQ++W++ L T EV+N 
Sbjct: 153 KLPPTWTAVVNYGGEPHIIRKYDLKIKQHITEIGKLDGLEFQWDQFDWELKLPTDEVKNV 212

Query: 283 TINVVQVVQPDSRRWPDLFNKMFTGGVRTFNAYSEIYMPAVTEIETLISTLGSTSWEARK 342
           T+NV Q++Q DS++W   F+++FTG  +  N   E+Y+P++ ++ETLISTLGS+SWE+RK
Sbjct: 213 TVNVFQIIQNDSKKWDKTFSELFTGNRKPLNDRIEVYLPSIDQVETLISTLGSSSWESRK 272

Query: 343 SKAPRAFVDYTLNMQMAKTFAPDPKKGTVKHMVIVTSFNHLALGMVSQYFRTKQRLENDL 402
            K PR+FVDYTLNM MAK FAPD KK  +KHMVIVTSFN+LALG++S YFRTKQ+LENDL
Sbjct: 273 MKTPRSFVDYTLNMDMAKVFAPDQKKSLIKHMVIVTSFNNLALGVLSPYFRTKQKLENDL 332

Query: 403 TYDVPGLTHLTILRPGPLLGEHGSKPVISPTNPDTGNMLTRCYTYKKNVMRTQFNWLAQV 462
           TYDVPGLTHLTILRPGPL+G+HG + +++P  P    +L +CY +K+++++ + +WL+QV
Sbjct: 333 TYDVPGLTHLTILRPGPLIGQHGKQIILAPQLPVGSGVLYKCYAWKRSLLKAKLHWLSQV 392

Query: 463 KEVGPTTKVTELVAKATYHLPGNWIVGYSIPAGRVAQIAAQEALVKRNYIKQNLRSSSMI 522
           K+VGP+ KVTEL+AKATYHLPGNWIVGYSIP+ +VA+IAA+EA+ KRN  + +  S +++
Sbjct: 393 KDVGPSKKVTELIAKATYHLPGNWIVGYSIPSSKVARIAAKEAMTKRNLARND--SDALV 450

Query: 523 VEVTIWSSQDMDTAETSNPA 542
           VEVT+WSSQ+MD A + + A
Sbjct: 451 VEVTLWSSQEMDRALSGSVA 470

 Score = 38.1 bits (87), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 15/25 (60%), Positives = 23/25 (92%)

Query: 15 RKSSLNYHELKSKIRTTRDKLFKHE 39
          RK+SL+Y ++K KI++TR+KLFKH+
Sbjct: 32 RKTSLHYQDIKIKIKSTRNKLFKHD 56

>TDEL0E02790 Chr5 complement(536193..537428) [1236 bp, 411 aa] {ON}
           Anc_5.348 YDR317W
          Length = 411

 Score =  160 bits (406), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 115/386 (29%), Positives = 189/386 (48%), Gaps = 60/386 (15%)

Query: 171 ENYVLLGSTGLTGSQVLQDLITP--WIGAPLEGVTART----------------FWCFSR 212
           ++++  GS+GL GS  L++L+    ++G P E +  R                  +C +R
Sbjct: 9   DHFLFFGSSGLIGSLTLKELLKADLYLGNP-ENIQKRLNTCEHLNLSNFRFNKLIYCINR 67

Query: 213 KFQDVEIDISN---LPKTWTAIVEFEGEKH-----------VIRKNDVRLIRHLSECGGM 258
           K     I + N   L     A + F    +           V + ++  L+ ++S+  G 
Sbjct: 68  KIGYKNILLDNEQYLKADKLAPISFNKADYRFEKITSICPSVKKHSNQSLVNNVSDESGT 127

Query: 259 LG---------LKCHWDQYNWDVVLTTGEVRNATIN----VVQVVQPDSRRWPDLFNKMF 305
           L          LK H     + V   +   +   I     ++Q+  PDS +W +L   +F
Sbjct: 128 LYIHNNSAGNVLKYHRSMQTYQVEYKSENSKKLLITFNFVILQIACPDSSKWCELLPDIF 187

Query: 306 TGGVRTFNAYSEI-----YMPAVTEIETLISTLGSTSWEARKSKAPRAFVDYTLNMQMAK 360
           +G V    + +E       +P + EI T+I TLG+ S   R+SKA R +VDY L  ++A+
Sbjct: 188 SGCV-ALRSEAEPDGTTNKLPPLDEIPTMICTLGAGS---RQSKAKRHYVDYELTFKLAQ 243

Query: 361 TFAPDPKKGTVKHMVIVTSFNHLALGMVSQYFRTKQRLENDLTYDV-PGLTHLTILRPGP 419
           +F         K +VIVT+FN++ +  +  YFRTK +LENDL + + P L  L +LRPGP
Sbjct: 244 SF----NNCEGKRLVIVTTFNNILIRHLLPYFRTKSKLENDLQHKLKPRLGKLVVLRPGP 299

Query: 420 LLGEHGSKPVISPTNPDTGNMLTRCYTYKKNVMRTQFNWLAQVKEVGPTTKVTELVAKAT 479
           L+GEHG     S T   + NML +   YK+   + +     + + +G  T+ +EL+A+  
Sbjct: 300 LVGEHGRPLTKSLTIGHSTNMLKQILYYKEYCFQCKLALFKEFRRIGFRTRASELIARTM 359

Query: 480 YHLPGNWIVGYSIPAGRVAQIAAQEA 505
           Y  PG+W++GY IPA + A +AA +A
Sbjct: 360 YRKPGSWMLGYCIPATKAAYVAASKA 385

>SAKL0G08910g Chr7 complement(761626..763143) [1518 bp, 505 aa] {ON}
           weakly similar to uniprot|Q06674 Saccharomyces
           cerevisiae YDR317W Hypothetical ORF
          Length = 505

 Score =  160 bits (404), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 106/323 (32%), Positives = 168/323 (52%), Gaps = 40/323 (12%)

Query: 205 RTFWCFSRKFQDVEIDIS--NLPKTWTAIVEFEGEKHVIRKNDVRLIRHLSECGGMLGL- 261
           +  +CF+RK   +EI  +   +   W   ++++G K+  +KN++       + G ++   
Sbjct: 146 KNLFCFNRKLALLEIPSTPEYINDYWEYSIDYKGTKYHSKKNNISFGVPTLKFGKLVNSN 205

Query: 262 ------KCHWDQYNW-------DVVLTTGEVRNAT------INVVQVVQPDSRRWPDLFN 302
                 +C   Q+++       D  +     R  T      INV+Q+++P+S+ WP L +
Sbjct: 206 ENSITNQCQLQQFDYKFEFQREDPSMQNLRTRAQTLIISLKINVIQILEPNSKLWPLLLH 265

Query: 303 KMFTGGVRTFNAY-------SEIYMPAVTEIETLISTLGSTSWEARKSKAPRAFVDYTLN 355
             F G   T  A        + +  P+++++ TL+S LGST++E +KS   R FVDY LN
Sbjct: 266 STF-GDTDTNVALHVQGQVPTPMIFPSLSKVNTLVSALGSTTFEQKKSHVSRDFVDYDLN 324

Query: 356 MQMAKTFAPDPKK-GTVKHMVIVTSFNHLALGMVSQYFRTKQRLENDLTYDVPGLTHLTI 414
            +MA+ F  +  + G  K +V++TSFN+ AL   S YF TK +LE DL   +P L  L I
Sbjct: 325 FKMAEEFTTNSSEHGIKKKVVVITSFNNFALSSTSPYFHTKLKLEQDLATRIPELDELVI 384

