Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
AGR274C6.69ON37537518770.0
Ecym_31196.69ON37835010611e-143
SAKL0A08206g6.69ON645441267e-07
NCAS0A024504.238ON1928176920.009
ZYRO0E04708gsingletonON611131890.019
TBLA0B099704.46ON1065119860.056
ZYRO0A11132gsingletonON69846800.27
KNAG0A031708.636ON471128790.28
TBLA0I028904.237ON1098152741.2
ZYRO0B01936gsingletonON824115741.4
ADL005C7.137ON325171712.1
Ecym_55145.414ON85488722.2
Suva_15.733.104ON28866712.4
TDEL0G045606.69ON48244712.4
Kwal_23.55345.267ON1907176722.4
ZYRO0F08976g8.520ON183349722.7
Kpol_1023.302.409ON127569712.8
Kwal_23.34422.325ON1396100713.5
NCAS0C036803.175ON1208138703.8
Smik_14.1072.16ON58288694.3
CAGL0I02838g2.162ON65552704.4
KLLA0E05281g4.238ON175599704.9
Smik_16.2923.330ON1181128695.6
YGL228W (SHE10)3.546ON577164677.9
TBLA0G008403.175ON1561107679.1
TDEL0E013304.238ON1657138679.2
KAFR0G032004.238ON1869118679.6
SAKL0G11110g5.267ON1871211679.9
NOTE: 7 genes in the same pillar as AGR274C were not hit in these BLAST results
LIST: Skud_15.344 Smik_15.362 YOR177C Suva_8.233 KLTH0G15334g Kwal_56.23256 TPHA0K01150

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AGR274C
         (375 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AGR274C Chr7 complement(1252837..1253964) [1128 bp, 375 aa] {ON}...   727   0.0  
Ecym_3119 Chr3 (221707..222843) [1137 bp, 378 aa] {ON} similar t...   413   e-143
SAKL0A08206g Chr1 (729465..731402) [1938 bp, 645 aa] {ON} conser...    53   7e-07
NCAS0A02450 Chr1 complement(463760..469546) [5787 bp, 1928 aa] {...    40   0.009
ZYRO0E04708g Chr5 complement(354494..356329) [1836 bp, 611 aa] {...    39   0.019
TBLA0B09970 Chr2 complement(2384399..2387596) [3198 bp, 1065 aa]...    38   0.056
ZYRO0A11132g Chr1 complement(890189..892285) [2097 bp, 698 aa] {...    35   0.27 
KNAG0A03170 Chr1 (394019..395434) [1416 bp, 471 aa] {ON} Anc_8.6...    35   0.28 
TBLA0I02890 Chr9 (683688..686984) [3297 bp, 1098 aa] {ON} Anc_4....    33   1.2  
ZYRO0B01936g Chr2 complement(156676..159150) [2475 bp, 824 aa] {...    33   1.4  
ADL005C Chr4 complement(698224..699201) [978 bp, 325 aa] {ON} Sy...    32   2.1  
Ecym_5514 Chr5 (1043659..1046223) [2565 bp, 854 aa] {ON} similar...    32   2.2  
Suva_15.73 Chr15 (116131..116997) [867 bp, 288 aa] {ON} YOL093W ...    32   2.4  
TDEL0G04560 Chr7 (831920..833368) [1449 bp, 482 aa] {ON} Anc_6.6...    32   2.4  
Kwal_23.5534 s23 (1206224..1211947) [5724 bp, 1907 aa] {ON} YHR0...    32   2.4  
ZYRO0F08976g Chr6 (725016..730517) [5502 bp, 1833 aa] {ON} highl...    32   2.7  
Kpol_1023.30 s1023 complement(63402..67229) [3828 bp, 1275 aa] {...    32   2.8  
Kwal_23.3442 s23 (291852..296042) [4191 bp, 1396 aa] {ON} YDL112...    32   3.5  
NCAS0C03680 Chr3 complement(737681..741307) [3627 bp, 1208 aa] {...    32   3.8  
Smik_14.107 Chr14 complement(202094..203842) [1749 bp, 582 aa] {...    31   4.3  
CAGL0I02838g Chr9 complement(248704..250671) [1968 bp, 655 aa] {...    32   4.4  
KLLA0E05281g Chr5 (467253..472520) [5268 bp, 1755 aa] {ON} simil...    32   4.9  
Smik_16.292 Chr16 complement(537812..541357) [3546 bp, 1181 aa] ...    31   5.6  
YGL228W Chr7 (67598..69331) [1734 bp, 577 aa] {ON}  SHE10Putativ...    30   7.9  
TBLA0G00840 Chr7 (200837..205522) [4686 bp, 1561 aa] {ON} Anc_3....    30   9.1  
TDEL0E01330 Chr5 (260599..265572) [4974 bp, 1657 aa] {ON} Anc_4....    30   9.2  
KAFR0G03200 Chr7 complement(663726..669335) [5610 bp, 1869 aa] {...    30   9.6  
SAKL0G11110g Chr7 complement(942330..947945) [5616 bp, 1871 aa] ...    30   9.9  

>AGR274C Chr7 complement(1252837..1253964) [1128 bp, 375 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR177C
           (MPC54)
          Length = 375

