Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
AGR270W6.65ON29429414470.0
Ecym_31246.65ON2742627359e-97
NCAS0F003306.65ON2812366231e-79
CAGL0L04620g6.65ON2642586167e-79
ZYRO0D14190g6.65ON2952456134e-78
SAKL0A08426g6.65ON2991776135e-78
Kpol_1042.116.65ON2922896041e-76
Smik_15.3526.65ON2881755995e-76
KAFR0G025006.65ON2892465926e-75
Skud_15.3366.65ON2861845848e-74
KLTH0G15444g6.65ON2632275802e-73
Suva_8.2276.65ON2871755794e-73
TBLA0G005506.65ON3182245791e-72
YOR174W (MED4)6.65ON2841755752e-72
NDAI0J013206.65ON3343045792e-72
Kwal_56.232426.65ON2562175713e-72
KLLA0F20185g6.65ON2852625534e-69
TPHA0F025906.65ON3062925538e-69
KNAG0M010206.65ON2792485473e-68
TDEL0G040606.65ON2201634606e-56
YGL086W (MAD1)6.188ON749136750.60
Kpol_1018.1167.433ON1241138731.3
SAKL0D06578g1.334ON42662712.1
KLLA0E11903g1.424ON26684692.4
TDEL0H023707.210ON371157667.4
SAKL0G18700g4.375ON164256668.0
Smik_2.1583.242ON29848659.3
CAGL0L07788g1.424ON26581659.5
KAFR0D018105.194ON373135659.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AGR270W
         (294 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AGR270W Chr7 (1244264..1245148) [885 bp, 294 aa] {ON} Syntenic h...   561   0.0  
Ecym_3124 Chr3 complement(232769..233593) [825 bp, 274 aa] {ON} ...   287   9e-97
NCAS0F00330 Chr6 (53650..54495) [846 bp, 281 aa] {ON} Anc_6.65 Y...   244   1e-79
CAGL0L04620g Chr12 (533791..534585) [795 bp, 264 aa] {ON} simila...   241   7e-79
ZYRO0D14190g Chr4 (1200325..1201212) [888 bp, 295 aa] {ON} simil...   240   4e-78
SAKL0A08426g Chr1 complement(746101..747000) [900 bp, 299 aa] {O...   240   5e-78
Kpol_1042.11 s1042 (21260..22138) [879 bp, 292 aa] {ON} (21260.....   237   1e-76
Smik_15.352 Chr15 (614812..615678) [867 bp, 288 aa] {ON} YOR174W...   235   5e-76
KAFR0G02500 Chr7 complement(519629..520498) [870 bp, 289 aa] {ON...   232   6e-75
Skud_15.336 Chr15 (607340..608200) [861 bp, 286 aa] {ON} YOR174W...   229   8e-74
KLTH0G15444g Chr7 complement(1353833..1354624) [792 bp, 263 aa] ...   228   2e-73
Suva_8.227 Chr8 (408722..409585) [864 bp, 287 aa] {ON} YOR174W (...   227   4e-73
TBLA0G00550 Chr7 (115655..116611) [957 bp, 318 aa] {ON} Anc_6.65...   227   1e-72
YOR174W Chr15 (658747..659601) [855 bp, 284 aa] {ON}  MED4Subuni...   226   2e-72
NDAI0J01320 Chr10 complement(308327..309331) [1005 bp, 334 aa] {...   227   2e-72
Kwal_56.23242 s56 (459387..460157) [771 bp, 256 aa] {ON} YOR174W...   224   3e-72
KLLA0F20185g Chr6 complement(1882094..1882951) [858 bp, 285 aa] ...   217   4e-69
TPHA0F02590 Chr6 (565725..566645) [921 bp, 306 aa] {ON} Anc_6.65...   217   8e-69
KNAG0M01020 Chr13 complement(180570..181409) [840 bp, 279 aa] {O...   215   3e-68
TDEL0G04060 Chr7 complement(741796..742458) [663 bp, 220 aa] {ON...   181   6e-56
YGL086W Chr7 (347119..349368) [2250 bp, 749 aa] {ON}  MAD1Coiled...    33   0.60 
Kpol_1018.116 s1018 (304130..306574,306576..307856) [3726 bp, 12...    33   1.3  
SAKL0D06578g Chr4 complement(541754..543034) [1281 bp, 426 aa] {...    32   2.1  
KLLA0E11903g Chr5 (1054430..1055230) [801 bp, 266 aa] {ON} highl...    31   2.4  
TDEL0H02370 Chr8 (398629..398682,398738..399799) [1116 bp, 371 a...    30   7.4  
SAKL0G18700g Chr7 complement(1613786..1618714) [4929 bp, 1642 aa...    30   8.0  
Smik_2.158 Chr2 (297867..298763) [897 bp, 298 aa] {ON} YBR040W (...    30   9.3  
CAGL0L07788g Chr12 (858202..858999) [798 bp, 265 aa] {ON} highly...    30   9.5  
KAFR0D01810 Chr4 complement(364321..365442) [1122 bp, 373 aa] {O...    30   9.7  

>AGR270W Chr7 (1244264..1245148) [885 bp, 294 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR174W (MED4)
          Length = 294

 Score =  561 bits (1447), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 276/294 (93%), Positives = 276/294 (93%)

Query: 1   MSANQLSKAATPKATPLGAAQGASSTSLHSFTSFQPQDASHVEQNKLHSVAIYEDLCQYE 60
           MSANQLSKAATPKATPLGAAQGASSTSLHSFTSFQPQDASHVEQNKLHSVAIYEDLCQYE
Sbjct: 1   MSANQLSKAATPKATPLGAAQGASSTSLHSFTSFQPQDASHVEQNKLHSVAIYEDLCQYE 60

Query: 61  ESLQRLVTSVDKFQPDLEAAQELIEIDSKLYSNLAQLPKYDLIDSQLKKLEEESKDIDER 120
           ESLQRLVTSVDKFQPDLEAAQELIEIDSKLYSNLAQLPKYDLIDSQLKKLEEESKDIDER
Sbjct: 61  ESLQRLVTSVDKFQPDLEAAQELIEIDSKLYSNLAQLPKYDLIDSQLKKLEEESKDIDER 120

Query: 121 TAKILGILGECYNDLNSLPMVEQVEFEMATMKKQKDKVNSSVLLEYAMKLSKFTRVPPTF 180
           TAKILGILGECYNDLNSLPMVEQVEFEMATMKKQKDKVNSSVLLEYAMKLSKFTRVPPTF
Sbjct: 121 TAKILGILGECYNDLNSLPMVEQVEFEMATMKKQKDKVNSSVLLEYAMKLSKFTRVPPTF 180

Query: 181 NKDAIGPNNFIWPAEDAIRRGMLAMASLKSKELTSLPGQSDQEAEQASAGKEADTAGPGV 240
           NKDAIGPNNFIWPAEDAIRRGMLAMASLKSKELTSLPGQSDQEAEQASAGKEADTAGPGV
Sbjct: 181 NKDAIGPNNFIWPAEDAIRRGMLAMASLKSKELTSLPGQSDQEAEQASAGKEADTAGPGV 240