Query: 415 LRPGPLLGEHGSKPVISPTNP--DTGNML----TRCYTYKKNVMRTQFNWLAQVKEVGPT 468
           LRPGPL+G H   P   P +P   T  +L    T CY YKK     + ++L  V +VG  
Sbjct: 385 LRPGPLIGSHT--PEFIPGDPPKSTNGLLKPLSTVCY-YKKACYDHKRHFLQSVTQVGLK 441

Query: 469 TKVTELVAKATYHLPGNWIVGYS 491
           TK+TE+ A+  Y    +W+ GYS
Sbjct: 442 TKMTEVFARLIYRSSCSWMFGYS 464

>Kwal_34.15989 s34 complement(147085..148605) [1521 bp, 506 aa] {ON}
           YDR317W - Hypothetical ORF [contig 272] FULL
          Length = 506

 Score =  155 bits (393), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 112/417 (26%), Positives = 193/417 (46%), Gaps = 81/417 (19%)

Query: 167 NDTGENYVLLGSTGLTGSQVLQDLITPWI------------------------------- 195
           N T ++ ++ G TGLTG  +  +L  PW+                               
Sbjct: 73  NRTVDSTLIFGITGLTGGLIAANLAQPWVYLNATNDLQRKISSLFPFSDQLEKHHHFMRR 132

Query: 196 -GAPLEGV--------TARTFWCFSRKFQDVE-IDISNLPKTWTAIVEFEGEKHVIRKND 245
             +PL  +          +  +CF+R+   +E I +  L  +W   ++++G K V  K +
Sbjct: 133 TRSPLCNLLTKEKSVEVTKNLFCFTRRSVTLEQICLDGLDASWEHSIDYKGSKMVCSKEN 192

Query: 246 VR------------LIRHLSECGGM---LGLKCHWDQYNWDVVLTTGEVRNAT------- 283
           +               +  S+   +   + L+      N+D    + +V   T       
Sbjct: 193 LSCEEPFVKRGTTTFFQDASDAPAVTLTIQLQKFTYHLNYD---NSRDVHGETCRHTLMI 249

Query: 284 ---INVVQVVQPDSRRWPDLFNKMFTGGVR----TFNAYSEIYM---PAVTEIETLISTL 333
              +N++ +V+ DS++WP L  ++F               E  +   P +T+I T++S+L
Sbjct: 250 QLRVNIILIVEEDSQKWPMLLTRIFGKHASKRPLIVKDTEEPILWTAPPLTQINTMVSSL 309

Query: 334 GSTSWEARKSKAPRAFVDYTLNMQMAKTFAPDPKKGTVKHMVIVTSFNHLALGMVSQYFR 393
           GS S+E +K K  R F DY LNM +A  F  D  +G  K +VI+TSFN+L L   S YF+
Sbjct: 310 GSKSFEKKKPKISRHFADYELNMLLAHAFCKDKTRGLEKKIVIITSFNNLFLSSTSDYFQ 369

Query: 394 TKQRLENDLTYDVPGLTHLTILRPGPLLGEHGSKPVISPTNPDTGNM----LTRCYTYKK 449
           +K  LE DL   V  L  L +LRPGPL+G H  + + SP+  D  +     + +   +KK
Sbjct: 370 SKLMLEQDLVTKVQALDKLVLLRPGPLVGNHTHQ-LQSPSIIDKPSFIPTAMFKVLKFKK 428

Query: 450 NVMRTQFNWLAQVKEVGPTTKVTELVAKATYHLPGNWIVGYSIPAGRVAQIAAQEAL 506
           N +  +   L ++ +VG  TK++EL+A+  Y    + ++G+ +PA +VA +A+  A+
Sbjct: 429 NCIERKLQLLREISQVGIRTKLSELMARLAYQRSCSPLLGHVVPAYKVAFVASIRAV 485

>Skud_4.583 Chr4 (1038472..1039719) [1248 bp, 415 aa] {ON} YDR317W
           (REAL)
          Length = 415

 Score =  152 bits (383), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 80/233 (34%), Positives = 138/233 (59%), Gaps = 12/233 (5%)

Query: 286 VVQVVQPDSRRWPDLFNKMFTG--GVRTFNAYSEIY-----MPAVTEIETLISTLGSTSW 338
           V Q++ P S  WP L +++F+    +  F+  ++ Y     +P++ +I T++ TLGSTS 
Sbjct: 168 VTQLIIPPSESWPRLLSRIFSKEQKLEKFDIDNKTYVADKSLPSLRDIGTMVCTLGSTSA 227

Query: 339 EARKSKAPRAFVDYTLNMQMAKTFAPDPKKGTVKHMVIVTSFNHLALGMVSQYFRTKQRL 398
             R+++ P +FVDY L   +A+ FA      T K +V+VTSFN+  L    +YFR K +L
Sbjct: 228 RVRRTQVPNSFVDYHLVFSLAQEFA----NTTNKRLVVVTSFNNDLLMRTFEYFRIKAKL 283

Query: 399 ENDLTYDVPG-LTHLTILRPGPLLGEHGSKPVISPTNPDTGNMLTRCYTYKKNVMRTQFN 457
           ENDL   +P  L  L ILRPGP+ G+HG    +     +      R   Y + V++ +  
Sbjct: 284 ENDLEEALPNKLKELVILRPGPMCGQHGDPVNVKLDVQENPTFSERILYYPRYVLKYKKQ 343

Query: 458 WLAQVKEVGPTTKVTELVAKATYHLPGNWIVGYSIPAGRVAQIAAQEALVKRN 510
           ++++ ++VG  TK++EL+A + Y +PG+ ++GYS+P  +V+ + + +A+ KR+
Sbjct: 344 YISEARKVGLRTKLSELIASSIYRMPGSALLGYSVPVSKVSYVTSLKAIEKRS 396

>Suva_2.486 Chr2 (859579..860826) [1248 bp, 415 aa] {ON} YDR317W
           (REAL)
          Length = 415

 Score =  151 bits (381), Expect = 9e-40,   Method: Compositional matrix adjust.
 Identities = 79/232 (34%), Positives = 136/232 (58%), Gaps = 12/232 (5%)

Query: 286 VVQVVQPDSRRWPDLFNKMFTG--GVRTFNAYSEIY-----MPAVTEIETLISTLGSTSW 338
           V Q+V P S  WP L  ++F+G   +  F+  S  Y     +PA+  I T++  LGS++ 
Sbjct: 168 VTQLVIPQSTSWPKLLPEVFSGTQKLERFDVDSRDYVSDKSLPALNSIGTMVCALGSSAA 227

Query: 339 EARKSKAPRAFVDYTLNMQMAKTFAPDPKKGTVKHMVIVTSFNHLALGMVSQYFRTKQRL 398
             RKS+ P +FVDY L+  +A+ F       T K +V++TSFN+  L    +YFR K +L
Sbjct: 228 RVRKSQVPNSFVDYHLSFNLAQEFT----NTTDKKLVVITSFNNDFLSRTFEYFRIKAKL 283

Query: 399 ENDLTYDVPG-LTHLTILRPGPLLGEHGSKPVISPTNPDTGNMLTRCYTYKKNVMRTQFN 457
           ENDL   +P  L  L ILRPGP+ G+HG+   +         +  R + Y + +++ +  
Sbjct: 284 ENDLEEALPNKLKELIILRPGPMCGQHGNPVHVEMDIQQNPTLSERFFYYPRYILKYKQQ 343

Query: 458 WLAQVKEVGPTTKVTELVAKATYHLPGNWIVGYSIPAGRVAQIAAQEALVKR 509
            +++V++VG  T+++E++A + Y +PG+ ++GYS+P  +V+ +A+  A+ K+
Sbjct: 344 CISEVRKVGLRTRLSEVIASSIYRMPGSALLGYSVPVSKVSYVASLMAIEKK 395

