Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
AGR251C3.455ON1193119360690.0
Ecym_44043.455ON1196119541220.0
SAKL0F06886g3.455ON1183114729450.0
Kwal_55.204643.455ON1189118327400.0
KLTH0E05104g3.455ON1185114125910.0
NCAS0A116303.455ON1201114324850.0
Kpol_1050.883.455ON1213120924650.0
Smik_16.3713.455ON1208112224650.0
Skud_16.4123.455ON1208115624640.0
YPR122W (AXL1)3.455ON1208120224620.0
NDAI0A046503.455ON1199119724100.0
KLLA0D15631g3.455ON1170115523930.0
KAFR0A053703.455ON1201119723890.0
Suva_16.4513.455ON1218113223800.0
ZYRO0C06336g3.455ON1189118722600.0
TDEL0F034003.455ON1170115922470.0
TBLA0C054503.455ON1202121621690.0
KNAG0A077403.455ON1197113821490.0
TPHA0D040603.455ON1201115920320.0
CAGL0D04686g3.455ON1181114814321e-177
NCAS0J014704.246ON9959194251e-41
SAKL0H03124g4.246ON10069234232e-41
TPHA0B022604.246ON10419214232e-41
Kpol_1055.834.246ON10209164214e-41
TDEL0E012504.246ON9953734152e-40
CAGL0H06457g4.246ON10089024027e-39
TBLA0A080504.246ON9959323973e-38
Kwal_23.42374.246ON10013723948e-38
KLTH0D14278g4.246ON10013713832e-36
Ecym_32734.246ON10234213786e-36
Smik_12.4764.246ON10254463751e-35
KNAG0B060804.246ON9969113742e-35
KLLA0E05105g4.246ON10043703652e-34
Skud_12.4744.246ON10223703633e-34
KAFR0A059704.246ON10113723624e-34
NDAI0J022404.246ON9993703581e-33
TBLA0I029404.246ON9653713581e-33
Suva_10.5064.246ON10233713562e-33
YLR389C (STE23)4.246ON10273743553e-33
ZYRO0B12320g4.246ON9943643536e-33
AER053C4.246ON10133743501e-32
Skud_12.2308.376ON4622091202e-05
TPHA0C024508.376ON4692071165e-05
Kpol_1024.23singletonOFF4542281156e-05
Kpol_YGOB_1024.238.376ON4642281156e-05
YLR163C (MAS1)8.376ON4622091112e-04
Suva_10.2608.376ON4622091075e-04
CAGL0H02739g8.376ON4652091066e-04
NCAS0C029708.376ON4612061050.001
Smik_12.2258.376ON4622091050.001
KNAG0A027608.376ON4672231040.001
SAKL0H14168g8.376ON461208990.005
KLLA0D18095g8.376ON469208990.005
NDAI0G023208.376ON463206990.005
ZYRO0C03806g8.376ON465211990.006
KAFR0H020308.376ON462223970.008
Kwal_23.33458.376ON458219970.008
TDEL0F050008.376ON456211970.009
TBLA0H010108.376ON499206970.009
KLTH0F08954g8.376ON458207940.019
AGL138C8.376ON470209940.020
AFR334W3.93ON1029188860.22
YOL098C3.93ON1037207840.42
Ecym_41918.376ON462223781.7
KLLA0F03575g2.255ON103974782.1
Skud_4.2113.147ON44391762.4
NDAI0B055505.417ON112036772.7
CAGL0H07183g5.346ON49889763.0
KNAG0C014501.251ON1689140736.9
TBLA0A069405.541ON991122737.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AGR251C
         (1193 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AGR251C Chr7 complement(1213371..1216952) [3582 bp, 1193 aa] {ON...  2342   0.0  
Ecym_4404 Chr4 complement(840532..844122) [3591 bp, 1196 aa] {ON...  1592   0.0  
SAKL0F06886g Chr6 (524553..528104) [3552 bp, 1183 aa] {ON} simil...  1139   0.0  
Kwal_55.20464 s55 complement(414783..418352) [3570 bp, 1189 aa] ...  1060   0.0  
KLTH0E05104g Chr5 complement(449481..453038) [3558 bp, 1185 aa] ...  1002   0.0  
NCAS0A11630 Chr1 (2311038..2314643) [3606 bp, 1201 aa] {ON} Anc_...   961   0.0  
Kpol_1050.88 s1050 (199457..203098) [3642 bp, 1213 aa] {ON} (199...   954   0.0  
Smik_16.371 Chr16 (659341..662967) [3627 bp, 1208 aa] {ON} YPR12...   954   0.0  
Skud_16.412 Chr16 (741265..744891) [3627 bp, 1208 aa] {ON} YPR12...   953   0.0  
YPR122W Chr16 (782045..785671) [3627 bp, 1208 aa] {ON}  AXL1Hapl...   952   0.0  
NDAI0A04650 Chr1 complement(1046461..1050060) [3600 bp, 1199 aa]...   932   0.0  
KLLA0D15631g Chr4 (1319185..1322697) [3513 bp, 1170 aa] {ON} sim...   926   0.0  
KAFR0A05370 Chr1 (1059317..1062922) [3606 bp, 1201 aa] {ON} Anc_...   924   0.0  
Suva_16.451 Chr16 (784213..787869) [3657 bp, 1218 aa] {ON} YPR12...   921   0.0  
ZYRO0C06336g Chr3 (479075..482644) [3570 bp, 1189 aa] {ON} simil...   875   0.0  
TDEL0F03400 Chr6 (628126..631638) [3513 bp, 1170 aa] {ON} Anc_3....   870   0.0  
TBLA0C05450 Chr3 complement(1312984..1316592) [3609 bp, 1202 aa]...   840   0.0  
KNAG0A07740 Chr1 complement(1226949..1230542) [3594 bp, 1197 aa]...   832   0.0  
TPHA0D04060 Chr4 (867294..870899) [3606 bp, 1201 aa] {ON} Anc_3....   787   0.0  
CAGL0D04686g Chr4 (457938..461483) [3546 bp, 1181 aa] {ON} simil...   556   e-177