Query: 241 STLEPANGGHNRRGSFEFTGIRKXXXXXXXXXXXXXXXXXXMDLDLNLFNPDEF 294
           STLEPANGGHNRRGSFEFTGIRK                  MDLDLNLFNPDEF
Sbjct: 241 STLEPANGGHNRRGSFEFTGIRKPPPASDADSSVVDDGDASMDLDLNLFNPDEF 294

>Ecym_3124 Chr3 complement(232769..233593) [825 bp, 274 aa] {ON}
           similar to Ashbya gossypii AGR270W
          Length = 274

 Score =  287 bits (735), Expect = 9e-97,   Method: Compositional matrix adjust.
 Identities = 158/262 (60%), Positives = 188/262 (71%), Gaps = 5/262 (1%)

Query: 38  DASHVEQNKLHSVAIYEDLCQYEESLQRLVTSVDKFQPDLEAAQELIEIDSKLYSNLAQL 97
           D+++ E N +  V +Y+DLCQ+EE LQ+LV SVDKF PDL+AAQ+LI  D KLYS L QL
Sbjct: 13  DSNNDELNHVQQVTLYKDLCQFEEDLQKLVVSVDKFSPDLQAAQDLINSDLKLYSTLEQL 72

Query: 98  PKYDLIDSQLKKLEEESKDIDERTAKILGILGECYNDLNSLPMVEQVEFEMATMKKQKDK 157
           P YD ID QLK+L+ ES++IDERT KIL IL +CYN+LN LPMVEQVEFEM  MKKQK+K
Sbjct: 73  PLYDSIDIQLKQLDNESQEIDERTGKILSILDKCYNNLNKLPMVEQVEFEMKMMKKQKEK 132

Query: 158 VNSSVLLEYAMKLSKFTRVPPTFNKDAIGPNNFIWPAEDAIRRGMLAMASLKSKELTSLP 217
           + S VLLEYAMKL+KFTRVPPTFNKDAIGPNNFIWPAEDAIRRGMLAMASLKS+ELT +P
Sbjct: 133 IKSGVLLEYAMKLAKFTRVPPTFNKDAIGPNNFIWPAEDAIRRGMLAMASLKSEELTRIP 192

Query: 218 ----GQSDQEAEQASAGKEADTAGPGVSTLEPANGGHNRRGSFEFTGIRKXXXXXXXXXX 273
                +  QE  Q    +E D   P  S+  P++   ++  SFEFTG  K          
Sbjct: 193 VELNSEEPQEPPQKGQSQEEDEVTPTHSSDTPSSKPDSKSESFEFTGKAKNQQSTQYSET 252

Query: 274 -XXXXXXXXMDLDLNLFNPDEF 294
                    +DLDL+LFNPDEF
Sbjct: 253 GAHEEADGSIDLDLDLFNPDEF 274

>NCAS0F00330 Chr6 (53650..54495) [846 bp, 281 aa] {ON} Anc_6.65
           YOR174W
          Length = 281

 Score =  244 bits (623), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 123/236 (52%), Positives = 162/236 (68%), Gaps = 10/236 (4%)

Query: 25  STSLHSFTSFQPQDASHVEQNKLHSVAIYEDLCQYEESLQRLVTSVDKFQPDLEAAQELI 84
           S+S+       P   S+ +++ +  V IY DLC YE+ L  LV SVDKF+PD+ AA+ELI
Sbjct: 20  SSSVSLLAEVNPNSISN-DEDDISKVQIYSDLCSYEQKLANLVNSVDKFKPDMNAARELI 78

Query: 85  EIDSKLYSNLAQLPKYDLIDSQLKKLEEESKDIDERTAKILGILGECYNDLNSLPMVEQV 144
           E+D  L+  L    +YD ID+ LKKL  ES ++D RT +ILGIL EC+++LN+LPM++QV
Sbjct: 79  EVDRHLFQTLDSFEEYDKIDNSLKKLNAESIELDARTKEILGILNECHDELNALPMLKQV 138

Query: 145 EFEMATMKKQKDKVNSSVLLEYAMKLSKFTRVPPTFNKDAIGPNNFIWPAEDAIRRGMLA 204
           EFEM T+ +Q+ K+NSSVLL+YA KLSKFT++PPTF+K +IGPNNFIWPAEDA+RRGMLA
Sbjct: 139 EFEMETILQQRSKINSSVLLDYATKLSKFTKIPPTFDKGSIGPNNFIWPAEDALRRGMLA 198

Query: 205 MASLKSKELTSLPGQSDQEAEQASAGKEADTAGPGVSTLEPANGGHNRRGSFEFTG 260
           +ASL + ELT  PG  + E E    G E       V+T         RR SF F+G
Sbjct: 199 LASLHADELTKAPGAHEGEEELIPKGSEPIAQEEPVTT---------RRESFTFSG 245

>CAGL0L04620g Chr12 (533791..534585) [795 bp, 264 aa] {ON} similar
           to uniprot|Q12343 Saccharomyces cerevisiae YOR174w MED4
          Length = 264

 Score =  241 bits (616), Expect = 7e-79,   Method: Compositional matrix adjust.
 Identities = 125/258 (48%), Positives = 168/258 (65%), Gaps = 10/258 (3%)

Query: 42  VEQNKLHSVAIYEDLCQYEESLQRLVTSVDKFQPDLEAAQELIEIDSKLYSNLAQLPKYD 101
           + + +L  V +Y DLC YEE+L +LV SVD F+P LE  ++LIE D KLYS L  LP+YD
Sbjct: 12  ISEQELDKVQLYSDLCLYEEALTKLVDSVDNFKPQLEIGKQLIEADKKLYSTLDLLPQYD 71

Query: 102 LIDSQLKKLEEESKDIDERTAKILGILGECYNDLNSLPMVEQVEFEMATMKKQKDKVNSS 161
            + ++L+ L++E   +D++T  IL IL EC++DLN+LP++E+VEFE   + KQ++K+ S+
Sbjct: 72  SVFTRLRTLDDEISKVDQQTKNILSILNECHDDLNALPLLEEVEFEKKMILKQREKIKSN 131

Query: 162 VLLEYAMKLSKFTRVPPTFNKDAIGPNNFIWPAEDAIRRGMLAMASLKSKELTSLPGQSD 221
           VLLEYA KL+KFT++PPTF+K  IGPNNFIWPAEDA+R+GMLAMASL  KELT LPGQ D
Sbjct: 132 VLLEYATKLAKFTKIPPTFDKGTIGPNNFIWPAEDALRKGMLAMASLHGKELTKLPGQED 191

Query: 222 QEAEQASAGKEADTAGPGVSTLEPANG-----GHNRRGSFEFTGIRKXXXXXXXXXXXXX 276
            E + ++A ++ +     V   E A G           SF F G                
Sbjct: 192 GEEDGSTANEDKNI----VKDAEGAEGEIRQDDKKEDDSFVF-GANANDAEGDEDKNAGE 246

Query: 277 XXXXXMDLDLNLFNPDEF 294
                MD DL+LFNPDEF
Sbjct: 247 DEDEAMDSDLDLFNPDEF 264

>ZYRO0D14190g Chr4 (1200325..1201212) [888 bp, 295 aa] {ON} similar
           to uniprot|Q12343 Saccharomyces cerevisiae YOR174W MED4
           Member of RNA Polymerase II transcriptional regulation
           mediator Stoichiometric member of mediator complex
          Length = 295