>Smik_4.576 Chr4 (1028647..1029894) [1248 bp, 415 aa] {ON} YDR317W
           (REAL)
          Length = 415

 Score =  148 bits (373), Expect = 9e-39,   Method: Compositional matrix adjust.
 Identities = 77/233 (33%), Positives = 138/233 (59%), Gaps = 12/233 (5%)

Query: 286 VVQVVQPDSRRWPDLFNKMFTG--GVRTFNAYSEIY-----MPAVTEIETLISTLGSTSW 338
           V Q++ P S  W  L + +F+G   +  F+A ++ Y     +P + +I T++ TLGSTS 
Sbjct: 168 VTQLIIPRSENWSRLLSYIFSGTQKLEKFDANNKTYVAGKSLPNLRDISTMVCTLGSTSA 227

Query: 339 EARKSKAPRAFVDYTLNMQMAKTFAPDPKKGTVKHMVIVTSFNHLALGMVSQYFRTKQRL 398
             R+++ P +FVDY+L   +A+ F       T K +VI+TSFN+  L    +YFR K +L
Sbjct: 228 RVRRTQVPNSFVDYSLPFSLAQEFT----NTTDKRLVIITSFNNKFLSTTFEYFRIKAKL 283

Query: 399 ENDLTYDVPGL-THLTILRPGPLLGEHGSKPVISPTNPDTGNMLTRCYTYKKNVMRTQFN 457
           ENDL   +P     L ILRPGP+ G+HG+   +     +      +   Y + ++  +  
Sbjct: 284 ENDLEEVLPNKPKELIILRPGPMCGQHGNSIKVELDVQENLTFSDKILYYPRYLLMYKKQ 343

Query: 458 WLAQVKEVGPTTKVTELVAKATYHLPGNWIVGYSIPAGRVAQIAAQEALVKRN 510
           ++++V+++G  TK++EL+A +TY +PG+ ++GYS+P  +V+ +A+  A+ +++
Sbjct: 344 YISEVRKIGLRTKLSELIASSTYRMPGSALLGYSVPVSKVSYVASLMAIERKS 396

>YDR317W Chr4 (1102184..1103428) [1245 bp, 414 aa] {ON}  HIM1Protein
           of unknown function involved in DNA repair
          Length = 414

 Score =  144 bits (363), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 75/256 (29%), Positives = 145/256 (56%), Gaps = 17/256 (6%)

Query: 267 QYNWDVVLTTGEVRNATI----NVVQVVQPDSRRWPDLFNKMFTG--GVRTFNAYSEIY- 319
           Q+++ +    G+ +   I     V Q++ P S  WP L  ++F+G   +  F+  ++ Y 
Sbjct: 145 QFSYTLHYACGKEKGIEIICNFTVTQLIIPRSETWPKLLPRIFSGTQKLEKFDIDNKNYV 204

Query: 320 ----MPAVTEIETLISTLGSTSWEARKSKAPRAFVDYTLNMQMAKTFAPDPKKGTVKHMV 375
               +P++ +I T++ +LGSTS   R+++ P +F DY L   +A+ F       T K +V
Sbjct: 205 PGRSLPSLCDISTMVCSLGSTSARVRRTQVPSSFADYYLPFNLAQEFT----NTTNKRLV 260

Query: 376 IVTSFNHLALGMVSQYFRTKQRLENDLTYDVPG-LTHLTILRPGPLLGEHGSKPVISPTN 434
           + T+FN+  L    +YFR K +LENDL   +P  L  L ILRPGP+ G+HG+ P+     
Sbjct: 261 VTTAFNNDFLSKTFEYFRIKAKLENDLDEALPNKLKELVILRPGPMCGQHGN-PINVELG 319

Query: 435 PDTGNMLTRCYTYKKNVMRTQFNWLAQVKEVGPTTKVTELVAKATYHLPGNWIVGYSIPA 494
            +    L + + Y   ++  +  ++++ + +G  TK++E++A + Y +PG+ ++GY++P 
Sbjct: 320 KENSTFLEKIFYYPHYLLVYKKKYISEARRIGLRTKLSEIIASSIYRMPGSALLGYAVPV 379

Query: 495 GRVAQIAAQEALVKRN 510
            +V+ +A+  A+ +++
Sbjct: 380 SKVSYVASLMAIERKS 395

>KLTH0H14784g Chr8 (1283834..1285378) [1545 bp, 514 aa] {ON} weakly
           similar to uniprot|Q06674 Saccharomyces cerevisiae
           YDR317W Hypothetical ORF
          Length = 514

 Score =  144 bits (363), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 119/412 (28%), Positives = 175/412 (42%), Gaps = 76/412 (18%)

Query: 171 ENYVLLGSTGLTGSQVLQDLITPWI---------------------------------GA 197
           +N ++LG+TGLTGS +L +L  PWI                                  +
Sbjct: 81  DNVLILGATGLTGSLILANLAQPWIYLNATNDLQSKVDSLYPADLERFTKHNIFVKKPKS 140

Query: 198 PLEGVTAR--------TFWCFSRKFQDVE-IDISNLPKTWTAIVEFEGEKHVIRKNDVRL 248
           PL  +  R          +C +R+   VE + +  L  +W   V  +G   +  K  +  
Sbjct: 141 PLCNILVRRKSIEVTKNLYCLARRPIAVEGMPLDGLDASWEHTVRCKGFDLICGKGGISR 200

Query: 249 IRHLSECGGMLGLKCHWDQYNWDVVL--------------------TTGE--VRNATINV 286
              L     M  L    +    +++L                    T G   +    INV
Sbjct: 201 DCTLERNAAMYELASTHNCPGREIILQLQSFSFKLVYENSRDPHGDTCGHALMVKLNINV 260

Query: 287 VQVVQPDSRRWPDLFNKMF------TGGV---RTFNAYSEIYMPAVTEIETLISTLGSTS 337
           + V+  DS+RWP L   +F       G +   +     S    P++ ++ TL+S LGST 
Sbjct: 261 ICVIDTDSQRWPALLTDVFGEQPMKRGLIPQGQGLEGISHWEFPSLGDVGTLVSALGSTR 320

Query: 338 WEARKSKAPRAFVDYTLNMQMAKTFAPDPKKGTVKHMVIVTSFNHLALGMVSQYFRTKQR 397
            + RKS  PR +VDY LN+ +A+ F     +GT K +V+VTSFN   L  VS YF+TK +
Sbjct: 321 HQERKSSIPRHYVDYELNLTLAQEFCQRKARGTRKKIVVVTSFNSSLLSTVSNYFQTKLK 380

Query: 398 LENDLTYDVPGLTHLTILRPGPLLGEHGSKPVISP-TNPDT--GNMLTRCYTYKKNVMRT 454
           LE DL   V G+ +L +LRPGPL+G H       P TN  T     L      KK     
Sbjct: 381 LEQDLYTKVHGMDNLVLLRPGPLVGNHTPHAQTPPATNKFTFLPAALFHILVLKKRCFDR 440

Query: 455 QFNWLAQVKEVGPTTKVTELVAKATYHLPGNWIVGYSIPAGRVAQIAAQEAL 506
           +   L  + +VG   K++EL A+  Y  P   +V     A +VA  AA  A+
Sbjct: 441 KVRLLRDLMKVGLRAKLSELGARLAYQHPCLQLVSSVNAAHKVAFFAASRAI 492

>CAGL0H07161g Chr8 complement(704823..706097) [1275 bp, 424 aa] {ON}
           similar to uniprot|Q06674 Saccharomyces cerevisiae
           YDR317w
          Length = 424