 Score =  727 bits (1877), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 358/375 (95%), Positives = 358/375 (95%)

Query: 1   MCPSNAQANEDPSLCLIDLTFMKQHKGLPDDPSFVELAINGILNQDSIVAQRKVKFSELP 60
           MCPSNAQANEDPSLCLIDLTFMKQHKGLPDDPSFVELAINGILNQDSIVAQRKVKFSELP
Sbjct: 1   MCPSNAQANEDPSLCLIDLTFMKQHKGLPDDPSFVELAINGILNQDSIVAQRKVKFSELP 60

Query: 61  LGPQPSARSSMTTPRKSILVSRQXXXXXXXXXXXXXXXXXLLLHRCFNFCNLDTDGVAER 120
           LGPQPSARSSMTTPRKSILVSRQ                 LLLHRCFNFCNLDTDGVAER
Sbjct: 61  LGPQPSARSSMTTPRKSILVSRQTTETENSDNEEDPDEVELLLHRCFNFCNLDTDGVAER 120

Query: 121 PLVENLELISYGIISTFRFHECCYKYAHELEASSTVKEEVPQRLLPVDKTATLDTDMQDE 180
           PLVENLELISYGIISTFRFHECCYKYAHELEASSTVKEEVPQRLLPVDKTATLDTDMQDE
Sbjct: 121 PLVENLELISYGIISTFRFHECCYKYAHELEASSTVKEEVPQRLLPVDKTATLDTDMQDE 180

Query: 181 LVLWKIEAEELGIKNNVLMTENGKLIAELTALRQTIRTLNDEKEKLRAQVHDRDIQLLKL 240
           LVLWKIEAEELGIKNNVLMTENGKLIAELTALRQTIRTLNDEKEKLRAQVHDRDIQLLKL
Sbjct: 181 LVLWKIEAEELGIKNNVLMTENGKLIAELTALRQTIRTLNDEKEKLRAQVHDRDIQLLKL 240

Query: 241 KDQSKDIDTETQVKLRRLQDLAGRLEKVISQRASTISNLREDRQALRRELAKSTELTINL 300
           KDQSKDIDTETQVKLRRLQDLAGRLEKVISQRASTISNLREDRQALRRELAKSTELTINL
Sbjct: 241 KDQSKDIDTETQVKLRRLQDLAGRLEKVISQRASTISNLREDRQALRRELAKSTELTINL 300

Query: 301 KGDNRRLKAHVDSLLHLFNDCENEGPSSSVTLPHQLQSLKLTSKHEKDESQAFMQRPLHP 360
           KGDNRRLKAHVDSLLHLFNDCENEGPSSSVTLPHQLQSLKLTSKHEKDESQAFMQRPLHP
Sbjct: 301 KGDNRRLKAHVDSLLHLFNDCENEGPSSSVTLPHQLQSLKLTSKHEKDESQAFMQRPLHP 360

Query: 361 QNNRKHTGLKLRAHT 375
           QNNRKHTGLKLRAHT
Sbjct: 361 QNNRKHTGLKLRAHT 375

>Ecym_3119 Chr3 (221707..222843) [1137 bp, 378 aa] {ON} similar to
           Ashbya gossypii AGR274C
          Length = 378

 Score =  413 bits (1061), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 210/350 (60%), Positives = 262/350 (74%), Gaps = 6/350 (1%)

Query: 1   MCPSNAQANEDPSLCLIDLTFMKQHKGLPDDPSFVELAINGILNQDSIVAQRKVKFSELP 60
           M  +N  A+ED   CL+DLTFMK +K + +DPSFVE+A+NGIL+QD++VAQRK+KF++ P
Sbjct: 1   MSSNNVHASED-GPCLLDLTFMK-NKSVSEDPSFVEIAVNGILDQDTVVAQRKIKFNDCP 58

Query: 61  LGPQPSARSSMTTPRKSILVSRQXXXXXXXXXXXXXXXXXLLLHRCFNFCNLDTDGVAER 120
           +GP+ +       P+KSILV+R+                 LLL RCFNFCNLDTDG+ +R
Sbjct: 59  MGPKLTKNEVPAIPKKSILVNRENTTDTPTEQEIPNEEVLLLLRRCFNFCNLDTDGIEKR 118

Query: 121 PLVENLELISYGIISTFRFHECCYKYAHELEASSTVKEEVPQRLLP-VDKTATLDTDMQD 179
            + ENLE ISYGIISTFRFHECCYKYAHELE +S VK E P  ++P V+  +  D ++Q 
Sbjct: 119 SIEENLESISYGIISTFRFHECCYKYAHELETTSKVKAECP--IVPLVEGKSPADAELQH 176

Query: 180 ELVLWKIEAEELGIKNNVLMTENGKLIAELTALRQTIRTLNDEKEKLRAQVHDRDIQLLK 239
           E V+WKIEAE LGIKNNVLM ENGKLI ELT+LRQTIR L DEKE L+AQV+++DIQL K
Sbjct: 177 EAVVWKIEAEALGIKNNVLMVENGKLINELTSLRQTIRNLRDEKENLKAQVYEKDIQLFK 236