 Score =  240 bits (613), Expect = 4e-78,   Method: Compositional matrix adjust.
 Identities = 124/245 (50%), Positives = 162/245 (66%), Gaps = 12/245 (4%)

Query: 23  ASSTSLHSFTSFQPQDASHVEQNKLHSVAIYEDLCQYEESLQRLVTSVDKFQPDLEAAQE 82
           +SSTSL S        + +   ++L  V IY DL QYEE L  LV SVD F+PD++   E
Sbjct: 23  SSSTSLIS----DAMSSGNNNDDELSKVQIYADLTQYEEKLAALVESVDNFKPDVKIVHE 78

Query: 83  LIEIDSKLYSNLAQLPKYDLIDSQLKKLEEESKDIDERTAKILGILGECYNDLNSLPMVE 142
           LIE+D  LY +L    +YD IDS+L +L++ES ++D +T ++L  L ECY  LN LPM+E
Sbjct: 79  LIEVDKSLYKSLDSFAEYDRIDSELNRLDKESNELDRKTKEVLETLSECYEMLNGLPMLE 138

Query: 143 QVEFEMATMKKQKDKVNSSVLLEYAMKLSKFTRVPPTFNKDAIGPNNFIWPAEDAIRRGM 202
           QVEFE  ++ KQ+ KVNSSVLL YA KLSKFT++PPTF+K  IGPNNF+WPAEDA+RRGM
Sbjct: 139 QVEFEKQSILKQRSKVNSSVLLNYATKLSKFTKIPPTFDKGTIGPNNFVWPAEDALRRGM 198

Query: 203 LAMASLKSKELTSLPGQSDQEAEQASA--------GKEADTAGPGVSTLEPANGGHNRRG 254
           LA+ASL SKE+T +PG+ ++E   A+         GKE +    G     P   G+ RR 
Sbjct: 199 LAIASLHSKEMTRIPGEPEEEEADATEKQGSGDKNGKEGEETKTGERPASPGAHGNERRQ 258

Query: 255 SFEFT 259
           SF FT
Sbjct: 259 SFVFT 263

>SAKL0A08426g Chr1 complement(746101..747000) [900 bp, 299 aa] {ON}
           similar to gnl|GLV|KLLA0F20185g Kluyveromyces lactis
           KLLA0F20185g and weakly similar to YOR174W
           uniprot|Q12343 Saccharomyces cerevisiae YOR174W MED4
           Member of RNA Polymerase II transcriptional regulation
           mediator Stoichiometric member of mediator complex
          Length = 299

 Score =  240 bits (613), Expect = 5e-78,   Method: Compositional matrix adjust.
 Identities = 111/177 (62%), Positives = 144/177 (81%)

Query: 43  EQNKLHSVAIYEDLCQYEESLQRLVTSVDKFQPDLEAAQELIEIDSKLYSNLAQLPKYDL 102
           +Q+ L  V +Y D+C+YEE+L +LV+SVDKF+PDL+ AQELIE D KL+  L + PKYD 
Sbjct: 40  DQDLLSRVEVYADICEYEETLGKLVSSVDKFKPDLKVAQELIETDKKLFKALEEFPKYDK 99

Query: 103 IDSQLKKLEEESKDIDERTAKILGILGECYNDLNSLPMVEQVEFEMATMKKQKDKVNSSV 162
           ID +L  LE++S+++D++T+KIL +L  C+  LNSLP +EQV  E  TM KQ++K+ S V
Sbjct: 100 IDGRLNDLEKQSQEVDKKTSKILEVLNGCHAQLNSLPALEQVLLERDTMLKQREKIYSGV 159

Query: 163 LLEYAMKLSKFTRVPPTFNKDAIGPNNFIWPAEDAIRRGMLAMASLKSKELTSLPGQ 219
           LL+YAMKL+KFTRVPPTF+K  +GPNNFIWPAEDA+RRGMLAMASLKSKELT +PGQ
Sbjct: 160 LLDYAMKLAKFTRVPPTFDKGMVGPNNFIWPAEDAMRRGMLAMASLKSKELTRIPGQ 216

>Kpol_1042.11 s1042 (21260..22138) [879 bp, 292 aa] {ON}
           (21260..22138) [879 nt, 293 aa]
          Length = 292

 Score =  237 bits (604), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 131/289 (45%), Positives = 179/289 (61%), Gaps = 13/289 (4%)

Query: 17  LGAAQGASSTSLH-------SFTSFQPQDASHVEQNKLHSVAIYEDLCQYEESLQRLVTS 69
           +G  +  SS SL        S  S    D ++ E N L  V IY D+ +YE +L +LV S
Sbjct: 6   MGHVKSISSVSLMTDNTNSISTNSLNMIDYNN-ESNDLSKVQIYNDISEYENTLFKLVES 64

Query: 70  VDKFQPDLEAAQELIEIDSKLYSNLAQLPKYDLIDSQLKKLEEESKDIDERTAKILGILG 129
           VDKF+PD++ A +LI++D +L+ +L    +YD I ++L++ ++E+ ++D +T +ILG L 
Sbjct: 65  VDKFKPDVKLAHQLIDVDERLFKSLDSFVEYDKISTKLEECDKEAAELDTKTKEILGTLN 124

Query: 130 ECYNDLNSLPMVEQVEFEMATMKKQKDKVNSSVLLEYAMKLSKFTRVPPTFNKDAIGPNN 189
           EC+  LNSLPM+EQVEFE   + KQ+ K+NS +LL+YA KLSKFT++PPTFNK +IGPNN
Sbjct: 125 ECHGLLNSLPMLEQVEFEKDIILKQRSKINSKLLLDYATKLSKFTKIPPTFNKGSIGPNN 184

Query: 190 FIWPAEDAIRRGMLAMASLKSKELTSLPGQSDQEAEQASAGKEADTAGPGV--STLEPAN 247
           FIWPAEDA+RRGMLAMASL SKELT LP +  +EA +     E D +   +    +   N
Sbjct: 185 FIWPAEDALRRGMLAMASLHSKELTKLPNEP-EEASEPDKSTEPDKSTEPIEEEKITVDN 243

Query: 248 GGHNRRGSFEFTGIRKXXXXXXXXXXX--XXXXXXXMDLDLNLFNPDEF 294
            G    GS  + G  K                    MDLDL+LFNPDEF
Sbjct: 244 EGDISMGSIVYDGSHKVKENEKAEENEKGSEAEADNMDLDLDLFNPDEF 292

>Smik_15.352 Chr15 (614812..615678) [867 bp, 288 aa] {ON} YOR174W
           (REAL)
          Length = 288

 Score =  235 bits (599), Expect = 5e-76,   Method: Compositional matrix adjust.
 Identities = 102/175 (58%), Positives = 148/175 (84%)

Query: 44  QNKLHSVAIYEDLCQYEESLQRLVTSVDKFQPDLEAAQELIEIDSKLYSNLAQLPKYDLI 103
           ++KL  V +YEDLC+YE++L++LV SVD+F+PD++ A++LI+ID  L++N+  L +YD I
Sbjct: 34  EDKLSKVQLYEDLCRYEDTLKKLVESVDRFKPDIDVARDLIKIDESLFNNVDLLSEYDNI 93