NCAS0J01470 Chr10 complement(261880..264867) [2988 bp, 995 aa] {...   168   1e-41
SAKL0H03124g Chr8 (291984..295004) [3021 bp, 1006 aa] {ON} simil...   167   2e-41
TPHA0B02260 Chr2 (517138..520263) [3126 bp, 1041 aa] {ON} Anc_4....   167   2e-41
Kpol_1055.83 s1055 (216511..219573) [3063 bp, 1020 aa] {ON} (216...   166   4e-41
TDEL0E01250 Chr5 (243919..246906) [2988 bp, 995 aa] {ON} Anc_4.2...   164   2e-40
CAGL0H06457g Chr8 (633721..636747) [3027 bp, 1008 aa] {ON} highl...   159   7e-39
TBLA0A08050 Chr1 (1988388..1991375) [2988 bp, 995 aa] {ON} Anc_4...   157   3e-38
Kwal_23.4237 s23 (630432..633437) [3006 bp, 1001 aa] {ON} YLR389...   156   8e-38
KLTH0D14278g Chr4 complement(1172523..1175528) [3006 bp, 1001 aa...   152   2e-36
Ecym_3273 Chr3 (515048..518119) [3072 bp, 1023 aa] {ON} similar ...   150   6e-36
Smik_12.476 Chr12 complement(838321..841398) [3078 bp, 1025 aa] ...   149   1e-35
KNAG0B06080 Chr2 complement(1197765..1200755) [2991 bp, 996 aa] ...   148   2e-35
KLLA0E05105g Chr5 (447645..450659) [3015 bp, 1004 aa] {ON} simil...   145   2e-34
Skud_12.474 Chr12 complement(839782..842850) [3069 bp, 1022 aa] ...   144   3e-34
KAFR0A05970 Chr1 (1206007..1209042) [3036 bp, 1011 aa] {ON} Anc_...   144   4e-34
NDAI0J02240 Chr10 complement(547488..550487) [3000 bp, 999 aa] {...   142   1e-33
TBLA0I02940 Chr9 complement(699857..702754) [2898 bp, 965 aa] {O...   142   1e-33
Suva_10.506 Chr10 complement(865239..868310) [3072 bp, 1023 aa] ...   141   2e-33
YLR389C Chr12 complement(899577..902660) [3084 bp, 1027 aa] {ON}...   141   3e-33
ZYRO0B12320g Chr2 complement(996046..999030) [2985 bp, 994 aa] {...   140   6e-33
AER053C Chr5 complement(735402..738443) [3042 bp, 1013 aa] {ON} ...   139   1e-32
Skud_12.230 Chr12 complement(438565..439953) [1389 bp, 462 aa] {...    51   2e-05
TPHA0C02450 Chr3 (545815..547224) [1410 bp, 469 aa] {ON} Anc_8.3...    49   5e-05
Kpol_1024.23 s1024 (68467..69831) [1365 bp, 454 aa] {OFF} (68467...    49   6e-05
Kpol_YGOB_1024.23 s1024 (68437..69831) [1395 bp, 464 aa] {ON} AN...    49   6e-05
YLR163C Chr12 complement(491866..493254) [1389 bp, 462 aa] {ON} ...    47   2e-04
Suva_10.260 Chr10 complement(463944..465332) [1389 bp, 462 aa] {...    46   5e-04
CAGL0H02739g Chr8 (248511..249908) [1398 bp, 465 aa] {ON} highly...    45   6e-04
NCAS0C02970 Chr3 (558478..559863) [1386 bp, 461 aa] {ON} Anc_8.376     45   0.001
Smik_12.225 Chr12 complement(439006..440394) [1389 bp, 462 aa] {...    45   0.001
KNAG0A02760 Chr1 (301136..302539) [1404 bp, 467 aa] {ON} Anc_8.3...    45   0.001
SAKL0H14168g Chr8 (1211470..1212855) [1386 bp, 461 aa] {ON} high...    43   0.005
KLLA0D18095g Chr4 complement(1526808..1528217) [1410 bp, 469 aa]...    43   0.005
NDAI0G02320 Chr7 (518661..520052) [1392 bp, 463 aa] {ON} Anc_8.3...    43   0.005
ZYRO0C03806g Chr3 complement(301873..303270) [1398 bp, 465 aa] {...    43   0.006
KAFR0H02030 Chr8 (374862..376250) [1389 bp, 462 aa] {ON} Anc_8.3...    42   0.008
Kwal_23.3345 s23 (253614..254990) [1377 bp, 458 aa] {ON} YLR163C...    42   0.008
TDEL0F05000 Chr6 complement(942516..943886) [1371 bp, 456 aa] {O...    42   0.009
TBLA0H01010 Chr8 (217060..218559) [1500 bp, 499 aa] {ON} Anc_8.3...    42   0.009
KLTH0F08954g Chr6 (770605..771981) [1377 bp, 458 aa] {ON} highly...    41   0.019
AGL138C Chr7 complement(453737..455149) [1413 bp, 470 aa] {ON} S...    41   0.020
AFR334W Chr6 (1043252..1046341) [3090 bp, 1029 aa] {ON} Syntenic...    38   0.22 
YOL098C Chr15 complement(132725..135838) [3114 bp, 1037 aa] {ON}...    37   0.42 
Ecym_4191 Chr4 (396094..397482) [1389 bp, 462 aa] {ON} similar t...    35   1.7  
KLLA0F03575g Chr6 (337386..340505) [3120 bp, 1039 aa] {ON} weakl...    35   2.1  
Skud_4.211 Chr4 complement(369208..370539) [1332 bp, 443 aa] {ON...    34   2.4  
NDAI0B05550 Chr2 complement(1357161..1360523) [3363 bp, 1120 aa]...    34   2.7  
CAGL0H07183g Chr8 complement(706436..707932) [1497 bp, 498 aa] {...    34   3.0  
KNAG0C01450 Chr3 (284898..289967) [5070 bp, 1689 aa] {ON} Anc_1....    33   6.9  
TBLA0A06940 Chr1 complement(1694417..1697392) [2976 bp, 991 aa] ...    33   7.5  