Query: 240 LKDQSKDIDTETQVKLRRLQDLAGRLEKVISQRASTISNLREDRQALRRELAKSTELTIN 299
           LKD+ KD + ETQ K+++LQD  GRLEKVI+QR STISNL++DR  LR++LAKSTE  IN
Sbjct: 237 LKDKIKDNNIETQTKIKQLQDTTGRLEKVITQRTSTISNLKQDRHTLRKQLAKSTENNIN 296

Query: 300 LKGDNRRLKAHVDSLLHLFNDCENEGPSSSVT-LPHQLQSLKLTSKHEKD 348
           LKG N RLK HVD+LL+LFNDCEN    ++ + LP Q + LKLTS  E D
Sbjct: 297 LKGANNRLKQHVDNLLYLFNDCENPASENNPSQLPQQFEHLKLTSDIESD 346

>SAKL0A08206g Chr1 (729465..731402) [1938 bp, 645 aa] {ON} conserved
           hypothetical protein
          Length = 645

 Score = 53.1 bits (126), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 20/44 (45%), Positives = 30/44 (68%)

Query: 103 LHRCFNFCNLDTDGVAERPLVENLELISYGIISTFRFHECCYKY 146
           + RCFN CN+  + + E  LV +L+ +S+GI+S F+  E CYKY
Sbjct: 219 ITRCFNLCNVPLEDLDEDDLVMSLQRLSFGIVSAFKTQEMCYKY 262

>NCAS0A02450 Chr1 complement(463760..469546) [5787 bp, 1928 aa] {ON}
            Anc_4.238 YDL058W
          Length = 1928

 Score = 40.0 bits (92), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 50/176 (28%), Positives = 83/176 (47%), Gaps = 29/176 (16%)

Query: 195  NNV-LMTENGKLIAELTALRQTIRTLNDEKEKLRAQVHDRDIQL----LKLKDQSKDIDT 249
            NNV L TEN  LI++++ L  TI  L    +   AQ  D   +L    + L +Q  +I+ 
Sbjct: 979  NNVTLTTENKGLISKISNLELTIDNLKKSNDAKSAQFSDDKNELEESIMHLNEQLNEIEA 1038

Query: 250  ETQVKLRRLQDLAGRLEKVISQ-------------RASTIS-NLREDRQAL------RRE 289
            E ++  R++ DL G+L  V S+             +  T++ +L   +Q L      +RE
Sbjct: 1039 EKEINERKVNDLEGQLNSVKSELTKNMDEITLLKTKLDTVNEDLTTSKQKLIESENEKRE 1098

Query: 290  LAKSTELTINLKGD-NRRLKAHV---DSLLHLFNDCENEGPSSSVTLPHQLQSLKL 341
            L+K  E + N   D N +L+      D+LL  ++  E  G ++  +   Q+  LKL
Sbjct: 1099 LSKLLENSKNAMIDSNNKLEESTLKYDTLLKKYDSLEKNGQANEKSFHDQVDELKL 1154

>ZYRO0E04708g Chr5 complement(354494..356329) [1836 bp, 611 aa] {ON}
           conserved hypothetical protein
          Length = 611

 Score = 38.9 bits (89), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 34/131 (25%), Positives = 57/131 (43%), Gaps = 13/131 (9%)

Query: 102 LLHRCFNFCNLDTDGVAERPLVENLELISYGIISTFRFHECCYKYAHELEASSTVKEEVP 161
           +  RC+  CNL      E    ++L+ +  GI  +F+  + CYKY    E +  + +E+ 
Sbjct: 143 VFRRCYTLCNLPMSQFDENNPFKSLKKLCEGIKKSFKAKDECYKYIR-YEENRRLSQEI- 200

Query: 162 QRLLPVDKTATLDTDMQDELVLWKIEAEELGIKNNVLMTENGKLIAELTALRQTIRTLND 221
            R L  D    L  D  + LVL +I         N L   N +   E+  L   + + N 
Sbjct: 201 -RKLK-DTIQELKDDRHNSLVLLQI---------NKLQKHNNEYRNEIKDLTAQVTSTNY 249

Query: 222 EKEKLRAQVHD 232
           E  +LR+ + +
Sbjct: 250 ENSELRSNISE 260

>TBLA0B09970 Chr2 complement(2384399..2387596) [3198 bp, 1065 aa]
           {ON} Anc_4.46 YLR309C
          Length = 1065

 Score = 37.7 bits (86), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 34/119 (28%), Positives = 62/119 (52%), Gaps = 4/119 (3%)

Query: 175 TDMQDELVLWKIEAEELGIKNNVLMTENGKLIAELTALRQTIRTLNDEKEKLRAQVHDRD 234
           +++ DEL L +   +E   K + L  E  K++A+L  L+  +++ N+E E LR  +    
Sbjct: 491 SELDDELQLLRSTNKEQEDKIDDLEAEKNKVLADLGELKAALKSKNEEIENLRDMLRTVG 550