Query: 104 DSQLKKLEEESKDIDERTAKILGILGECYNDLNSLPMVEQVEFEMATMKKQKDKVNSSVL 163
           D  L+K++++S+++D +T +IL I+ EC+++L +LPM+EQVEFE  T+ +Q+ K+NS+ L
Sbjct: 94  DRNLRKIDKDSEELDSKTKRILEIMNECHDELGALPMLEQVEFEKNTILQQRSKINSTAL 153

Query: 164 LEYAMKLSKFTRVPPTFNKDAIGPNNFIWPAEDAIRRGMLAMASLKSKELTSLPG 218
           L+YA KLSKFTR+PPTF+K +IGPNNFIWPAEDA+RRGMLAMASL SKELT +PG
Sbjct: 154 LDYATKLSKFTRIPPTFDKGSIGPNNFIWPAEDALRRGMLAMASLHSKELTRVPG 208

>KAFR0G02500 Chr7 complement(519629..520498) [870 bp, 289 aa] {ON}
           Anc_6.65 YOR174W
          Length = 289

 Score =  232 bits (592), Expect = 6e-75,   Method: Compositional matrix adjust.
 Identities = 117/246 (47%), Positives = 160/246 (65%), Gaps = 1/246 (0%)

Query: 50  VAIYEDLCQYEESLQRLVTSVDKFQPDLEAAQELIEIDSKLYSNLAQLPKYDLIDSQLKK 109
           V IY DL QYEE+L RL+ S+D ++PD + AQELI+IDSKL+++L    +YD I S+LK 
Sbjct: 44  VGIYSDLSQYEETLSRLIQSIDTYKPDKKIAQELIDIDSKLFNSLDSFVQYDRISSRLKD 103

Query: 110 LEEESKDIDERTAKILGILGECYNDLNSLPMVEQVEFEMATMKKQKDKVNSSVLLEYAMK 169
            E++ K+   +T +IL  L EC+N LN LP V+QV FEM TM +Q+ K+NSSVLL+YA K
Sbjct: 104 FEKQEKESTLKTKEILETLNECHNALNLLPTVDQVHFEMNTMLEQRKKINSSVLLDYATK 163

Query: 170 LSKFTRVPPTFNKDAIGPNNFIWPAEDAIRRGMLAMASLKSKELTSLPG-QSDQEAEQAS 228
           LSKFT++PPTF+K +IGPNNF+WPAEDA+RRGMLA+A+  + ELT + G +     + + 
Sbjct: 164 LSKFTKIPPTFDKGSIGPNNFVWPAEDALRRGMLALAASHTDELTKIAGVEMSLSDDNSI 223

Query: 229 AGKEADTAGPGVSTLEPANGGHNRRGSFEFTGIRKXXXXXXXXXXXXXXXXXXMDLDLNL 288
           A  E  +   G   +       +RRGS+ F G                     +DLDL+L
Sbjct: 224 ALDEIKSVDAGEGPIPEKKDSSSRRGSYIFAGQSGKNAEHKNNEENKEEADNAVDLDLDL 283

Query: 289 FNPDEF 294
           FNPD+F
Sbjct: 284 FNPDDF 289

>Skud_15.336 Chr15 (607340..608200) [861 bp, 286 aa] {ON} YOR174W
           (REAL)
          Length = 286

 Score =  229 bits (584), Expect = 8e-74,   Method: Compositional matrix adjust.
 Identities = 103/184 (55%), Positives = 146/184 (79%)

Query: 44  QNKLHSVAIYEDLCQYEESLQRLVTSVDKFQPDLEAAQELIEIDSKLYSNLAQLPKYDLI 103
           ++KL  V +YEDLC+YE  L +LV SVD+F+PDL+ A++LI  D  L++N+  L  YD I
Sbjct: 34  EDKLSKVQLYEDLCRYEGVLSKLVESVDRFKPDLDVARDLISADESLFNNVKLLADYDNI 93

Query: 104 DSQLKKLEEESKDIDERTAKILGILGECYNDLNSLPMVEQVEFEMATMKKQKDKVNSSVL 163
           D  L+K++++S+++D ++ KIL IL EC+++L+ LP +EQVEFE  T+ +Q+ K+NS+ L
Sbjct: 94  DRNLQKIDKDSEELDSKSRKILEILNECHDELSGLPTLEQVEFEKNTILQQRSKINSTAL 153

Query: 164 LEYAMKLSKFTRVPPTFNKDAIGPNNFIWPAEDAIRRGMLAMASLKSKELTSLPGQSDQE 223
           L+YA KLSKFT++PPTF+K  +GPNNFIWPAEDA+RRGMLAMASL SKELT +PG+ +QE
Sbjct: 154 LDYATKLSKFTKIPPTFDKGTVGPNNFIWPAEDALRRGMLAMASLHSKELTRVPGEDEQE 213

Query: 224 AEQA 227
            E+ 
Sbjct: 214 TEEV 217

>KLTH0G15444g Chr7 complement(1353833..1354624) [792 bp, 263 aa]
           {ON} some similarities with uniprot|Q12343 Saccharomyces
           cerevisiae YOR174W MED4 Member of RNA Polymerase II
           transcriptional regulation mediator Stoichiometric
           member of mediator complex
          Length = 263

 Score =  228 bits (580), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 119/227 (52%), Positives = 160/227 (70%), Gaps = 7/227 (3%)

Query: 38  DASHVEQNKLHSVAIYEDLCQYEESLQRLVTSVDKFQPDLEAAQELIEIDSKLYSNLAQL 97
           D S   +N L  + +Y D+C++E++L +LV SVD+F PDLE A+ LIE D +LY +L  L
Sbjct: 13  DRSDSVENPLSKLQVYNDICEFEDTLGKLVASVDRFNPDLELARALIEADKQLYKSLECL 72

Query: 98  PKYDLIDSQLKKLEEESKDIDERTAKILGILGECYNDLNSLPMVEQVEFEMATMKKQKDK 157
           PKYD ID++ K L+EE +D DE+T +IL  L EC +DLN+LPM+EQVEFE  TM KQ++K
Sbjct: 73  PKYDEIDTRAKTLDEEHRDTDEKTIRILETLTECGSDLNALPMLEQVEFERETMLKQREK 132

Query: 158 VNSSVLLEYAMKLSKFTRVPPTFNKDAIGPNNFIWPAEDAIRRGMLAMASLKSKELTSLP 217
           V + VLL+YAMKL+KFT VPPTF+K  +GPNNF+WPAEDA+RRGMLA+ASL++ E  +  
Sbjct: 133 VFTDVLLDYAMKLAKFTHVPPTFDKGTVGPNNFVWPAEDAMRRGMLAIASLRASEGANAQ 192

Query: 218 GQ---SDQE-AEQASAGKEADTAGPGVSTLEPANGGHNRRGSFEFTG 260
            Q   S+Q+ +E++S  +EA T      T E       RR SF F G
Sbjct: 193 EQQASSEQKTSEKSSENEEAQTDIRSPDTKEEPVA---RRPSFGFDG 236