 Score =  134 bits (336), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 112/411 (27%), Positives = 184/411 (44%), Gaps = 100/411 (24%)

Query: 171 ENYVLLGSTGLTGSQVLQDLITPW----------------IGAPLEGVTART-FWCFSRK 213
           +N +L GSTGLTGS V + L+ P                 I   LE VT +T  +CF+RK
Sbjct: 21  KNILLFGSTGLTGSLVFEYLLDPCFYLNSAVELRELLLEAIEEGLENVTIKTCLYCFNRK 80

Query: 214 FQ-------------------------------------DVEIDISNLPKTWTAIVEFEG 236
                                                  D +I+ SN   T+   + ++ 
Sbjct: 81  IGEPLDKYLKSPSANSFGPFCFNGSQYHYNKGTCVPLDIDQDIETSN-DATFDGFLYYKD 139

Query: 237 E-KHVIRKNDVR----------LIRHLSECGGMLGLKCHWDQYNWDVVLTTGEVRNATIN 285
           + K+V  KN +            + ++S  G +L L                   N   N
Sbjct: 140 KGKNVTGKNPISGEYYGKEYMYYLEYMSAEGNLLKL-------------------NFIFN 180

Query: 286 VVQVVQPDSRRWPDLFNKMFTGGVRTFNAYSEI----YMPAVTEIETLISTLGSTSWEAR 341
            +Q++  +S  WP +   +F+  V   +   ++    Y P +++I+T+IST+G+T+   +
Sbjct: 181 HIQLIIKNSFSWPSVIPIIFSDEVEAISFREKMPLKRYFPLLSDIKTMISTIGTTTNRNK 240

Query: 342 KSKAPRAFVDYTLNMQMAKTFAPDPKKGTVKHMVIVTSFNHLALGMVSQYFRTKQRLEND 401
            S      +DY LN+ + K F+    K     ++IVTSFN+  +  VS YF+ K +LE+ 
Sbjct: 241 ISNTTYNDIDYQLNVDLVKAFSNTDDKS----VIIVTSFNNTIISTVSPYFKIKMKLEST 296

Query: 402 LTYDV-PGLTHLTILRPGPLLGEHGSKPVISPTNPD---TGNMLTRCYTYKKNVMRTQFN 457
           L   + P L  LTILRPGPL+G H     I PTN       ++  R   +KK  ++    
Sbjct: 297 LANAITPPLKTLTILRPGPLVGRHSD---IYPTNDSILKNSSLFERALLHKKAFLQNMEC 353

Query: 458 WLAQVKEVGPTTKVTELVAKATYHLPGNWIVGYSIPAGRVAQIAAQEALVK 508
           ++  ++  G + K +E+VA+  Y +PG+ ++GY IPA +VA   +  A+ K
Sbjct: 354 FVDDIRTGGMSIKASEIVARTFYRIPGSKLLGYCIPAQKVAYAISIAAVDK 404

>ZYRO0F00550g Chr6 complement(51742..52989) [1248 bp, 415 aa] {ON}
           similar to uniprot|Q06674 Saccharomyces cerevisiae
           YDR317W Hypothetical ORF
          Length = 415

 Score =  131 bits (330), Expect = 8e-33,   Method: Compositional matrix adjust.
 Identities = 103/380 (27%), Positives = 177/380 (46%), Gaps = 68/380 (17%)

Query: 174 VLLGSTGLTGSQVLQDLITPWI----GAPLEG-------------VTARTFWCFSRKFQD 216
           +L GSTGL GS  L++L+   +    G  L+                 + F+C +RK  +
Sbjct: 18  LLFGSTGLIGSLTLEELLKVELYLDAGNDLQSKLELYENSDINHFTLNKFFYCVNRKLNN 77

Query: 217 VEIDISN---LPKTWTAIVEFEGEKHVIRKN-----------DVRLIRHLSECGGMLGLK 262
            +    N   + +     + F G+ + +  N           +  L  ++ E  G + L 
Sbjct: 78  EKRSPGNEYLMERCKATPLVFRGQDYYLHNNTSATPPASQSSNPSLGNNVFEEDGTIQLT 137

Query: 263 CHWD-----------QYNWDVVLTTGEVRNATIN----VVQVVQPDSRRWPDLFNKMFTG 307
              D           + ++ +   + +++N  I     +VQ+V  DS RW DL   +F+G
Sbjct: 138 KTVDNRSVTLRFRQTRKSYQLEYISKDLKNLLITFHFTIVQLVFEDSTRWADLLPSIFSG 197

Query: 308 GVRTF---NAYSEIYMPAVTEIETLISTLGSTSWEARKSKAPRAFVDYTLNMQMAKTFAP 364
            V      + ++   +P + +++T+I TLG  S   + S   R FV+Y L  Q+ + FA 
Sbjct: 198 EVELVPEESNHTSPRLPHLDQVKTMICTLGPNSSSTKHSHYDRYFVEYQLTFQIVQNFA- 256

Query: 365 DPKKGTVKHMVIVTSFNHLALGMVSQYFRTKQRLENDLTYDV-PGLTHLTILRPGPLLGE 423
                  K +VI+TSFN+  +  +  YF+ K +LENDL   V P L  L +LRPGP++G 
Sbjct: 257 ---SCEDKRLVIMTSFNNSLVSHIFPYFKAKYQLENDLQNKVAPALAQLVVLRPGPIVGN 313

Query: 424 H---GSKPVISPTNPDTGNMLTR----CYTYKKNVMRTQFNWLAQVKEVGPTTKVTELVA 476
           H     + +    +P     L      C+ YKK+ ++       +++++G  TK +ELVA
Sbjct: 314 HVNLNDRDLRLRYSPSLCEQLKHYKEWCWEYKKSFVK-------EIRKIGFKTKASELVA 366

Query: 477 KATYHLPGNWIVGYSIPAGR 496
           KA Y  PG+ ++GY +PA +
Sbjct: 367 KAMYRKPGSSVLGYCVPASK 386

>Kpol_1051.4 s1051 (8692..9972) [1281 bp, 426 aa] {ON} (8692..9972)
           [1281 nt, 427 aa]
          Length = 426

 Score =  109 bits (272), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 73/262 (27%), Positives = 137/262 (52%), Gaps = 22/262 (8%)

Query: 284 INVVQVVQPDSRRWPDLFNKMFTGGV------RTFNAYSEIYMPAVTEIETLISTLG-ST 336
           I+V  ++ P S +WP L  ++F             N+     +P +  I T+IS+LG + 
Sbjct: 173 ISVYHIIIPTSNQWPTLLPRIFNPATVIEKVEDKENSILPTGLPDLKNIPTMISSLGLNH 232

Query: 337 SWEARKSKAPRAFVDYTLNMQMAKTFAPDPKKGTVKHMVIVTSFNHLALGMVSQYFRTKQ 396
             +  + K+ RA +D+ L +++ +TFA        K +V++T+FN+  +  + +YF  K 
Sbjct: 233 RQQITREKSYRA-IDFDLTLKLTQTFA----NNNNKKLVVITTFNNKVVSKMFRYFHFKF 287

Query: 397 RLENDLTYDV-PGLTHLTILRPGPLLG---EHGSKPVISPTNPDTGNMLTRCYTYKKNVM 452
           ++E  L  ++ P L+ L ILRPGP++G        P  +P    + N++ +    KK ++
Sbjct: 288 KIEEALQNELNPKLSQLVILRPGPIVGVPMTDAINPEFNPILKKSDNLVEQSILLKKYLL 347