Query: 235 IQLLKLKDQSKDIDT----ETQVKLRRLQDLAGRLEKVISQRASTISNLREDRQALRRE 289
            +L++ KDQ KD  +    E +   R L DL  +   VI    + I++L++D   ++ E
Sbjct: 551 NELVEAKDQIKDAGSLNAKEAESLKRELDDLREKNSAVIQTYETKIADLKKDFDNMKNE 609

>ZYRO0A11132g Chr1 complement(890189..892285) [2097 bp, 698 aa] {ON}
           some similarities with uniprot|Q22X91 Tetrahymena
           thermophila SB210 TTHERM_00561660 Viral A-type inclusion
           protein repeat containing protein
          Length = 698

 Score = 35.4 bits (80), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 11/46 (23%), Positives = 25/46 (54%)

Query: 102 LLHRCFNFCNLDTDGVAERPLVENLELISYGIISTFRFHECCYKYA 147
           ++ +C+N C +  D +    + ++L  + +GI + F+  E C+ Y 
Sbjct: 155 VMIKCYNMCGISVDYLDIDKMFDSLGKLMFGISNEFKMKELCFNYV 200

>KNAG0A03170 Chr1 (394019..395434) [1416 bp, 471 aa] {ON} Anc_8.636
           YOR216C
          Length = 471

 Score = 35.0 bits (79), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 68/128 (53%), Gaps = 9/128 (7%)

Query: 183 LWKIEAEELGIKNNVLMT--ENGKLIAELTALRQTIRTLNDEKEKLRAQV--HDRDIQL- 237
           L + E++ L +KN V  T  EN +L   +T L +   ++  E E L+ QV  ++R I+  
Sbjct: 150 LQEYESQNLRLKNKVSSTSKENEELRTTVTTLNKEYDSMESEYENLQKQVTSYERQIEKC 209

Query: 238 -LKLKDQSKDIDTETQVKLRRLQDLAGRLEKV---ISQRASTISNLREDRQALRRELAKS 293
            +KL+  ++    E    ++ +++L  +++K+   +     +IS+L+ +RQ L  +LA S
Sbjct: 210 EIKLEHATESHSDELNAYIKEIENLTLKIQKLTVALENSHQSISDLKSERQELAHDLATS 269

Query: 294 TELTINLK 301
                NLK
Sbjct: 270 ESTLSNLK 277

>TBLA0I02890 Chr9 (683688..686984) [3297 bp, 1098 aa] {ON} Anc_4.237
           YLR383W
          Length = 1098

 Score = 33.1 bits (74), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 41/152 (26%), Positives = 69/152 (45%), Gaps = 20/152 (13%)

Query: 159 EVPQRLLPVDKTATLDTD------MQDELVLWKIEAEELGIKNNVLMTENGKLIAELTAL 212
           E+ + L  V  T  LD+       +Q+ +V ++   E L    N L+ +   L       
Sbjct: 737 ELKKDLNKVVDTGVLDSAKDEYQRIQNAIVSYETALEGLKENMNTLLEKARPLNDIRDTA 796

Query: 213 RQTIRTLNDEKEKLRAQVHDRDIQLLKLKDQ---SKDIDTETQVKLRRLQ----DLAGRL 265
           ++T R +  E E L+ ++ DRDI++ + KD      D     Q K+ R+Q    DL   +
Sbjct: 797 QKTYRNIKKEFEALKQELEDRDIRIRRYKDDITIQNDEKARIQEKIDRVQSNINDLMSGI 856

Query: 266 EKVI-------SQRASTISNLREDRQALRREL 290
           E  I       S+  ST  NL +++  +R+EL
Sbjct: 857 ETQIENASEFCSEEESTSENLPDNQDDIRKEL 888

>ZYRO0B01936g Chr2 complement(156676..159150) [2475 bp, 824 aa] {ON}
           weakly similar to uniprot|P25386 Saccharomyces
           cerevisiae YDL058W USO1 involved intracellular protein
           transport, coiled-coil protein necessary for protein
           transport from ER to Golgi; Integrin analogue gene
          Length = 824

 Score = 33.1 bits (74), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 30/115 (26%), Positives = 54/115 (46%), Gaps = 20/115 (17%)

Query: 102 LLHRCFNF-----CNLDTDGVAERPLVENLELISYGIISTFRFHECCYKYAHELEASSTV 156
           LL R F       C +  D      L+  L+ ++ G++++F+  E CYKY    ++    
Sbjct: 156 LLQRIFTLHGIPPCEIKED------LLGTLQRLARGVVASFKQREQCYKYVGRKQSI--- 206

Query: 157 KEEVPQRLLPVDK----TATLDTDMQDELVLWKIEAEELGIKNNVLMTENGKLIA 207
            EE+ +     DK     A L+  +  E V W++  +E+ I+N+ L  +  +LI 
Sbjct: 207 -EELDELEYVNDKLKCEVAGLNKKLSQEKVRWEV-VDEVFIENDSLKAKVEELIT 259

>ADL005C Chr4 complement(698224..699201) [978 bp, 325 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YEL005C
           (VAB2)
          Length = 325

 Score = 32.0 bits (71), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 40/171 (23%), Positives = 73/171 (42%), Gaps = 14/171 (8%)