>Suva_8.227 Chr8 (408722..409585) [864 bp, 287 aa] {ON} YOR174W
           (REAL)
          Length = 287

 Score =  227 bits (579), Expect = 4e-73,   Method: Compositional matrix adjust.
 Identities = 102/175 (58%), Positives = 143/175 (81%)

Query: 44  QNKLHSVAIYEDLCQYEESLQRLVTSVDKFQPDLEAAQELIEIDSKLYSNLAQLPKYDLI 103
           ++K   V +YEDLC+YE+ L +LV SVD+F+P+LE A++LI+ D  L++N+  L  YD I
Sbjct: 34  EHKSSKVQLYEDLCRYEDILGKLVESVDRFKPNLEIAKDLIKTDESLFNNVKLLADYDKI 93

Query: 104 DSQLKKLEEESKDIDERTAKILGILGECYNDLNSLPMVEQVEFEMATMKKQKDKVNSSVL 163
           D  L+K++++S+++D +T KIL IL EC+++L++LPM+EQVEFE  T+ +Q+ K+NS+ L
Sbjct: 94  DLNLRKIDKDSEELDSKTRKILEILNECHDELSALPMLEQVEFEKKTILQQRSKINSTAL 153

Query: 164 LEYAMKLSKFTRVPPTFNKDAIGPNNFIWPAEDAIRRGMLAMASLKSKELTSLPG 218
           L+YA KLSKFTR+PPTF+K  +GPNNFIWPAEDA+RRGMLAMASL SKELT +PG
Sbjct: 154 LDYATKLSKFTRIPPTFDKGTVGPNNFIWPAEDALRRGMLAMASLHSKELTRIPG 208

>TBLA0G00550 Chr7 (115655..116611) [957 bp, 318 aa] {ON} Anc_6.65
           YOR174W
          Length = 318

 Score =  227 bits (579), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 115/224 (51%), Positives = 159/224 (70%), Gaps = 5/224 (2%)

Query: 43  EQNKLHSVAIYEDLCQYEESLQRLVTSVDKFQPDLEAAQELIEIDSKLYSNLAQLPKYDL 102
           + ++L  +  Y DL QYEE+L +L +SVDK++PDL+ A +LI+ID KLYS L    KYD 
Sbjct: 33  KNDELSKIQTYNDLIQYEETLSKLSSSVDKYKPDLQYAYDLIDIDRKLYSTLDSFVKYDE 92

Query: 103 IDSQLKKLEEESKDIDERTAKILGILGECYNDLNSLPMVEQVEFEMATMKKQKDKVNSSV 162
           I ++LKKLE ++K +DE+T  +L  L +C+  LN+LPM+EQVEFE  TM KQ++K+NS V
Sbjct: 93  ISTKLKKLEIDTKALDEKTKSVLDSLNDCHELLNTLPMLEQVEFEKNTMLKQREKINSKV 152

Query: 163 LLEYAMKLSKFTRVPPTFNKDAIGPNNFIWPAEDAIRRGMLAMASLKSKELTSLPGQ-SD 221
           LL+YA KL+KFT++PPTFNK+ +GPNNFIWPAEDA+RRGMLA+AS  ++ELT+LPG   D
Sbjct: 153 LLDYATKLAKFTKIPPTFNKNTLGPNNFIWPAEDALRRGMLAVASAHTEELTALPGSVGD 212

Query: 222 QEAEQASAGKEAD--TAGPGVSTLEPANGGHN--RRGSFEFTGI 261
           +E  +  +   AD  T       ++    G +  RRGSF F  +
Sbjct: 213 EENSKDISQLNADDVTNKDNHMDMDITVEGQDRFRRGSFTFGSL 256

>YOR174W Chr15 (658747..659601) [855 bp, 284 aa] {ON}  MED4Subunit
           of the RNA polymerase II mediator complex; associates
           with core polymerase subunits to form the RNA polymerase
           II holoenzyme; essential for transcriptional regulation
          Length = 284

 Score =  226 bits (575), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 101/175 (57%), Positives = 143/175 (81%)

Query: 44  QNKLHSVAIYEDLCQYEESLQRLVTSVDKFQPDLEAAQELIEIDSKLYSNLAQLPKYDLI 103
           ++KL  V +YEDLC+YE++L +LV SVD+F+P+L+ A++LI  D  L+ N+  L +YD I
Sbjct: 34  EDKLSKVQLYEDLCRYEDTLSKLVESVDRFKPNLDIAKDLIRTDEALFENVKLLAEYDNI 93

Query: 104 DSQLKKLEEESKDIDERTAKILGILGECYNDLNSLPMVEQVEFEMATMKKQKDKVNSSVL 163
              L+K++++S+++D +T KIL IL EC+++L +LPM+EQVEFE  T+ +Q+ K+NS+ L
Sbjct: 94  YRNLQKIDKDSEELDSKTRKILEILNECHDELKALPMLEQVEFEKNTILQQRSKINSTEL 153

Query: 164 LEYAMKLSKFTRVPPTFNKDAIGPNNFIWPAEDAIRRGMLAMASLKSKELTSLPG 218
           L+YA KLSKFT++PPTF+K A+GPNNFIWPAEDA+RRGMLAMASL SKELT +PG
Sbjct: 154 LDYATKLSKFTKIPPTFDKGAVGPNNFIWPAEDALRRGMLAMASLHSKELTRIPG 208

>NDAI0J01320 Chr10 complement(308327..309331) [1005 bp, 334 aa] {ON}
           Anc_6.65 YOR174W
          Length = 334

 Score =  227 bits (579), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 129/304 (42%), Positives = 177/304 (58%), Gaps = 17/304 (5%)

Query: 2   SANQLSKAATPKATPLGAAQGASSTSLHSFTSFQPQDASHVEQNKLHSVAIYEDLCQYEE 61
           SAN L +A++          G  S+S   F      D+S   ++ L  V IY+D+  YE+
Sbjct: 37  SANHL-RASSVSLLAEAVTNGTPSSS--EFNRSYDNDSS---KDVLSEVRIYDDIITYEK 90

Query: 62  SLQRLVTSVDKFQPDLEAAQELIEIDSKLYSNLAQLPKYDLIDSQLKKLEEESKDIDERT 121
           +L RL+ SVDKF+P+L  AQELI+ D  L+  L    +YD ID  LK LE ++  IDE T
Sbjct: 91  ALSRLIDSVDKFKPNLNIAQELIQADKSLFDTLNSFIQYDEIDLHLKALETKASKIDELT 150

Query: 122 AKILGILGECYNDLNSLPMVEQVEFEMATMKKQKDKVNSSVLLEYAMKLSKFTRVPPTFN 181
              L  L EC++DLN LP + Q+EFE+ T+  Q+ K+NS++LL+YA KLSKFT++PPTF+
Sbjct: 151 QSTLQTLNECHDDLNKLPTLPQIEFELNTILNQRTKINSTILLDYATKLSKFTKIPPTFD 210