Query: 453 RTQFNWLAQVKEVGPTTKVTELVAKATYHLPGNWIVGYSIPAGRVAQIAAQEALVKRNYI 512
             +   L + +  G   ++T+++AK  Y  PG  ++GY IPA +VA++AA +A      I
Sbjct: 348 DYKLATLKKYRSTGIAPRLTDILAKTMYRKPGTSVLGYCIPATKVAKVAALKA------I 401

Query: 513 KQNLRSSSMIVEVTIWSSQDMD 534
           +  + S+    +V I +S+ +D
Sbjct: 402 EPTIASTYSKPDVQIITSRQID 423

>KAFR0C01880 Chr3 complement(374180..375217) [1038 bp, 345 aa] {ON}
           Anc_5.348 YDR317W
          Length = 345

 Score = 99.4 bits (246), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 67/178 (37%), Positives = 94/178 (52%), Gaps = 15/178 (8%)

Query: 281 NATINV--VQVVQPDSRRWPDLFNKMFTGG-------VRTFNAYSEIYMPA-VTEIETLI 330
           N T NV  VQ+V  +S +WPDL   +FTG         R    + E++  A + +I T++
Sbjct: 145 NVTYNVFHVQIVYNESEKWPDLLPILFTGENEIKIARKRKDRLFPELFKLANINDISTVV 204

Query: 331 STLGSTSWEARKSKAPRAFVDYTLNMQMAKTFAPDPKKGTVKHMVIVTSFNHLALGMVSQ 390
            TLG++S  A+K       +DY L   + + F     K     ++IVTSFN+  +  +  
Sbjct: 205 CTLGASSATAKKQNMTVNKIDYDLTYNLIRAFTTTENKK----VIIVTSFNNALISNIFP 260

Query: 391 YFRTKQRLENDLTYDV-PGLTHLTILRPGPLLGEHGSKPVISPTNPDTGNMLTRCYTY 447
           YFRTK RLENDL   + P +  L ILRPGP+ G+H SK     TN  T N +TR   Y
Sbjct: 261 YFRTKLRLENDLKTTLEPPIKELYILRPGPIKGKHRSKESEISTNIRTLNPITRAIHY 318

>KLLA0B10120g Chr2 (886187..887233) [1047 bp, 348 aa] {ON} some
           similarities with uniprot|Q06674 Saccharomyces
           cerevisiae YDR317W
          Length = 348

 Score = 95.5 bits (236), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 90/362 (24%), Positives = 168/362 (46%), Gaps = 45/362 (12%)

Query: 186 VLQDLITPWIGAPLEGVTARTFWCFSRKFQDVEIDISNLPKTWTAIVEFEGEKHVIRKND 245
           VLQ +++     P+  V   T               SNL      I+    +  +    +
Sbjct: 19  VLQQMLSLPSYFPVIDVPTLT---------------SNLELNHHIIIITRSQFDL--GTE 61

Query: 246 VRLIRHLSECGGMLGLKCHWDQYNWDVVLTTG--EVRNATIN--VVQVVQPDSRRWPDLF 301
           V  I  + +   ++  KC +++ +  +  +T   ++ +  +N  V  + +PDS +W  + 
Sbjct: 62  VEKISSMFQKSDLVEWKCVFNESSNTISYSTTIHDLISICVNVEVTTIKEPDSTKWAQMI 121

Query: 302 NKMFTGGVRTFNAYSEIYMPAVTEIETLISTLGSTSWEARKSKAPRAFVDYTLNMQMAKT 361
                           I++   +   ++IS LGSTS  ++++   R +VD  LN+ + K 
Sbjct: 122 PH-------------HIFINDPSADLSVISCLGSTSARSKRTGVARDWVDKILNLDILKA 168

Query: 362 FA-PDPKKGTVKHMVIVTSFNHLALGMVSQYFRTKQRLENDLTYDVPG-LTHLTILRPGP 419
               D     +   +I+TSFN+ A+  +  YF+ KQ LE +  + +      + ILRPGP
Sbjct: 169 ILNNDILSQKLSQYIIMTSFNNFAISRMFPYFKAKQELETNTQFLLQNHRASIVILRPGP 228

Query: 420 LLGEHGSKPVISPTNPDTGN-MLTRCYTYKKNVMRTQFNWLAQVKEVGPTTKVTELVAKA 478
           L+G+HGS    S T P+  + +L     YKK +       + + K+VG  T+ +ELVA+ 
Sbjct: 229 LIGKHGSTS--SFTVPELDDRLLHSILRYKKAIFHHYVRRMNEWKDVGIATRTSELVAQF 286

Query: 479 TYHLPGNWIVGYSIPAGRVAQIAAQEALVKRNYIKQNLRSSSMIVEVTIWSSQDMDTAET 538
           +Y++PG + VGY +     A +   E +  +++   +L+      +VT +SSQ +D+ + 
Sbjct: 287 SYNMPGAFFVGYPVKVLDCAHVIVTERV--KHFKLPSLQPQ----KVTYFSSQQIDSYKA 340

Query: 539 SN 540
            N
Sbjct: 341 KN 342

>TPHA0D02060 Chr4 (424797..426287) [1491 bp, 496 aa] {ON} Anc_5.348
           YDR317W
          Length = 496

 Score = 88.6 bits (218), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 66/266 (24%), Positives = 124/266 (46%), Gaps = 26/266 (9%)

Query: 260 GLKCHWDQYNWDVVL----TTGEVR--NATINVVQVVQPDSRRWPDLFNKMF-------- 305
            ++C+++   +D  L    ++G++   N  + +  +   DS  WP L   +F        
Sbjct: 212 NVECYFNLQQYDSSLIFASSSGDILKINFDLKLYHLSAVDSTIWPSLLPVLFDSNTKLVP 271

Query: 306 -TGGVRTFNAYSEIYMPAVTEIETLISTLGSTSWEARKSKAPRAFVDYTLNMQMAKTFAP 364
             G +   +  +E  +P ++E++ ++++LGS S   +        +DY LN+ +  +F  
Sbjct: 272 NKGLIENIDLTNE-KLPLLSEVKVMLNSLGSRSHSPKNETFKN--IDYKLNLSLINSF-- 326

Query: 365 DPKKGTVKHMVIVTSFNHLALGMVSQYFRTKQRLENDLTYDVPG-LTHLTILRPGPLLGE 423
                + K ++I+TS N       S+Y   K  LE DL  ++   +  L ILRPGPL+G 
Sbjct: 327 --NNTSDKKVIIITSVNKKIYTFFSRYLNYKMVLEEDLKTNLDNKINELVILRPGPLVGT 384

Query: 424 HGSK---PVISPTNPDTGNMLTRCYTYKKNVMRTQFNWLAQVKEVGPTTKVTELVAKATY 480
             +    P ++       + L +   YK+     +   L ++K  G     T ++AK  Y
Sbjct: 385 PMTTKLIPGLTAHLKRNDSSLKQLINYKRFAFDYKVALLRRIKYTGFEPTCTNILAKTFY 444

Query: 481 HLPGNWIVGYSIPAGRVAQIAAQEAL 506
             PG  ++GY+IPA +VA++   + L
Sbjct: 445 RRPGTSLLGYTIPASKVAEVMVFKGL 470

>TBLA0A03100 Chr1 (739771..740889) [1119 bp, 372 aa] {ON} Anc_5.348
           YDR317W
          Length = 372

 Score = 75.9 bits (185), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 54/163 (33%), Positives = 77/163 (47%), Gaps = 25/163 (15%)

Query: 281 NATINVVQVVQPDSRRWPDLFNKMFT-------------GGVRTF-NAYSEIYMPAVTEI 326
           N  IN+ Q V P S  W ++   +F                +  F N  S I +P + +I
Sbjct: 190 NYIINIYQFVLPKSDTWLEVLPNIFKPTTILHSKINCTWNYIDQFTNEKSNIVLPKLEDI 249