>AGR251C Chr7 complement(1213371..1216952) [3582 bp, 1193 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YPR122W
            (AXL1)
          Length = 1193

 Score = 2342 bits (6069), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1160/1193 (97%), Positives = 1160/1193 (97%)

Query: 1    MTLNTKPAVFDVKLYTPXXXXXXXXXXXXXXXXXXTFLISDPSETVASCAVSIATGSHND 60
            MTLNTKPAVFDVKLYTP                  TFLISDPSETVASCAVSIATGSHND
Sbjct: 1    MTLNTKPAVFDVKLYTPISSSNRSHRIIRLNNNLLTFLISDPSETVASCAVSIATGSHND 60

Query: 61   PVEIPGLAHFCEHMVLSSGSKRHPEPNAFHETLSKNNGSQNAHTSGEQTSFYFELPSSQS 120
            PVEIPGLAHFCEHMVLSSGSKRHPEPNAFHETLSKNNGSQNAHTSGEQTSFYFELPSSQS
Sbjct: 61   PVEIPGLAHFCEHMVLSSGSKRHPEPNAFHETLSKNNGSQNAHTSGEQTSFYFELPSSQS 120

Query: 121  SDSLVFDQVVGILADALKEPIFHDVLINKEIYAINSEHVGNKSSLTKMMYHAVRLLASPE 180
            SDSLVFDQVVGILADALKEPIFHDVLINKEIYAINSEHVGNKSSLTKMMYHAVRLLASPE
Sbjct: 121  SDSLVFDQVVGILADALKEPIFHDVLINKEIYAINSEHVGNKSSLTKMMYHAVRLLASPE 180

Query: 181  HPFHQFGTGNIFTLTNMPKLHKLSLKNELVKYFREHFFAENMVLCLRGPQSLNQLSKIAQ 240
            HPFHQFGTGNIFTLTNMPKLHKLSLKNELVKYFREHFFAENMVLCLRGPQSLNQLSKIAQ
Sbjct: 181  HPFHQFGTGNIFTLTNMPKLHKLSLKNELVKYFREHFFAENMVLCLRGPQSLNQLSKIAQ 240

Query: 241  ARFSDIPSIPTLQVPRLLRWRSSSSFDKNRNLSVRPLESFQILKDAWSARYAKKPVFDKT 300
            ARFSDIPSIPTLQVPRLLRWRSSSSFDKNRNLSVRPLESFQILKDAWSARYAKKPVFDKT
Sbjct: 241  ARFSDIPSIPTLQVPRLLRWRSSSSFDKNRNLSVRPLESFQILKDAWSARYAKKPVFDKT 300