Query: 182 KDAIGPNNFIWPAEDAIRRGMLAMASLKSKELTSLPGQSDQEAEQASAGKEADTAGPGVS 241
           K +IGPNNFIWPAED++RRGMLAMASLK+ +LT +PGQ+   +++ +   E         
Sbjct: 211 KGSIGPNNFIWPAEDSLRRGMLAMASLKADQLTYIPGQAQSMSKEKALPTEVQETQEQTQ 270

Query: 242 TLEPANGGHNRRGSFEFTGIRKXXXXXXXXXXXXXXXXX-----------XMDLDLNLFN 290
           T +       RR SF F+G  K                             MD+DL+LFN
Sbjct: 271 TQQQDQEEQPRRESFVFSGKNKEEEEETTHTHEDSKRKQEEKDHESGDEDAMDIDLDLFN 330

Query: 291 PDEF 294
           PDEF
Sbjct: 331 PDEF 334

>Kwal_56.23242 s56 (459387..460157) [771 bp, 256 aa] {ON} YOR174W
           (MED4) - Stoichiometric member of mediator complex
           [contig 183] FULL
          Length = 256

 Score =  224 bits (571), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 111/217 (51%), Positives = 150/217 (69%), Gaps = 6/217 (2%)

Query: 44  QNKLHSVAIYEDLCQYEESLQRLVTSVDKFQPDLEAAQELIEIDSKLYSNLAQLPKYDLI 103
           +++L    IY D+C++EE+L +LV SVDKF PDL+ A+ LIE+D +L   L  LP+YD I
Sbjct: 19  ESRLSKAQIYSDICEFEETLGKLVASVDKFNPDLKIAESLIEVDKRLSKTLESLPRYDEI 78

Query: 104 DSQLKKLEEESKDIDERTAKILGILGECYNDLNSLPMVEQVEFEMATMKKQKDKVNSSVL 163
           D + K+L+++  + DER  +IL  L EC  DLN+LPM+EQVEFE  TM KQ++KV ++VL
Sbjct: 79  DLRAKELDQKHLETDERMVRILETLTECSTDLNALPMLEQVEFERQTMLKQREKVFTNVL 138

Query: 164 LEYAMKLSKFTRVPPTFNKDAIGPNNFIWPAEDAIRRGMLAMASLKSKELTSLPGQSDQE 223
           L+YAMKL+KFT VPPTF+K A+GPNNF+WPAEDA+RRGMLA+ASL++ E    P      
Sbjct: 139 LDYAMKLAKFTHVPPTFDKGAVGPNNFVWPAEDAMRRGMLAIASLQASEDAKKPETG--A 196

Query: 224 AEQASAGKEADTAGPGVSTLEPANGGHNRRGSFEFTG 260
           A+ A    +   + P +   EP      RR SFEF G
Sbjct: 197 AQTAEETTKQPQSSPQLKVEEPM----QRRDSFEFNG 229

>KLLA0F20185g Chr6 complement(1882094..1882951) [858 bp, 285 aa]
           {ON} similar to uniprot|Q12343 Saccharomyces cerevisiae
           YOR174W MED4 Member of RNA Polymerase II transcriptional
           regulation mediator Stoichiometric member of mediator
           complex
          Length = 285

 Score =  217 bits (553), Expect = 4e-69,   Method: Compositional matrix adjust.
 Identities = 121/262 (46%), Positives = 161/262 (61%), Gaps = 19/262 (7%)

Query: 10  ATPKATPLGAAQGASSTSLHSFTSFQPQDASHVE-QNKLHSVAIYEDLCQYEESLQRLVT 68
           +TP   P       SSTS+ +   F  QD +  +   +L SV IY+DL +YEE++Q+L  
Sbjct: 2   STPGPVP-------SSTSVATL-PFSAQDKTQEQVSEELQSVGIYQDLERYEETIQQLSK 53

Query: 69  SVDKFQPDLEAAQELIEIDSKLYSNLAQLPKYDLIDSQLKKLEEESKDIDERTAKILGIL 128
           SVD F+PDL    ++IE D KLY  L +  +Y  I+ +L +L++E K+ID +T +IL  L
Sbjct: 54  SVDTFKPDLSLIDKVIECDKKLYETLEEFDEYYKIEEELSRLDKEQKNIDNKTREILETL 113

Query: 129 GECYNDLNSLPMVEQVEFEMATMKKQKDKVNSSVLLEYAMKLSKFTRVPPTFNKDAIGPN 188
             CYN LN LPM+EQVEFE   M KQ++K++S V+L+YAMKL+KFTR PPTF+K  IGPN
Sbjct: 114 NTCYNSLNELPMLEQVEFEQKVMLKQREKIHSKVVLDYAMKLAKFTRFPPTFDKSMIGPN 173

Query: 189 NFIWPAEDAIRRGMLAMASLKSKE--LTSLPGQSDQEAEQASAGKE--------ADTAGP 238
           NFIWPAED++R+GMLAMASLK KE  L +L   +       S   E         D    
Sbjct: 174 NFIWPAEDSLRKGMLAMASLKKKELLLDALDEDNVNNDNNTSKIDEMRNTNEDSVDDRFN 233

Query: 239 GVSTLEPANGGHNRRGSFEFTG 260
               ++ A     RRGSFEFT 
Sbjct: 234 NKEQVQDATEDTERRGSFEFTA 255

>TPHA0F02590 Chr6 (565725..566645) [921 bp, 306 aa] {ON} Anc_6.65
           YOR174W
          Length = 306

 Score =  217 bits (553), Expect = 8e-69,   Method: Compositional matrix adjust.
 Identities = 119/292 (40%), Positives = 177/292 (60%), Gaps = 16/292 (5%)

Query: 6   LSKAATPKATPLGAAQGASSTSLHSFTSFQPQDASHVEQNKLHSVAIYEDLCQYEESLQR 65
           L+  A P++T    +QG +S            + +    + L +VAIY D+  YE++L +
Sbjct: 28  LTPVAVPQSTANNISQGTAS------------NMNTAAVDSLANVAIYNDIKNYEDTLIK 75

Query: 66  LVTSVDKFQPDLEAAQELIEIDSKLYSNLAQLPKYDLIDSQLKKLEEESKDIDERTAKIL 125
           LV+S+D F+PD+E A+ LIE+D +LY NL    +YD ID+++ K++++S+ +D +T  IL
Sbjct: 76  LVSSIDNFRPDVEVAKTLIEVDKRLYKNLGSFKEYDEIDTKISKIKDDSEKLDLQTKHIL 135

Query: 126 GILGECYNDLNSLPMVEQVEFEMATMKKQKDKVNSSVLLEYAMKLSKFTRVPPTFNKDAI 185
            IL +  N LNSLPM+E++ FE   M +++ K+NS +LL+YA K+SKFT++PPTFNK +I
Sbjct: 136 DILNDSRNMLNSLPMLEEIYFERDVMHEKQKKINSKILLDYATKISKFTKIPPTFNKGSI 195

Query: 186 GPNNFIWPAEDAIRRGMLAMASLKSKELTSLPGQSDQEAEQASAGKEADTAGPGVSTLEP 245
           GPNNFIWPAEDA+RRGMLA+AS+   ELT LP  +  ++++    ++ +    G      
Sbjct: 196 GPNNFIWPAEDALRRGMLAVASIHRSELTKLPNDTSYDSDK-ELEEQQEQEQHGTENTRE 254