Query: 327 ETLISTLGSTSWEARKSKAPRAFVDYTLNMQMAKTFAPDPKKGTVKHMVIVTSFNHLALG 386
           + +I TLG+     +K       +D+ L  Q++  F+   + G  K +VIVT+FN+  L 
Sbjct: 250 QVMICTLGTNLLCDQKK------IDFDLTFQLSNWFSN--RLG--KKLVIVTAFNNSLLS 299

Query: 387 MVSQYFRTKQRLENDLTYDVPG-LTHLTILRPGPLLGEHGSKP 428
               YF  K +LE  L YD+   L  L ILRPGPLLG H   P
Sbjct: 300 KTFNYFNVKNQLEKSLKYDLDFPLGELVILRPGPLLGTHVLNP 342

>ZYRO0D09548g Chr4 (812531..813208) [678 bp, 225 aa] {ON} similar to
           uniprot|P40008 Saccharomyces cerevisiae YER004W FMP52
           The authentic non-tagged protein was localized to the
           mitochondria
          Length = 225

 Score = 53.9 bits (128), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 51/175 (29%), Positives = 75/175 (42%), Gaps = 31/175 (17%)

Query: 255 CGG-MLGLKCHWDQYNWDVVLTTGEVRNATINVVQVVQPDSRRWPDLFNKMFTGGVRTFN 313
           CGG  L      D++     +T  E+ +   NV Q+V+ DS +W  LF +          
Sbjct: 12  CGGSFLRNAIASDKFTEVFTITRRELPSDADNVKQIVETDSSKWAQLFPE---------- 61

Query: 314 AYSEIYMPAVTEIETLISTLGSTSWEARKSKAPRAFVDYTLNMQMAKTFAPDPKKGTVKH 373
                     T ++   S  G+T   A  ++     +D+ LN+++AK      K      
Sbjct: 62  ----------TGVKFYFSAFGTTRAAAGSAENFYK-IDHDLNVELAKA----AKTKGCTT 106

Query: 374 MVIVTSFNHLALGMVSQYFRTKQRLEND-LTYDVPGLTHLTILRPGPLLGEHGSK 427
           MV+V+S       M+  YF+ K  +E D L  D     H  ILRPGPLLG   SK
Sbjct: 107 MVLVSSVGANENSML-PYFKDKGEIERDILALD---FDHTIILRPGPLLGRQKSK 157

>KLTH0H00264g Chr8 complement(23047..23715) [669 bp, 222 aa] {ON}
           similar to uniprot|P40008 Saccharomyces cerevisiae
           YER004W FMP52 The authentic non-tagged protein was
           localized to the mitochondria
          Length = 222

 Score = 46.6 bits (109), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 38/118 (32%), Positives = 59/118 (50%), Gaps = 10/118 (8%)

Query: 327 ETLISTLGSTSWEARKSKAPRAFVDYTLNMQMAKTFAPDPKKGTVKHMVIVTSFNHLALG 386
           + L S L +T  EA K    +  VD+ +N+Q+A++     K+      V+V+S       
Sbjct: 67  DILFSGLATTRGEAGKENFYK--VDHDMNLQLARS----AKEKGYSTYVVVSSTGADENS 120

Query: 387 MVSQYFRTKQRLENDLTYDVPGLTHLTILRPGPLLGEH-GSKPVISPTNPDTGNMLTR 443
           M   Y +TK  LE D+     G     ILRPGPLLGE   SK +++  +   G+++ R
Sbjct: 121 MF-YYMKTKGELERDIL--ALGFERTIILRPGPLLGERTKSKGLLNGLSSKIGSIVYR 175

>NCAS0E02080 Chr5 complement(399088..399765) [678 bp, 225 aa] {ON} 
          Length = 225

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 56/230 (24%), Positives = 87/230 (37%), Gaps = 41/230 (17%)

Query: 256 GGMLGLKCHWDQYNWDVVLTTGEVRNATINVVQVVQPDSRRWPDLFNKMFTGGVRTFNAY 315
           GG L       ++N  V LT   +  +     Q+V+PD+ +W  L               
Sbjct: 14  GGFLKEAEKTGKFNTIVTLTRRALPKSDSIATQIVEPDNSKWSHL--------------- 58

Query: 316 SEIYMPAVTEIETLISTLGSTSWEARKSKAPRAFVDYTLNMQMAKTFAPDPKKGTVKHMV 375
               +P  T+   L + L  TS+ A      +  +D+ LN+++AK       K      +
Sbjct: 59  ----IPENTKY--LFTGLSMTSY-ALGGFDNQYKIDHDLNLELAKA-----AKAKGCSTI 106

Query: 376 IVTSFNHLALGMVSQYFRTKQRLENDLTYDVPGLTHLTILRPGPLLGEHGSKPVISPTNP 435
           +V S +  +L     Y R K  +E D+        H  ILRPG LLGE   +        
Sbjct: 107 VVVSSDRASLDSRFSYMRMKGEIERDIV--ALDFDHTIILRPGILLGERDPQTAHKSFTH 164

Query: 436 DTGNMLTRCYTYKKNVMRTQFNWLAQVKEVGPTTKVTELVAKATYHLPGN 485
           D   M+   +       R++  WLA+    G      + V K   HL  N
Sbjct: 165 DAMRMIGGMF------YRSRLAWLAEYPIYG------DEVGKVGVHLALN 202

>TBLA0A10500 Chr1 (2585576..2586289) [714 bp, 237 aa] {ON} Anc_7.148
           YER004W
          Length = 237

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 31/99 (31%), Positives = 49/99 (49%), Gaps = 8/99 (8%)

Query: 325 EIETLISTLGSTSWEARKSKAPRAFVDYTLNMQMAKTFAPDPKKGTVKHMVIVTSFNHLA 384
           +I+ L++ L +T  +A      + ++D+ LN+     FA   K+      V+V+S    A
Sbjct: 66  KIDILMTGLATTK-KAAGGAQQQYYIDHDLNID----FAKKAKENGCSTFVVVSSAGASA 120

Query: 385 LGMVSQYFRTKQRLENDLTYDVPGLTHLTILRPGPLLGE 423
               S++F  K + E +         HL ILRPGPLLGE
Sbjct: 121 ---DSRFFYLKMKGEIERDLKAIDFDHLIILRPGPLLGE 156

>Ecym_4479 Chr4 complement(973594..974268) [675 bp, 224 aa] {ON}
           similar to Ashbya gossypii ADR005W
          Length = 224

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 36/103 (34%), Positives = 51/103 (49%), Gaps = 12/103 (11%)

Query: 326 IETLISTLGSTSWEARKSKAPRAFVDYTLNMQMAKTFAPDPKKGTVKHMVIVTSFNHLAL 385
           I  L S LG+T   A  S   +  +D+ LN+ +AK      K+   K +V+V+S   L  
Sbjct: 64  INVLFSALGTTK-AAAGSIENQYKIDHGLNLAVAKA----AKEKGCKTLVLVSS---LGA 115

Query: 386 GMVSQ--YFRTKQRLENDLTYDVPGLTHLTILRPGPLLGEHGS 426
            + S+  YF+ K  LE D+     G     +LRPG LLGE  S
Sbjct: 116 SIESRLPYFKMKGELERDVL--ALGFERTILLRPGVLLGERDS 156

>NDAI0E03640 Chr5 complement(784609..785286) [678 bp, 225 aa] {ON}
           Anc_7.148 YER004W
          Length = 225

 Score = 40.8 bits (94), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 48/188 (25%), Positives = 81/188 (43%), Gaps = 42/188 (22%)