Query: 301  PMHNSIMVQSSKSPVIRFVFPINYFSTRFTDRELATYTQIWCELLGDECEGSLCHYLRSH 360
            PMHNSIMVQSSKSPVIRFVFPINYFSTRFTDRELATYTQIWCELLGDECEGSLCHYLRSH
Sbjct: 301  PMHNSIMVQSSKSPVIRFVFPINYFSTRFTDRELATYTQIWCELLGDECEGSLCHYLRSH 360

Query: 361  SYITELIAYSSNFAVNDTGLILQLHLTNHGWLNVQKIIPIVWKYLIPAILDAPLSSLAQY 420
            SYITELIAYSSNFAVNDTGLILQLHLTNHGWLNVQKIIPIVWKYLIPAILDAPLSSLAQY
Sbjct: 361  SYITELIAYSSNFAVNDTGLILQLHLTNHGWLNVQKIIPIVWKYLIPAILDAPLSSLAQY 420

Query: 421  ISELNSLDLLKFLYQELERSPMDRCADLCESLLQDLSAIDLSFLLKSTLTYFECNNLSVA 480
            ISELNSLDLLKFLYQELERSPMDRCADLCESLLQDLSAIDLSFLLKSTLTYFECNNLSVA
Sbjct: 421  ISELNSLDLLKFLYQELERSPMDRCADLCESLLQDLSAIDLSFLLKSTLTYFECNNLSVA 480

Query: 481  NLGTYRENQTSKDWWRGEAVKFQAFVNEFMSQDTVRIILLGNLSKCYFNCNPDKITTDTY 540
            NLGTYRENQTSKDWWRGEAVKFQAFVNEFMSQDTVRIILLGNLSKCYFNCNPDKITTDTY
Sbjct: 481  NLGTYRENQTSKDWWRGEAVKFQAFVNEFMSQDTVRIILLGNLSKCYFNCNPDKITTDTY 540

Query: 541  FEYEYVKIFIDLEVLGCDDIHYRFTIPGPNPFMVPVGHKLSFIKHALLASSVQSENSALS 600
            FEYEYVKIFIDLEVLGCDDIHYRFTIPGPNPFMVPVGHKLSFIKHALLASSVQSENSALS
Sbjct: 541  FEYEYVKIFIDLEVLGCDDIHYRFTIPGPNPFMVPVGHKLSFIKHALLASSVQSENSALS 600

Query: 601  VVAQSDLVRASPRLAGKNSYYELWLKEEDVDLSFRSKSIFSMELISTSLEPAPEYTMHLE 660
            VVAQSDLVRASPRLAGKNSYYELWLKEEDVDLSFRSKSIFSMELISTSLEPAPEYTMHLE
Sbjct: 601  VVAQSDLVRASPRLAGKNSYYELWLKEEDVDLSFRSKSIFSMELISTSLEPAPEYTMHLE 660

Query: 661  ILGQLLYSILGPILYPAERAGYTYELSLSSKGDVRLGLTISGFTDGILNLLKIIVDAIVN 720
            ILGQLLYSILGPILYPAERAGYTYELSLSSKGDVRLGLTISGFTDGILNLLKIIVDAIVN
Sbjct: 661  ILGQLLYSILGPILYPAERAGYTYELSLSSKGDVRLGLTISGFTDGILNLLKIIVDAIVN 720

Query: 721  LSQDLNSIPKDIFRKARILVRTKYKEASSESCVTLASLGLLILLENCMWPLEDRLEALED 780
            LSQDLNSIPKDIFRKARILVRTKYKEASSESCVTLASLGLLILLENCMWPLEDRLEALED
Sbjct: 721  LSQDLNSIPKDIFRKARILVRTKYKEASSESCVTLASLGLLILLENCMWPLEDRLEALED 780

Query: 781  IYVESFRIFLEKFINGDNYLNILIQGSDMTIADNINEYLSERLTHHISRADDNVCRLSEP 840
            IYVESFRIFLEKFINGDNYLNILIQGSDMTIADNINEYLSERLTHHISRADDNVCRLSEP
Sbjct: 781  IYVESFRIFLEKFINGDNYLNILIQGSDMTIADNINEYLSERLTHHISRADDNVCRLSEP 840

Query: 841  ATYVIPEGSNLFFKRVGFHDDPNNSIVYFIQTGERDNNYIYTLTVLTEFIMSQTLVPDLR 900
            ATYVIPEGSNLFFKRVGFHDDPNNSIVYFIQTGERDNNYIYTLTVLTEFIMSQTLVPDLR
Sbjct: 841  ATYVIPEGSNLFFKRVGFHDDPNNSIVYFIQTGERDNNYIYTLTVLTEFIMSQTLVPDLR 900