Query: 246 ANGGHNRRGSFEFTGIRKXXXXXXXXXXX---XXXXXXXMDLDLNLFNPDEF 294
           A+    +  SF F G  K                     MDLDL LFNPDEF
Sbjct: 255 ADVEQEQEESFVFDGKHKNEEKTENSNEANSNDDNENDNMDLDLELFNPDEF 306

>KNAG0M01020 Chr13 complement(180570..181409) [840 bp, 279 aa] {ON}
           Anc_6.65 YOR174W
          Length = 279

 Score =  215 bits (547), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 118/248 (47%), Positives = 162/248 (65%), Gaps = 8/248 (3%)

Query: 47  LHSVAIYEDLCQYEESLQRLVTSVDKFQPDLEAAQELIEIDSKLYSNLAQLPKYDLIDSQ 106
           L  V IY  + +YE++L  LV SVD ++PD+  AQ L++ D +L+++L +  +YD I ++
Sbjct: 40  LKKVRIYSGIVEYEDTLAALVESVDSYKPDMAVAQRLVDADKELFASLDKFKEYDEISTR 99

Query: 107 LKKLEEESKDIDERTAKILGILGECYNDLNSLPMVEQVEFEMATMKKQKDKVNSSVLLEY 166
           L +L+ +S  +D +T  IL  L EC+++LN LP +EQV+FEM T+ +Q++K+NSS LL+Y
Sbjct: 100 LGELKGKSTALDTKTRDILEKLNECHDELNKLPYLEQVQFEMDTILEQREKINSSELLDY 159

Query: 167 AMKLSKFTRVPPTFNKDAIGPNNFIWPAEDAIRRGMLAMASLKSKELTSLPGQSDQEAEQ 226
           A KLSKFTR+PPTF+K +IGPNNFIWPAEDA+R+GMLA+A+L S+ELT +PGQ D E   
Sbjct: 160 ATKLSKFTRIPPTFDKGSIGPNNFIWPAEDALRKGMLAIAALHSRELTRIPGQDDAE--- 216

Query: 227 ASAGKEADTAGPGVSTLEPANGGHNRRGSFEFTGIRKXXXXXXXXXXXXXXXXXXMDLDL 286
               K+  T  P V   EPA     RR SF F                       MDLDL
Sbjct: 217 ---DKKKQTEKPDVP--EPAPVTEERRSSFVFGDTSTADDQKSSSAHSDHDDDDAMDLDL 271

Query: 287 NLFNPDEF 294
           +LFNPDEF
Sbjct: 272 DLFNPDEF 279

>TDEL0G04060 Chr7 complement(741796..742458) [663 bp, 220 aa] {ON}
           Anc_6.65 YOR174W
          Length = 220

 Score =  181 bits (460), Expect = 6e-56,   Method: Compositional matrix adjust.
 Identities = 86/163 (52%), Positives = 121/163 (74%), Gaps = 3/163 (1%)

Query: 52  IYEDLCQYEESLQRLVTSVDKFQPDLEAAQELIEIDSKLYSNLAQLPKYDLIDSQLKKLE 111
           +Y DL +YEE+L RLV SVD+F+PDL  A+EL+E D  L  +L +   YD +D +L++L+
Sbjct: 4   VYGDLTRYEEALGRLVESVDQFRPDLSCARELVEADRALGKSLDKFGLYDEVDKELQRLD 63

Query: 112 EESKDIDERTAKILGILGECYNDLNSLPMVEQVEFEMATMKKQKDKVNSSVLLEYAMKLS 171
            ES+ ++  TA+ L  L ECY  L++LPM+EQV+FE   + +Q+ +VNS+VLLEYA KLS
Sbjct: 64  RESERLNRHTARTLETLDECYRALSALPMLEQVKFEQRKVLEQRGRVNSAVLLEYATKLS 123

Query: 172 KFTRVPPTFNKDAIGPNNFIWPAEDAIRRGMLAMASLKSKELT 214
           KFT+ P      A+GPNNF+WPAEDA+RRG LA+A+L S+E+T
Sbjct: 124 KFTKAPAGV---AVGPNNFVWPAEDALRRGQLAVAALHSEEIT 163

>YGL086W Chr7 (347119..349368) [2250 bp, 749 aa] {ON}
           MAD1Coiled-coil protein involved in the spindle-assembly
           checkpoint; phosphorylated by Mps1p upon checkpoint
           activation which leads to inhibition of the activity of
           the anaphase promoting complex; forms a complex with
           Mad2p
          Length = 749

 Score = 33.5 bits (75), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 36/136 (26%), Positives = 59/136 (43%), Gaps = 19/136 (13%)

Query: 109 KLEEESKDIDERTAKILGILGECYNDLNSLPMVEQVEFEMATMKKQKDKVNSSVLLEYAM 168
           KLE+E K + ER+A  +    +C  +L +   ++  + EM T+++Q           Y  
Sbjct: 119 KLEQELKSLKERSANSMNDKDKCIEELRT--TLQNKDLEMETLRQQ-----------YDS 165

Query: 169 KLSKFTRVPPTFNKDAIGPNNFIWPAEDAIRRGMLAMASLKSKELTSLPGQSDQEAEQAS 228
           KLSK T     F  +A   ++ +   E  I+R      S+  K+L     + D E     
Sbjct: 166 KLSKVTNQCDHFKLEAESSHSLLMKYEKEIKR-----QSVDIKDLQHQVMEKDDELSSVK 220

Query: 229 AGKEADTAGPGVSTLE 244
           A K  + + P  ST E
Sbjct: 221 ASKMIN-SHPNYSTEE 235

>Kpol_1018.116 s1018 (304130..306574,306576..307856) [3726 bp, 1241
            aa] {ON} (304130..306574,306576..307856) [3726 nt, 1242
            aa]
          Length = 1241

 Score = 32.7 bits (73), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 36/138 (26%), Positives = 60/138 (43%), Gaps = 22/138 (15%)

Query: 9    AATPKATPLGAAQGASSTSLHSFTSFQPQDASHVE-------QNKLHSVAIYEDLCQYEE 61
            A      P  A  G      +++T +QP + S+V        QN LH V+    L     
Sbjct: 1006 AGVAGDVPFSAVDG------NNYTHWQPFNKSNVAKLLIDLGQNNLHEVSGGMLLWG--- 1056

Query: 62   SLQRLVTSVD-KFQPDLEAAQELIEIDSKLYSNLAQLPKYDLIDSQLKKLEEESKDIDER 120
              QR   ++  +  P  E  + L+E  +    N   +PK D  DS L+ L++   + +E 
Sbjct: 1057 --QRPAKNISVEILPHSEMIERLLENITDFVEN-GNIPKDD--DSLLELLQDVYYEDEES 1111

Query: 121  TAKILGILGECYNDLNSL 138
              ++ G   +C ND+NS+
Sbjct: 1112 ICRVFGGTDQCANDVNSI 1129

>SAKL0D06578g Chr4 complement(541754..543034) [1281 bp, 426 aa] {ON}
           similar to uniprot|Q758E5 Ashbya gossypii AEL183C
           AEL183Cp and weakly similar to YJL049W uniprot|P47048
           Saccharomyces cerevisiae YJL049W Hypothetical ORF
          Length = 426