Query: 150 LEASSTVKEEVPQRLLPVDKTATLDTDMQDELVLWKIEAEELGIKNNVLMTENGKLIAEL 209
           +  S   KE     +LP  K      D++ + +   +  E   +K +V+   N +++AE+
Sbjct: 23  VRGSDAYKELCSLGMLPSSK------DLRQDSIFRAVANEVKQVKQDVVEI-NSRVVAEV 75

Query: 210 TALRQTIRTLNDEKEKLRAQVHDRDIQLLKLKDQSKDIDTETQVKLRRLQDLAGRLEKVI 269
              ++    LN   +KL+A  +  D    KL    +   T TQ ++R+L D  G  E  I
Sbjct: 76  QVEKELAEHLN---QKLKASEYKVDHLAKKLVRLRQKHSTNTQRQVRKLDDCIGDFESNI 132

Query: 270 SQRASTISNLREDRQALRRELAKSTELTINLKGDNRRLKAHVDSLLHLFND 320
            +   T++ + +   ++   L +   L     GD++    H   L  LF D
Sbjct: 133 RELHGTVAEMVDRLGSVDMGLPEKERLI----GDHQLNARHYPLLYELFRD 179

>Ecym_5514 Chr5 (1043659..1046223) [2565 bp, 854 aa] {ON} similar to
           Ashbya gossypii AER241W
          Length = 854

 Score = 32.3 bits (72), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 25/88 (28%), Positives = 48/88 (54%), Gaps = 8/88 (9%)

Query: 236 QLLKLKDQSKDIDTETQVKLRR----LQDLAGRLEKVISQRASTISNLREDRQ----ALR 287
           +L K+KD  +  + E  VKL++    +Q L    E+++S++   I +LR + Q    +L 
Sbjct: 388 KLSKMKDSLEQNNREFDVKLKKAEKQIQTLERERERILSEQQDAIHDLRLEHQKRVQSLH 447

Query: 288 RELAKSTELTINLKGDNRRLKAHVDSLL 315
           +E++   E+   L+GDN+  K   + L+
Sbjct: 448 KEVSNLREMNSKLEGDNQSYKKRFEQLV 475

>Suva_15.73 Chr15 (116131..116997) [867 bp, 288 aa] {ON} YOL093W
           (REAL)
          Length = 288

 Score = 32.0 bits (71), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 30/66 (45%), Gaps = 9/66 (13%)

Query: 109 FCNLDTDGVAERPLVENLELISYGIISTFRFHECCYKYAHELEASSTVKEEVPQRLLPVD 168
           +   DTD   ER L   +  I  GI+   R+ E C K A +L         +P R LP+D
Sbjct: 185 YLTADTDEKIER-LEPGMRYIVGGIVDKNRYKELCLKKAQKL--------GIPTRRLPID 235

Query: 169 KTATLD 174
           +   L+
Sbjct: 236 EYINLE 241

>TDEL0G04560 Chr7 (831920..833368) [1449 bp, 482 aa] {ON} Anc_6.69
           YOR177C
          Length = 482

 Score = 32.0 bits (71), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 28/44 (63%), Gaps = 2/44 (4%)

Query: 103 LHRCFNFCNLD-TDGVAERPLVENLELISYGIISTFRFHECCYK 145
           + R +N C+L  T    + PL+ +LEL++ G+ + F+ HE C+K
Sbjct: 162 IARIYNLCDLPFTLFRKDDPLL-SLELLARGVCNAFKSHEICWK 204

>Kwal_23.5534 s23 (1206224..1211947) [5724 bp, 1907 aa] {ON} YHR023W
            (MYO1) - Class II Myosin [contig 11] FULL
          Length = 1907

 Score = 32.3 bits (72), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 47/176 (26%), Positives = 78/176 (44%), Gaps = 28/176 (15%)

Query: 144  YKYAHELEASSTVKEEVPQRLLPVDKTATLDTDMQ--------DELVLWKIEA------E 189
            Y+  +E E+ S + E   +R   +DK   L+  +Q        +E ++ +++A      E
Sbjct: 1674 YRRRYE-ESRSGLGEVSKERESILDKVHALEKSLQLEREQSDRNEALVEQLQAAASKAKE 1732

Query: 190  ELGI---KNNVLMTENGKLIAELTALRQTIRTLND------EKEKLRAQVHDRDIQLLKL 240
            +L I   KN VL  EN         LR++I TL        EKE   ++V     +L  L
Sbjct: 1733 QLAIEKDKNIVLHEENQSFGKSNNQLRESISTLESKLANTTEKEAWLSKVQ----ELETL 1788

Query: 241  KDQSKDIDTETQVKLRRLQDLAGRLEKVISQRASTISNLREDRQALRRELAKSTEL 296
              Q  D   E   + + L+     L+ +  ++A TI+   EDR+   +EL +  EL
Sbjct: 1789 AAQEADAKFEEMKRAKVLERTVAELKTINGKQADTIAAANEDREEYAKELTEKAEL 1844