Query: 901  QKKQIGYIVLGGLRVLSDTVGLHITTMAGSPPEFLEEKINEYLAYLEDMVLAKLTAPQFK 960
            QKKQIGYIVLGGLRVLSDTVGLHITTMAGSPPEFLEEKINEYLAYLEDMVLAKLTAPQFK
Sbjct: 901  QKKQIGYIVLGGLRVLSDTVGLHITTMAGSPPEFLEEKINEYLAYLEDMVLAKLTAPQFK 960

Query: 961  HDYVDELLSLLTSNSLGKLEKTSGPANLMSQIEANVHSGQRNTSLAMKSHKRLRTQISYR 1020
            HDYVDELLSLLTSNSLGKLEKTSGPANLMSQIEANVHSGQRNTSLAMKSHKRLRTQISYR
Sbjct: 961  HDYVDELLSLLTSNSLGKLEKTSGPANLMSQIEANVHSGQRNTSLAMKSHKRLRTQISYR 1020

Query: 1021 RYNFDEDDEPVDARTLQNLKLSEYMRFFRQRISIYSGKRAKLSIMVYSAMSKEEVQGKML 1080
            RYNFDEDDEPVDARTLQNLKLSEYMRFFRQRISIYSGKRAKLSIMVYSAMSKEEVQGKML
Sbjct: 1021 RYNFDEDDEPVDARTLQNLKLSEYMRFFRQRISIYSGKRAKLSIMVYSAMSKEEVQGKML 1080

Query: 1081 YLQIESFLKMKGFNIPSKDLNAIVQKSKGKPTALLKGLLSYFRSQGESLKLLSTVLREVV 1140
            YLQIESFLKMKGFNIPSKDLNAIVQKSKGKPTALLKGLLSYFRSQGESLKLLSTVLREVV
Sbjct: 1081 YLQIESFLKMKGFNIPSKDLNAIVQKSKGKPTALLKGLLSYFRSQGESLKLLSTVLREVV 1140

Query: 1141 KQLFSKAXXXXXXXXXXXXXXXLQAMSQHVTPAITLEQVPEVNSYRSNISSTL 1193
            KQLFSKA               LQAMSQHVTPAITLEQVPEVNSYRSNISSTL
Sbjct: 1141 KQLFSKATPDSSSSTPSGTHGSLQAMSQHVTPAITLEQVPEVNSYRSNISSTL 1193

>Ecym_4404 Chr4 complement(840532..844122) [3591 bp, 1196 aa] {ON}
            similar to Ashbya gossypii AGR251C
          Length = 1196

 Score = 1592 bits (4122), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 745/1195 (62%), Positives = 951/1195 (79%), Gaps = 9/1195 (0%)

Query: 1    MTLNTKPAVFDVKLYTPXXXXXXXXXXXXXXXXXXTFLISDPSETVASCAVSIATGSHND 60
            MTLN KP  FDV LYTP                    LISDPSET+ASCA+S+ATGSHND
Sbjct: 1    MTLNKKPVFFDVTLYTPISSSKRSHRIIQLSNNLLALLISDPSETIASCAISVATGSHND 60

Query: 61   PVEIPGLAHFCEHMVLSSGSKRHPEPNAFHETLSKNNGSQNAHTSGEQTSFYFELPSSQS 120
            P E+PGLAHFCEHMVLSSGSK++PEPN FHE+L++NNGS+NAHT+GEQTSFYFE+P + S
Sbjct: 61   PPELPGLAHFCEHMVLSSGSKKYPEPNFFHESLTRNNGSKNAHTTGEQTSFYFEVPHTTS 120

Query: 121  SDSLVFDQVVGILADALKEPIFHDVLINKEIYAINSEHVGNKSSLTKMMYHAVRLLASPE 180
            ++  VF+Q++ ILA + KEP+FHD+L+NKEIYAI+SEH+GNKS+L+KM+YHA RLLA+  
Sbjct: 121  AELHVFEQLIDILAASFKEPVFHDILVNKEIYAIHSEHMGNKSTLSKMLYHATRLLANEN 180

Query: 181  HPFHQFGTGNIFTLTNMPKLHKLSLKNELVKYFREHFFAENMVLCLRGPQSLNQLSKIAQ 240
            HPF  F TGN+FTLTNMP+++KL+LK EL+KYF+EHF AE MV+C+RG QSLNQLSK+AQ
Sbjct: 181  HPFSHFSTGNVFTLTNMPRVNKLNLKTELIKYFKEHFRAEKMVVCIRGSQSLNQLSKLAQ 240

Query: 241  ARFSDIPSI-----PTLQVPRLLRWRSSSSFDKNRNLS--VRPLESFQILKDAWSARYAK 293
             +F DIP       PT    +L  WRSS+S   + + S  +  L+  +ILKD W  RY+K
Sbjct: 241  LKFGDIPGSAAAGSPTSSPLKLKSWRSSNSITSSVDTSSTLASLDESRILKDTWLPRYSK 300