 Score = 32.0 bits (71), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 37/62 (59%), Gaps = 7/62 (11%)

Query: 96  QLPKYDLIDSQLKKLEEESKDIDERTAKILGILGECYNDLNSLPMVEQVEFEMATMKKQK 155
           Q+   D ++  + K E++S D++E   K+L I G  YN+       E+++ E+A ++K++
Sbjct: 333 QIGGIDEVERAISKFEDQSNDVNEMNDKLLEISGYDYNE-------EEIDEELARIEKEQ 385

Query: 156 DK 157
           +K
Sbjct: 386 EK 387

>KLLA0E11903g Chr5 (1054430..1055230) [801 bp, 266 aa] {ON} highly
           similar to uniprot|P25343 Saccharomyces cerevisiae
           YCR009C RVS161 BAR adaptor protein subunit of a complex
           (Rvs161p Rvs167p) that regulates actin endocytosis and
           viability following starvation or osmotic stress
          Length = 266

 Score = 31.2 bits (69), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 26/84 (30%), Positives = 42/84 (50%), Gaps = 8/84 (9%)

Query: 100 YDLIDSQLKKLEEESKDIDERTAKILGILGECYNDLNSLPMVEQVEFEMATMKKQKDKVN 159
           +D I++ +KK E + +D D   AK+  ++ +   D   LP  E+   E+A  K   D +N
Sbjct: 127 FDEIETAIKKREHKKQDYDAAKAKVRRLIDKPAKDATKLPRAEK---ELAFAKDIYDNLN 183

Query: 160 SSVLLEYAMKLSKFTRVP---PTF 180
             + LE    +S   RVP   P+F
Sbjct: 184 DQLKLELPQLVS--LRVPYYDPSF 205

>TDEL0H02370 Chr8 (398629..398682,398738..399799) [1116 bp, 371 aa]
           {ON} Anc_7.210 YER044C-A
          Length = 371

 Score = 30.0 bits (66), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 40/157 (25%), Positives = 68/157 (43%), Gaps = 22/157 (14%)

Query: 38  DASHVEQNKLHSVAIYEDLCQYEESLQRLVTSV------DKFQPDLEAAQELIEIDSKLY 91
           +  H E N +H   +   +C Y ESL  +  +         FQ  L   Q  +    K  
Sbjct: 219 NGEHSESNAVHFFHMMSSICFYLESLIHVYIAQISSKEDTAFQKHLACNQHYL----KRT 274

Query: 92  SNLAQLPKYDLIDSQLKKLEEESKDIDERTAKILGILGE---CYNDLNSLPM---VEQVE 145
            +L QL   DL    L  L +E++ + +R   +  I+ E    +ND+    +   VEQ E
Sbjct: 275 QSLPQLHVNDL----LLMLGKETERVQDRLDCLKMIIREFLKIFNDVQWSRLDSYVEQHE 330

Query: 146 FEMATMKKQKDKVNSSVLLEYAMKLSKFTRVP--PTF 180
                MKK++  + S++L+   ++L    R+   PT+
Sbjct: 331 VHACAMKKRRLNIQSTLLVTGELELISAFRLINWPTW 367

>SAKL0G18700g Chr7 complement(1613786..1618714) [4929 bp, 1642 aa]
           {ON} similar to uniprot|P47171 Saccharomyces cerevisiae
           YJR140C HIR3 Transcriptional corepressor
          Length = 1642

 Score = 30.0 bits (66), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 31/56 (55%), Gaps = 5/56 (8%)

Query: 57  CQYEESLQRLVTSVDKFQPDLEAAQELIEIDSKLYSNLAQLPKYDL--IDSQLKKL 110
           C  E +   L+TS++K Q  +   +  IEI   LYSN   +P+  L  ++SQL K+
Sbjct: 631 CISEITDDNLITSLNKVQSRINKTETGIEI---LYSNYKNIPRLHLKTVESQLSKI 683

>Smik_2.158 Chr2 (297867..298763) [897 bp, 298 aa] {ON} YBR040W
           (REAL)
          Length = 298

 Score = 29.6 bits (65), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 29/48 (60%), Gaps = 3/48 (6%)

Query: 131 CY--NDLNSLPMVEQVEFEMATMKKQKDKVNSSVLLEYAMKLSKFTRV 176
           CY   DL+S+P+ + +E +++ +     K  SSV+L   +KL++ T V
Sbjct: 110 CYPRKDLSSVPLYKDLEIQLSNIASSNSKAQSSVILN-ILKLAQLTSV 156

>CAGL0L07788g Chr12 (858202..858999) [798 bp, 265 aa] {ON} highly
           similar to uniprot|P25343 Saccharomyces cerevisiae
           YCR009c
          Length = 265

 Score = 29.6 bits (65), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 26/81 (32%), Positives = 40/81 (49%), Gaps = 8/81 (9%)

Query: 103 IDSQLKKLEEESKDIDERTAKILGILGECYNDLNSLPMVEQVEFEMATMKKQKDKVNSSV 162
           ID  +KK E + KD D   AK+  ++ +   D + LP  E+   EMA  K   + +N+ +
Sbjct: 130 IDEAIKKREHKKKDYDAAKAKVRRMIDKPAKDASKLPRAEK---EMALAKDIYENLNNQL 186

Query: 163 LLEYAMKLSKFTRVP---PTF 180
             E    +S   RVP   P+F
Sbjct: 187 KTELPQLVS--LRVPYFDPSF 205

>KAFR0D01810 Chr4 complement(364321..365442) [1122 bp, 373 aa] {ON}
           Anc_5.194 YGR187C
          Length = 373

 Score = 29.6 bits (65), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 39/135 (28%), Positives = 66/135 (48%), Gaps = 30/135 (22%)

Query: 17  LGAAQGASSTSLHSFTSFQP-QDASHV--EQNKL---HSVAIYEDLCQYEESLQRLVTSV 70
           +G + G +S SL  + +F P +D   +  E +K+    S+ I  +LC  + ++++++   
Sbjct: 28  IGFSTGPAS-SLFKYDNFTPVKDLKELAKENSKILVQQSITILVNLCD-DATMRKIIAD- 84

Query: 71  DKFQPDLEAAQELIE--IDSK---------LYSNLAQLPKYDLIDSQLKKLEEESKDIDE 119
                D E  + LI   ID K         L SNLA   K D I S    + E SKD+DE
Sbjct: 85  -----DTEFVKYLITKIIDLKNTNADVMCILLSNLA---KEDTITSVFDMVRESSKDLDE 136

Query: 120 R--TAKILGILGECY 132
              ++K++  L +C+
Sbjct: 137 VFGSSKLIDCLMDCF 151

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.311    0.128    0.350 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 28,525,895
Number of extensions: 1193779
Number of successful extensions: 4494
Number of sequences better than 10.0: 127
Number of HSP's gapped: 4662
Number of HSP's successfully gapped: 129
Length of query: 294
Length of database: 53,481,399
Length adjustment: 109
Effective length of query: 185
Effective length of database: 40,982,805
Effective search space: 7581818925
Effective search space used: 7581818925
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 65 (29.6 bits)