>ZYRO0F08976g Chr6 (725016..730517) [5502 bp, 1833 aa] {ON} highly
          similar to uniprot|P32528 Saccharomyces cerevisiae
          YBR208C DUR1 2 Urea amidolyase contains both urea
          carboxylase and allophanate hydrolase activities
          degrades urea to CO2 and NH3 expression sensitive to
          nitrogen catabolite repression and induced by
          allophanate an intermediate in allantoin degradation
          Length = 1833

 Score = 32.3 bits (72), Expect = 2.7,   Method: Composition-based stats.
 Identities = 18/49 (36%), Positives = 23/49 (46%)

Query: 19 LTFMKQHKGLPDDPSFVELAINGILNQDSIVAQRKVKFSELPLGPQPSA 67
          L  +K  K  P+DP+++ L     L Q   V Q K K   LPL   P A
Sbjct: 34 LNLLKSQKCAPEDPAWISLVSESNLQQQWQVLQSKSKKESLPLYGVPIA 82

>Kpol_1023.30 s1023 complement(63402..67229) [3828 bp, 1275 aa] {ON}
            complement(63402..67229) [3828 nt, 1276 aa]
          Length = 1275

 Score = 32.0 bits (71), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 35/69 (50%), Gaps = 11/69 (15%)

Query: 203  GKLIAELTALRQTIRTL---NDEKEKLRAQVHDRDIQLLKLKDQSKDIDTETQVKLRRLQ 259
            GKLI E+  LR+ +  +   N  KE +   V+D D++         DI  ETQ+KL +  
Sbjct: 1042 GKLINEIMKLRKQLMYIIKSNISKEGIAVAVNDEDLK--------SDIPNETQIKLLKQM 1093

Query: 260  DLAGRLEKV 268
              AG ++ V
Sbjct: 1094 VAAGFIDNV 1102

>Kwal_23.3442 s23 (291852..296042) [4191 bp, 1396 aa] {ON} YDL112W
           (TRM3) - tRNA (Gm18) ribose methylase [contig 252] FULL
          Length = 1396

 Score = 32.0 bits (71), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 25/100 (25%), Positives = 48/100 (48%), Gaps = 4/100 (4%)

Query: 199 MTENGKLIAELTALRQTIRTLNDEKEKLRAQVHDRDIQLLKLKDQSKDIDTETQVKLRRL 258
           + ENGK  AEL+++ +TIR   +  +++ A V  R + LL   +   D + E     + L
Sbjct: 23  LVENGK-DAELSSVLKTIRFEQEALDEVAAAVTTRVVSLL---NSFPDSEVEESKTFQEL 78

Query: 259 QDLAGRLEKVISQRASTISNLREDRQALRRELAKSTELTI 298
            +L  +L K +      I N  ++R  +  ++ ++  L  
Sbjct: 79  AELTSKLTKSVGALQDWIVNALDNRNEVTTDINRAVALNF 118

>NCAS0C03680 Chr3 complement(737681..741307) [3627 bp, 1208 aa] {ON}
           Anc_3.175
          Length = 1208

 Score = 31.6 bits (70), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 34/138 (24%), Positives = 69/138 (50%), Gaps = 4/138 (2%)

Query: 190 ELGIKNNVLMTENGKLIAELT-ALRQTIRTLNDEKEKLRAQVHDRDIQLLKLKDQSKDID 248
           EL     +L  ++G + +E+   + ++I T++    KL      RD +LL++  + +D++
Sbjct: 548 ELSSLTELLSDDSGHVSSEMWQTINKSISTISSCFTKLNYFTSARDKRLLQMLTKQRDVN 607

Query: 249 TETQVKLRRLQDLAGRLEKVISQRASTISNLREDRQALRRELAKSTELTINLKGDNRRLK 308
               V ++ ++DL   L     + AS     +  ++ L+REL ++  LT + K + +   
Sbjct: 608 ---NVWIQSVKDLEMELIDKDERLASLDKERKHLKKMLQRELHEAGTLTPSNKVNTKSAD 664

Query: 309 AHVDSLLHLFNDCENEGP 326
              +SLL L N+  +E P
Sbjct: 665 VEDESLLELTNNGGDESP 682

>Smik_14.107 Chr14 complement(202094..203842) [1749 bp, 582 aa] {ON}
           YNL225C (REAL)
          Length = 582

 Score = 31.2 bits (69), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 24/88 (27%), Positives = 42/88 (47%), Gaps = 5/88 (5%)

Query: 202 NGKLIAELTALRQTIRTLNDEKEKLRAQVHDRDIQLLKLKDQSKDIDTETQVKLRRLQDL 261
           N ++ A+L +L +  R+    KE   A + D+DI L   ++++  + TE +    RL+ L
Sbjct: 387 NEEIKAKLESLNERFRSWEKSKETYEALLKDKDILLADFENKTSTMSTELETLRSRLEIL 446

Query: 262 AGRLEKVISQRASTISNLREDRQALRRE 289
            G     I     TI N+ + R  +  E
Sbjct: 447 EGNTSDKI-----TIKNILQSRPDISEE 469

>CAGL0I02838g Chr9 complement(248704..250671) [1968 bp, 655 aa] {ON}
           similar to uniprot|P41696 Saccharomyces cerevisiae
           YOR113w AZF1 asparagine-rich zinc finger protein
          Length = 655