Query: 294  KPVFDKTPMHNSIMVQSSKSPVIRFVFPINYFSTRFTDRELATYTQIWCELLGDECEGSL 353
            +PVF   P +NS+M+QS K PVIRF+FP+NY STRFTD+E+ATYT+ WC+++GDE  GS 
Sbjct: 301  EPVFTPRPKYNSMMIQSKKPPVIRFIFPVNYLSTRFTDKEIATYTKAWCDIIGDEGYGSF 360

Query: 354  CHYLRSHSYITELIAYSSNFAVNDTGLILQLHLTNHGWLNVQKIIPIVWKYLIPAILDAP 413
            CH+LR ++YI++L+A+SS+FAVND GLILQLHLTN+GW NV  I+P+ WKY +  ILD  
Sbjct: 361  CHFLRQNNYISDLLAFSSSFAVNDDGLILQLHLTNYGWANVSIIVPLFWKYTVNTILDTS 420

Query: 414  LSSLAQYISELNSLDLLKFLYQELERSPMDRCADLCESLLQDLSAIDLSFLLKSTLTYFE 473
            LS + QY+SELNS+DLLKFLYQ++ERSPM+RCA+LC+ L+QDLS +   F+LK++   F+
Sbjct: 421  LSKIGQYLSELNSIDLLKFLYQDVERSPMERCAELCDQLMQDLSVVPPPFILKTSGLMFD 480

Query: 474  CNNLSVANLGTYRENQTSKDWWRGEAVKFQAFVNEFMSQDTVRIILLGNLSKCYFNCNPD 533
            CN+  +  +G+Y E+Q S DWWRG+A+KFQ FV EF + + V++I+LG LSKC F  N  
Sbjct: 481  CNDPRIQKIGSYSESQNSTDWWRGQAIKFQTFVKEFTTIENVKMIMLGPLSKCPFYSNSM 540

Query: 534  KITTDTYFEYEYVKIFIDLEVLGCDDIHYRFTIPGPNPFMVPVGHKLSFIKHALLASSVQ 593
            ++T DT++EY+Y+K +I++  L   D  Y F IP PN F+VPVGHKLS+IK ALLA+S Q
Sbjct: 541  QLTADTHYEYDYLKAYIEITELEAIDNEYEFHIPSPNQFLVPVGHKLSYIKKALLAASAQ 600

Query: 594  SENSALSVVAQSDLVRASPRLAGKNSYYELWLKEEDVDLSFRSKSIFSMELISTSLEPAP 653
            SENS+L +V QSDL++ +P LAGKN++YELW KEED++LSF+SKSI S+E+IST+L+PAP
Sbjct: 601  SENSSLFIVTQSDLLQTTPSLAGKNAFYELWTKEEDINLSFKSKSIVSLEVISTTLKPAP 660

Query: 654  EYTMHLEILGQLLYSILGPILYPAERAGYTYELSLSSKGDVRLGLTISGFTDGILNLLKI 713
            EYTM LEILGQLL+SI+ P+LYPAERAGYTYELSLSSKGDVRLG+T+SGFT+GI+ +L I
Sbjct: 661  EYTMQLEILGQLLFSIISPVLYPAERAGYTYELSLSSKGDVRLGITLSGFTEGIMGILNI 720

Query: 714  IVDAIVNLSQDLNSIPKDIFRKARILVRTKYKEASSESCVTLASLGLLILLENCMWPLED 773
            I+D+++ L +D   I K +FR+AR++VRTKY+EA+SE+C TLASLGLLI+LE CMW LED
Sbjct: 721  ILDSLLELGEDSVEISKGMFRRARVMVRTKYEEAASENCATLASLGLLIVLEGCMWTLED 780

Query: 774  RLEALEDIYVESFRIFLEKFINGDNYLNILIQGSDMTIADNINEYLSERLTHHISRADDN 833
            RL ALEDI +ESF  F++ FING NYLN+L+QGSD+++AD +N+ +  +LTHH+S  +  
Sbjct: 781  RLNALEDIDMESFVQFMKLFINGRNYLNLLVQGSDLSLADKVNDCVDAKLTHHMSSLETG 840

Query: 834  VCRLSEPATYVIPEGSNLFFKRVGFHDDPNNSIVYFIQTGERDNNYIYTLTVLTEFIMSQ 893
               L EP T+ IP GSNL  K+ G HDDPNNSIVYFIQTG RDNNY YTLTV TEF+MS 
Sbjct: 841  KNILVEPTTHFIPRGSNLCVKKSGSHDDPNNSIVYFIQTGTRDNNYAYTLTVFTEFLMSM 900

Query: 894  TLVPDLRQKKQIGYIVLGGLRVLSDTVGLHITTMAGSPPEFLEEKINEYLAYLEDMVLAK 953
            TLVPDLR KKQIGY+VLGGLRVLSDTVGLHITTM+ +PPE+LE+KI+EYL+YLE MVL K
Sbjct: 901  TLVPDLRGKKQIGYVVLGGLRVLSDTVGLHITTMSSNPPEYLEKKIDEYLSYLESMVLMK 960