Query: 286 VVQVVQPDSRRWPDLFNKMFTGGVRTFNAYSEIYMPAVTEIETLISTLGSTSWEARKSKA 345
           + Q+V+ D+ +W  +                   +P   EI  L ++L ST+  A     
Sbjct: 45  ITQLVETDNSKWASM-------------------IPD-KEINVLFTSL-STTRGAAGGFD 83

Query: 346 PRAFVDYTLNMQMAKTFAPDPKKGTVKHMVIVTSFNHLALGMVSQYFRTKQRLENDLTYD 405
            +  +D+ LN+++AK      K+     +V+V+S    A   ++ Y R K  +E D+   
Sbjct: 84  EQYKIDHDLNIELAKA----AKEKGCSTIVLVSSRGAHADSRMA-YTRMKGEIERDII-- 136

Query: 406 VPGLTHLTILRPGPLLGEHGSKPVISPTNPDTG------NMLTR-CYTYKKNVMRTQFNW 458
             G  H  ILRPG LLG+  S       N D+G      +M+    Y +K+N+ +     
Sbjct: 137 ALGFDHTIILRPGILLGQRDS-------NGDSGFGGGIASMIGGFLYNHKRNLFKGHSVE 189

Query: 459 LAQVKEVG 466
              V +VG
Sbjct: 190 AEDVGKVG 197

>TDEL0H03110 Chr8 (512079..512753) [675 bp, 224 aa] {ON} Anc_7.148
           YER004W
          Length = 224

 Score = 39.7 bits (91), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 29/91 (31%), Positives = 45/91 (49%), Gaps = 8/91 (8%)

Query: 350 VDYTLNMQMAKTFAPDPKKGTVKHMVIVTSFNHLALGMVSQYFRTKQRLENDLTYDVPGL 409
           +D+ LN+++AK      K+      V+V+S       M + Y + K  +E D+     G 
Sbjct: 86  IDHDLNIELAKV----AKEKGCSTFVLVSSGGAKEDSMFA-YMKMKGEIERDIL--ALGF 138

Query: 410 THLTILRPGPLLGEH-GSKPVISPTNPDTGN 439
            H  ILRPGPLLG+   SK +I+      G+
Sbjct: 139 DHTIILRPGPLLGDRLTSKGLITDVFSKIGS 169

>TBLA0F03310 Chr6 complement(814437..814922) [486 bp, 161 aa] {ON}
           Anc_7.148 YER004W possible pseudogene; truncated at 5'
           end
          Length = 161

 Score = 38.5 bits (88), Expect = 0.012,   Method: Composition-based stats.
 Identities = 27/74 (36%), Positives = 38/74 (51%), Gaps = 7/74 (9%)

Query: 350 VDYTLNMQMAKTFAPDPKKGTVKHMVIVTSFNHLALGMVSQYFRTKQRLENDLTYDVPGL 409
           +D+ LN+ +AK      K+      V+V+S    A    + Y + K  +E DL  +  G 
Sbjct: 20  IDHNLNIHLAKK----AKENGCSTFVLVSSSLANADSRFT-YLKMKGEIERDL--EAIGF 72

Query: 410 THLTILRPGPLLGE 423
            HL ILRPG LLGE
Sbjct: 73  DHLIILRPGKLLGE 86

>Kpol_312.9 s312 (21577..22242) [666 bp, 221 aa] {ON} (21577..22242)
           [666 nt, 222 aa]
          Length = 221

 Score = 38.9 bits (89), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 38/139 (27%), Positives = 60/139 (43%), Gaps = 29/139 (20%)

Query: 288 QVVQPDSRRWPDLFNKMFTGGVRTFNAYSEIYMPAVTEIETLISTLGSTSWEARKSKAPR 347
           Q+V+ DS +W +L                   +P  T+   L S L +T   A      +
Sbjct: 45  QIVEKDSTKWSEL-------------------IPDDTKY--LFSGLATTR-AAAGGLDNQ 82

Query: 348 AFVDYTLNMQMAKTFAPDPKKGTVKHMVIVTSFNHLALGMVSQYFRTKQRLENDLTYDVP 407
             +DY LN+++AK      K+     +V+V+S        ++ Y + K  +E D+     
Sbjct: 83  YKIDYDLNIELAKA----AKEKGCSTLVLVSSAGANEHSWIA-YLKMKGEIERDMIK--L 135

Query: 408 GLTHLTILRPGPLLGEHGS 426
           G  H  ILRPG +LGE  S
Sbjct: 136 GFDHTIILRPGAILGERTS 154

>TPHA0L00760 Chr12 (143784..144464) [681 bp, 226 aa] {ON} Anc_7.148
           YER004W
          Length = 226

 Score = 38.5 bits (88), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 42/150 (28%), Positives = 69/150 (46%), Gaps = 14/150 (9%)

Query: 281 NATINVVQVVQPDSRRWPDLFNKMFTGGVRTFNAYSEIYMPAVTEIETLISTLGSTSWEA 340
           N +  V Q+     R+  D ++   T   +  N  SE ++  V +   ++ T  ST+  A
Sbjct: 21  NKSDKVSQITTITRRKLADTYDNN-TKINQIINKNSEEWVNEVPKGLDVVFTSLSTTKGA 79

Query: 341 RKSKAPRAFVDYTLNMQMAKTFAPDPKKGTVKHMVIVTSFN---HLALGMVSQYFRTKQR 397
             S   +  +D+ LN+Q+ +      K+   K +V+++S     H   G    Y + K  
Sbjct: 80  AGSLENQYKIDHDLNLQLLEK----AKENGCKTVVLISSSGANEHSWAG----YLKMKGE 131

Query: 398 LENDLTYDVPGLTHLTILRPGPLLGEHGSK 427
           +E D+T    G  H  ILRPG LLGE  S+
Sbjct: 132 IERDVTK--LGFDHTIILRPGVLLGERDSQ 159

>Smik_5.118 Chr5 (163900..164595) [696 bp, 231 aa] {ON} YER004W
           (REAL)
          Length = 231

 Score = 37.7 bits (86), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 25/74 (33%), Positives = 37/74 (50%), Gaps = 7/74 (9%)

Query: 350 VDYTLNMQMAKTFAPDPKKGTVKHMVIVTSFNHLALGMVSQYFRTKQRLENDLTYDVPGL 409
           +D+ LN+Q+A+      K    + +V+V+S    A      Y + K  +E D+       
Sbjct: 89  IDHDLNLQLARA----AKDKGCETIVLVSSAGAHADSRFG-YMKMKGEIERDVI--ALNF 141

Query: 410 THLTILRPGPLLGE 423
            H  ILRPGPLLGE
Sbjct: 142 KHTIILRPGPLLGE 155

>KNAG0L00930 Chr12 (170496..171185) [690 bp, 229 aa] {ON} 
          Length = 229

 Score = 36.6 bits (83), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 31/98 (31%), Positives = 45/98 (45%), Gaps = 8/98 (8%)

Query: 326 IETLISTLGSTSWEARKSKAPRAFVDYTLNMQMAKTFAPDPKKGTVKHMVIVTSFNHLAL 385
           ++ LI  LG+T   AR +   +  VD+ L +++A       K+    H V+V S      
Sbjct: 69  LDVLICALGTT--RARSNAEEQYAVDHDLTLELATV----AKREKHAHTVVVVSSTGAHP 122

Query: 386 GMVSQYFRTKQRLENDLTYDVPGLTHLTILRPGPLLGE 423
                Y R K  +E D+T       H  +LRPG LLGE
Sbjct: 123 ESRFFYARMKGDVERDITE--LQFNHTVLLRPGILLGE 158