 Score = 31.6 bits (70), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 29/52 (55%), Gaps = 2/52 (3%)

Query: 156 VKEEVPQRLLP-VDKTATLDTDMQDELVLWKIEAEELGIKNNVLMTENGKLI 206
           V E +P  L P  ++   L T   D+LVL  I+A + G+   V  TE+GKL+
Sbjct: 534 VNENIPDELPPETNQKEKLGTTNVDQLVLM-IQARKKGVTEKVPTTEDGKLV 584

>KLLA0E05281g Chr5 (467253..472520) [5268 bp, 1755 aa] {ON} similar to
            uniprot|P25386 Saccharomyces cerevisiae YDL058W USO1
            involved intracellular protein transport coiled-coil
            protein necessary for protein transport from ER to Golgi
            Integrin analogue gene
          Length = 1755

 Score = 31.6 bits (70), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 28/99 (28%), Positives = 48/99 (48%), Gaps = 5/99 (5%)

Query: 136  TFRFHECCYKYAHELEASSTVKEEVPQRLLPVDK-TATLDTDMQDELVLWKIEAEELGIK 194
            T   H    K A  ++ ++++ EE+ +  L V+  T  L T  Q    LW  E  EL  +
Sbjct: 1615 TLLVHSAQEKNAQMIQENTSLAEEIKELKLQVNTWTEKLVTSEQ----LWSSEKTELIKQ 1670

Query: 195  NNVLMTENGKLIAELTALRQTIRTLNDEKEKLRAQVHDR 233
             +++ TE+ K   E + L   +  + +E  KL+ +V DR
Sbjct: 1671 MDIIKTESAKQAQENSQLNVELSAIKEENMKLKNRVDDR 1709

>Smik_16.292 Chr16 complement(537812..541357) [3546 bp, 1181 aa]
           {ON} YPR049C (REAL)
          Length = 1181

 Score = 31.2 bits (69), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 35/128 (27%), Positives = 54/128 (42%), Gaps = 15/128 (11%)

Query: 207 AELTALRQTIRTLNDEKEKLRAQVHDRDIQLLKL----KDQSKDIDTETQVKLRRLQDLA 262
            E TA R+T+  LN E  +L  +      ++  L    K Q  DI  +   KL R++ L 
Sbjct: 743 VEKTAYRETLTNLNQELARLTNEEESHRTEIFTLNASFKKQLNDIIVQDNEKLVRIEKLK 802

Query: 263 GRLEKVISQRASTISNLREDRQALRRELAKSTELTINLKGDNRRLKAHVDSLLHLFNDCE 322
              + + + R     NL +  +   +E+A        LK +  RL   V +L       E
Sbjct: 803 SDYDDIYNSRERLQENLDDSNKKCEKEIAL-------LKAEIERLNEQVATL----GKNE 851

Query: 323 NEGPSSSV 330
           NE  SSS+
Sbjct: 852 NEIKSSSM 859

>YGL228W Chr7 (67598..69331) [1734 bp, 577 aa] {ON}  SHE10Putative
           glycosylphosphatidylinositol (GPI)-anchored protein of
           unknown function; overexpression causes growth arrest
          Length = 577

 Score = 30.4 bits (67), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 44/164 (26%), Positives = 78/164 (47%), Gaps = 27/164 (16%)

Query: 146 YAHELEASSTVKEEVPQRLLPVDKTATL--DTDMQDELVLWKIEAEELGIKNNVLMTENG 203
           +AH+ EAS+ V+       + V++ A L  D DM  E +L K +      + +V    NG
Sbjct: 251 HAHDDEASTDVEGSTD---VNVNEQALLQEDFDMWSETILQKTQDVIQLFEKDVSKYING 307

Query: 204 KLIAELTALRQTIRTLNDEKEKLRAQVH--DRDIQLLKLKDQSKDIDTETQVKLRRLQDL 261
           KL+ E    +   ++L+D+ +K  +++     DI+ +      + ID+ET  K+    D 
Sbjct: 308 KLVEEANHFKAKFQSLDDKSKKFFSKISLAINDIECV------EGIDSETGKKI--FFDK 359

Query: 262 AGRLEKVISQRAS----------TISNLREDRQALRRELAKSTE 295
           +G  E  ISQ  +          T S L E   A+ ++L++ T+
Sbjct: 360 SGSTE--ISQYITRELVREYFNETRSTLDELTNAMEKDLSEITD 401

>TBLA0G00840 Chr7 (200837..205522) [4686 bp, 1561 aa] {ON} Anc_3.175
           YAR042W
          Length = 1561

 Score = 30.4 bits (67), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 23/107 (21%), Positives = 57/107 (53%), Gaps = 7/107 (6%)

Query: 207 AELTALRQTIRTLNDEKEKLRAQVHDRDIQLLKLKDQSKDIDTETQVKLRRLQDLAGRLE 266
           A  + ++ +I+T+    E+L      RD +L+ +  + KD++    V ++ ++DL    E
Sbjct: 715 ASWSTIKNSIKTITQCFEQLNTLSASRDKKLVAMLTKQKDVN---NVWIQSVKDL----E 767