Query: 954  LTAPQFKHDYVDELLSLLTSNSLGKLEKTSGPANLMSQIEANVHSGQRNTSLAMKSHKRL 1013
            L   QFK +Y+++ L L+ SNSL K+EKTSGPANLMSQIEANV SG +N S+AMKSHKR+
Sbjct: 961  LNNEQFKMNYLNKFLRLVESNSLSKIEKTSGPANLMSQIEANVRSGSQNGSMAMKSHKRI 1020

Query: 1014 RTQISYRRYNFDEDDEPVDARTLQNLKLSEYMRFFRQRISIYSGKRAKLSIMVYSAMSKE 1073
            R QISYRRYNF+E+DEP++A+T++NL L EYM FF ++IS+YS  RAK+S+MV S MSK+
Sbjct: 1021 RNQISYRRYNFEEEDEPINAKTIRNLTLREYMAFFHEKISVYSKSRAKMSVMVTSPMSKD 1080

Query: 1074 EVQGKMLYLQIESFLKMKGFNIPSKDLNAIVQKSKGKPTALLKGLLSYFRSQGESLKLLS 1133
            EVQ KM++LQIESFLKMKGFNIPS+DL +I+ KS GKPT LLK L SYFR +GES+KLL+
Sbjct: 1081 EVQSKMMFLQIESFLKMKGFNIPSEDLKSIIVKSGGKPTVLLKHLFSYFRVRGESIKLLT 1140

Query: 1134 TVLREVVKQLFSK--AXXXXXXXXXXXXXXXLQAMSQHVTPAITLEQVPEVNSYR 1186
             +++E+VKQ  +K                  LQAMSQ V PA+ L +V +VNSYR
Sbjct: 1141 AIVKEIVKQASNKPPGSAAKTSATPTGTSGTLQAMSQTVAPAVPLIEVTDVNSYR 1195

>SAKL0F06886g Chr6 (524553..528104) [3552 bp, 1183 aa] {ON} similar to
            uniprot|P40851 Saccharomyces cerevisiae YPR122W AXL1
            Haploid specific endoprotease that performs one of two
            N-terminal cleavages during maturation of a- factor
            mating pheromone required for axial budding pattern of
            haploid cells
          Length = 1183

 Score = 1139 bits (2945), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 565/1147 (49%), Positives = 792/1147 (69%), Gaps = 17/1147 (1%)

Query: 10   FDVKLYTPXXXXXXXXXXXXXXXXXXTFLISDPSETVASCAVSIATGSHNDPVEIPGLAH 69
            FDV+ YTP                    LIS+P+E   SCA+S+ATGSHNDP EI GLAH
Sbjct: 9    FDVQFYTPISCSSRSHRVIQLDNGMLVLLISNPAEKATSCALSVATGSHNDPKEILGLAH 68

Query: 70   FCEHMVLSSGSKRHPEPNAFHETLSKNNGSQNAHTSGEQTSFYFELPSSQSSDSLVFDQV 129
            FCEHM+LS+GSK +P+PNA+H+ +SKN GSQNA T+GEQT+F FELP+  +SD LVFD+V
Sbjct: 69   FCEHMILSAGSKSYPDPNAYHDVISKNGGSQNAFTTGEQTTFCFELPNLSNSDELVFDKV 128

Query: 130  VGILADALKEPIFHDVLINKEIYAINSEHVGNKSSLTKMMYHAVRLLASPEHPFHQFGTG 189
            + I + + K+P+F+++L+NKEIYAINSEH  NKSS  K+ YHA RLLA+ +HPF QF TG
Sbjct: 129  LDIFSSSFKKPLFNELLVNKEIYAINSEHTANKSSRDKIFYHATRLLANGDHPFSQFSTG 188

Query: 190  NIFTLTNMPKLHKLSLKNELVKYFREHFFAENMVLCLRGPQSLNQLSKIAQARFSDIPSI 249
            +I TL+++ +L+K+ L+ E++KYF+ +F+AENM LC++GPQSLN L K+  ++F+DI  +
Sbjct: 189  DITTLSDILQLNKVDLRTEVIKYFKNNFYAENMCLCIKGPQSLNTLGKLVFSKFNDIKGL 248

Query: 250  PTLQVPRLLRWRSSSSFD-KNRNLSVR----PLESFQILKDAWSARYAKKPVFDKTPMHN 304
            P   + R LR ++      K+RN S       LESF+IL   W  +Y    +F     HN
Sbjct: 249  P---ISRPLRTKNQPWLKLKSRNFSNDGFGLGLESFKILSRNWLQKYGNVGIFTGCDNHN 305

Query: 305  SIMVQSSKSPVIRFVFPINYFSTRFTDRELATYTQIWCELLGDECEGSLCHYLRSHSYIT 364
            +++V S K P +R +FPI++  TR T +E+   +Q WCEL GDE EGSLCH+++ + YIT
Sbjct: 306  TVLVDSQKLPALRLIFPIHHRLTRLTKKEIDLLSQCWCELFGDESEGSLCHFMKKNDYIT 365