>Skud_5.103 Chr5 (156788..157471) [684 bp, 227 aa] {ON} YER004W
           (REAL)
          Length = 227

 Score = 36.2 bits (82), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 31/117 (26%), Positives = 52/117 (44%), Gaps = 10/117 (8%)

Query: 350 VDYTLNMQMAKTFAPDPKKGTVKHMVIVTSFNHLALGMVSQYFRTKQRLENDLTYDVPGL 409
           +D+ LN+Q+A+      K+   + +V+V+S           Y + K  +E D+       
Sbjct: 89  IDHDLNLQLARA----AKEKGCETIVLVSSAGAHPDSRFG-YMKMKGEIERDVI--ALNF 141

Query: 410 THLTILRPGPLLGEHGSKPVISPTNPDTGNMLTRCYTYKKNVMRTQFNWLAQVKEVG 466
            H  ILRPGPLLGE             T  + TR Y   ++++++   +     EVG
Sbjct: 142 KHTIILRPGPLLGERTKSKQSGFGGNLTAALGTRVY---RSILQSWLGYPVYGDEVG 195

>YER004W Chr5 (159580..160275) [696 bp, 231 aa] {ON}  FMP52Protein
           of unknown function, localized to the mitochondrial
           outer membrane; induced by treatment with
           8-methoxypsoralen and UVA irradiation
          Length = 231

 Score = 36.2 bits (82), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 24/74 (32%), Positives = 38/74 (51%), Gaps = 7/74 (9%)

Query: 350 VDYTLNMQMAKTFAPDPKKGTVKHMVIVTSFNHLALGMVSQYFRTKQRLENDLTYDVPGL 409
           +D+ LN+Q+A+      K+   + +V+V+S           Y + K  +E D+       
Sbjct: 89  IDHDLNLQLAQA----AKEKGCETIVLVSSAGAHPDSRFG-YMKMKGEIERDVI--ALDF 141

Query: 410 THLTILRPGPLLGE 423
            H+ ILRPGPLLGE
Sbjct: 142 KHIIILRPGPLLGE 155

>KAFR0G02750 Chr7 (569916..570593) [678 bp, 225 aa] {ON} Anc_7.148
           YER004W
          Length = 225

 Score = 35.4 bits (80), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 25/74 (33%), Positives = 38/74 (51%), Gaps = 7/74 (9%)

Query: 350 VDYTLNMQMAKTFAPDPKKGTVKHMVIVTSFNHLALGMVSQYFRTKQRLENDLTYDVPGL 409
           +D+ LN+++AK      ++     +VIVT+    A    S++F TK + E +      G 
Sbjct: 89  IDHDLNVELAKA----AREKGCSTIVIVTAHGAHA---DSRFFYTKMKGEIERDISDLGF 141

Query: 410 THLTILRPGPLLGE 423
               ILRPG LLGE
Sbjct: 142 NRTIILRPGILLGE 155

>Suva_5.91 Chr5 (135337..136023) [687 bp, 229 aa] {ON} YER004W
           (REAL)
          Length = 229

 Score = 35.0 bits (79), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 24/74 (32%), Positives = 39/74 (52%), Gaps = 7/74 (9%)

Query: 350 VDYTLNMQMAKTFAPDPKKGTVKHMVIVTSFNHLALGMVSQYFRTKQRLENDLTYDVPGL 409
           +D+ LNMQ+A+  A D  +G    +++ ++  H+       Y + K  +E D+       
Sbjct: 89  IDHDLNMQLARA-AKD--RGCDTIVLVSSAGAHVDSRF--GYMKMKGEIERDII--ALNF 141

Query: 410 THLTILRPGPLLGE 423
            H  ILRPGPLLG+
Sbjct: 142 KHTIILRPGPLLGK 155

>NCAS0E02090 Chr5 complement(400057..400734) [678 bp, 225 aa] {ON} 
          Length = 225

 Score = 34.3 bits (77), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 26/75 (34%), Positives = 37/75 (49%), Gaps = 9/75 (12%)

Query: 350 VDYTLNMQMAKTFAPDPKKGTVKHMVIVTSFNHLALGMVSQYFRTKQRLEND-LTYDVPG 408
           +D+ LN+ +AK      +KG     V++ S +  +L     Y R K  +E D L  D   
Sbjct: 86  IDHDLNVDLAKAA---KEKGC--STVVLVSSSGASLDSRFSYMRMKGEIERDILALD--- 137

Query: 409 LTHLTILRPGPLLGE 423
             H  ILRPG LLG+
Sbjct: 138 FDHTIILRPGILLGD 152

>KNAG0L00925 Chr12 (169763..170449) [687 bp, 228 aa] {ON}
          Length = 228

 Score = 33.1 bits (74), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 36/145 (24%), Positives = 63/145 (43%), Gaps = 30/145 (20%)

Query: 285 NVVQVVQPDSRRWPDLFNKMFTGGVRTFNAYSEIYMPAVTEIETLISTLGSTSWEARKSK 344
            +V +V+PD + W                 ++   +P   +++ L+S LG+T   A    
Sbjct: 46  KLVALVEPDGKLW----------------GHAVRGIPG--DLDVLLSALGTT--RAAAGA 85

Query: 345 APRAFVDYTLNMQMAKTFAPDPKKGTVKHMVIVTSFNHLALGMVSQYFRTKQRLENDLTY 404
             +  VD+ L + +A+    D      K + +V+S         S++F T  R++ D   
Sbjct: 86  EGQYAVDHDLCVAVARAARNDKN---CKSVALVSSAGA---HTDSRFFYT--RMKGDTER 137

Query: 405 DVPGLT--HLTILRPGPLLGEHGSK 427
           D+  L   H   LRPG LLG+  +K
Sbjct: 138 DIAALAFPHAVFLRPGILLGQRTTK 162

>Skud_2.243 Chr2 complement(438373..442551) [4179 bp, 1392 aa] {ON}
           YBR115C (REAL)
          Length = 1392

 Score = 32.0 bits (71), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 19/45 (42%), Positives = 25/45 (55%), Gaps = 1/45 (2%)

Query: 147 TNSDSRPGSRHSVIRTNPALNDTGENYVLLGSTGLTGSQVLQDLI 191
           T S S P SR S +  N A  +T  N  + G+TG  GS +L DL+
Sbjct: 948 TLSSSYP-SRESFVEPNSAEGETTINVFVTGTTGFLGSYILADLL 991

>CAGL0F06061g Chr6 complement(604063..605073) [1011 bp, 336 aa] {ON}
           similar to uniprot|Q04212 Saccharomyces cerevisiae
           YMR041c
          Length = 336

 Score = 30.8 bits (68), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 20/77 (25%), Positives = 43/77 (55%), Gaps = 5/77 (6%)

Query: 196 GAPLEGVTARTFWCFSRKFQDVEIDISNLPKTWTAIVEFE-GEKHVIRKNDVRLIRHLSE 254
           G  ++ +  R       K+    I +SN+ +   AI++++  EK  + +ND++L++H+ E
Sbjct: 255 GVEIQDLANRYAMFNWHKYGPTVIGVSNVAELQDAIIDYQITEKDKLPENDIKLVKHIQE 314

Query: 255 CGGMLGLKCHWDQYNWD 271
              +LG + H+++  WD
Sbjct: 315 --EILGTE-HYNE-TWD 327

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.131    0.398 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 49,641,221
Number of extensions: 2003887
Number of successful extensions: 4869
Number of sequences better than 10.0: 38
Number of HSP's gapped: 4925
Number of HSP's successfully gapped: 43
Length of query: 542
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 428
Effective length of database: 40,409,475
Effective search space: 17295255300
Effective search space used: 17295255300
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 68 (30.8 bits)