Query: 267 KVISQRASTISNLREDRQALRRELAKSTELTINLKGDNRRLKAHVDS 313
           + + +++  +  + ++R+ L++ + K  + T + +   +RL  H DS
Sbjct: 768 RELGKKSQRLEAMDKERRTLKKVVNKRIQDTESPQNVAKRLSKHDDS 814

>TDEL0E01330 Chr5 (260599..265572) [4974 bp, 1657 aa] {ON} Anc_4.238
           YDL058W
          Length = 1657

 Score = 30.4 bits (67), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 41/138 (29%), Positives = 65/138 (47%), Gaps = 14/138 (10%)

Query: 170 TATLDTDMQDELVLWKIEAEELGIKNNVLMTENGKLIAELTALRQTIRTLNDEKEKLRAQ 229
           T+ LD+ + +E   +  E + LG+K + L+  N KL  ++    QTI  LN E+EK    
Sbjct: 728 TSKLDS-LTNEYEKYSEENKSLGLKISDLLESNKKLHKDVNQASQTIEELNVEREK---- 782

Query: 230 VHDRDIQLLKLKDQSKDIDTETQ-VKLRRLQDLAGRLEKVISQRASTISNLREDRQALRR 288
                  LL  +D+ K+ DTET  +KL +  +    LEK +    +      +    + R
Sbjct: 783 -------LLTSRDEYKN-DTETNSLKLNKSMERISVLEKELKDIRAEKKKAEDGINKMSR 834

Query: 289 ELAKSTELTINLKGDNRR 306
           EL   T+   NLK   +R
Sbjct: 835 ELFSLTKENQNLKESQKR 852

>KAFR0G03200 Chr7 complement(663726..669335) [5610 bp, 1869 aa] {ON}
           Anc_4.238 YDL058W
          Length = 1869

 Score = 30.4 bits (67), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 34/118 (28%), Positives = 61/118 (51%), Gaps = 9/118 (7%)

Query: 198 LMTENGKLIAELTALRQTIRTLNDEKEKLRAQVHDRDIQLLKL-KDQSKDIDTETQVKLR 256
           +  EN KL   L    + +++L++E +KLR         LL+  KDQS    TE + K +
Sbjct: 879 MKNENKKLDNTLAKKEKELQSLDEELQKLRKMQS-----LLETDKDQSARELTEWKSKFQ 933

Query: 257 RLQDLAGRLEKVISQRASTISNLREDRQALRRELAKSTELTINLKGDNRRLKAHVDSL 314
              +L  RL   +   A++  N++ +R  L++ L    E+T N K D + L++ +++L
Sbjct: 934 GHDELVTRLTDKLKSLANSFKNIQSERDTLQKHLM---EITDNNKLDVQNLESQIEAL 988

>SAKL0G11110g Chr7 complement(942330..947945) [5616 bp, 1871 aa] {ON}
            similar to uniprot|P08964 Saccharomyces cerevisiae
            YHR023W MYO1 Type II myosin heavy chain required for
            wild- type cytokinesis and cell separation localizes to
            the actomyosin ring binds to myosin light chains Mlc1p
            and Mlc2p through its IQ1 and IQ2 motifs respectively
          Length = 1871

 Score = 30.4 bits (67), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 54/211 (25%), Positives = 98/211 (46%), Gaps = 32/211 (15%)

Query: 138  RFHECCYKYAHELEASSTVKEEVPQRLLPVD---KTATLDTDMQDELVLWKIE-----AE 189
            R+     K+   L+AS  V+ E+ +++  +    +T   DTD + E +L + E      E
Sbjct: 1528 RYTAEIQKFKSSLDASMRVETELKKKISTLTYSLETLKSDTDAKIEELLRQNEHYENLVE 1587

Query: 190  ELGIKNNV-------LMTENGKLIAELTALRQTIRTLNDEKEKLRAQVHDRDIQLLKLKD 242
            +LG + ++       L T+   LI +  +L  ++ TL   K++L A+   RD     LK 
Sbjct: 1588 QLGSQKDISEATQKDLETKLKTLINKTNSLSDSVDTLLKLKQELEAE---RDY----LKS 1640

Query: 243  QSKDIDTETQVKLRRLQDLAGR---------LEKVISQR-ASTISNLREDRQALRRELAK 292
            + +D +T+ +  LR  +++A           L++  +QR  S +  L+ D + L+ +L  
Sbjct: 1641 KLEDSNTDFENSLRNREEIANNVHLLKESLDLQQQQNQRNESLVQQLQNDARVLKAQLEN 1700

Query: 293  STELTINLKGDNRRLKAHVDSLLHLFNDCEN 323
              E  I L  +N+ L    + L    ND EN
Sbjct: 1701 EKERGIVLHEENQSLGKSNNQLRERINDLEN 1731

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.132    0.369 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 36,801,011
Number of extensions: 1518090
Number of successful extensions: 7895
Number of sequences better than 10.0: 491
Number of HSP's gapped: 8075
Number of HSP's successfully gapped: 740
Length of query: 375
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 264
Effective length of database: 40,753,473
Effective search space: 10758916872
Effective search space used: 10758916872
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 66 (30.0 bits)