Query: 365  ELIAYSSNFAVNDTGLILQLHLTNHGWLNVQKIIPIVWKYLIPAILDAPLSSLAQYISEL 424
            EL A+ S+FAVND  LIL+L+LTN GW N+Q I+ + +   +P +++     LA+++SEL
Sbjct: 366  ELTAFMSHFAVNDNALILELYLTNTGWKNLQMIVAVFFNKYVPIVIECGTYELAEFLSEL 425

Query: 425  NSLDLLKFLYQELERSPMDRCADLCESLLQDLSAIDLSFLLKSTLTYFECNNLSVANLGT 484
            N ++LLKFLYQ++  S M+ C++L   LL D+ ++  SF+LK      +CN +  + LG+
Sbjct: 426  NCIELLKFLYQDVTLSSMEECSNLSSLLLTDIESLGPSFILKGN-PMNDCNEID-SELGS 483

Query: 485  YRENQTSKDWWRGEAVKFQAFVNEFMSQDTVRIILLGNLSKCYF---NCNPDKITTDTYF 541
            + E++ S+ WW G A+KFQ+F+ EF++ + VR++L+G+L +C     +    K+  + Y+
Sbjct: 484  FAESEESRMWWIGHAIKFQSFIKEFINFENVRLVLMGDLKECPLMKTDLTSLKLNIEPYY 543

Query: 542  EYEYVKIFIDLE--VLGCDDIHYRFTIPGPNPFMVPVGHKLSFIKHALLASSVQSENSAL 599
            E+EY K   D     L  ++I Y F IP  N F+  VG  LS IK+ALLASS +S+ +AL
Sbjct: 544  EFEYHKCRSDQSNFKLTVEEISYSFHIPYKNVFLPSVGFNLSLIKNALLASSNRSQTAAL 603

Query: 600  SVVAQSDLVRASPRLAGKNSYYELWLKEEDVDLSFRSKSIFSMELISTSLEPAPEYTMHL 659
            S+ +Q+      P+L GKN +YE+W+KEED +L+F+SKSI + E+IST L P P YTM L
Sbjct: 604  SLGSQNANPHVLPKLLGKNCFYEMWVKEEDFELTFKSKSIVTFEIISTHLNPEPSYTMML 663

Query: 660  EILGQLLYSILGPILYPAERAGYTYELSLSSKGDVRLGLTISGFTDGILNLLKIIVDAIV 719
            EIL +LL  +L   LYP+E+ GYTYE++ SSKGDVR+G T+SGF++G+  +++ IV  +V
Sbjct: 664  EILCELLGDMLSSQLYPSEKIGYTYEIAASSKGDVRIGFTVSGFSEGVYKIIEKIVGTLV 723

Query: 720  NLSQDLNSIPKDIFRKARILVRTKYKEASSESCVTLASLGLLILLENCMWPLEDRLEALE 779
             +      I +D+FRK+RI VR KY+EA+S +  TL ++GLLI+LE  MW LE RLEALE
Sbjct: 724  QIVYSEVVIARDLFRKSRIAVRNKYEEAASVNSTTLVNIGLLIVLEKYMWRLESRLEALE 783

Query: 780  DIYVESFRIFLEKFINGDNYLNILIQGSDMTIADNINEYLSERLTHHISRADDNVCRLSE 839
               +ESF+ FL  F     Y+N+ IQG D T  D IN +L   LT H+S+  D V  L+E
Sbjct: 784  STDMESFKQFLSDFFGNSTYMNLFIQG-DQTYTDQINIFLDRNLTGHLSKKRDAVKILNE 842

Query: 840  PATYVIPEGSNLFFKRVGFHDDPNNSIVYFIQTGERDNNYIYTLTVLTEFIMSQTLVPDL 899
            P + ++  GSNLF    GF DDPNNSIVYFIQTG+R +NY YTLT  T F++S TLVPDL
Sbjct: 843  PTSTILKPGSNLFITHKGFKDDPNNSIVYFIQTGDRTDNYSYTLTAFTAFLISLTLVPDL 902

Query: 900  RQKKQIGYIVLGGLRVLSDTVGLHITTMAGSPPEFLEEKINEYLAYLEDMVLAKLTAPQF 959
            R +KQ+GYIVLGGLR LS TVGLHIT  + SPP FLEEKI EYL+YLE  +L  L    F
Sbjct: 903  RGRKQVGYIVLGGLRTLSSTVGLHITITSSSPPHFLEEKIGEYLSYLEKDLLDNLKPQLF 962

Query: 960  KHDYVDELLSLLTSNSLGKLEKTSGPANLMSQIEANVHSGQRN-TSLAMKSHKRLRTQIS 1018
            +  YV E L+++ S  + K E+   P NLMS+I+ANV SG  +     MKSH+R+R QIS
Sbjct: 963  REKYVKEYLNVILSGKMEKTERELAPVNLMSRIKANVRSGNLDRVGRTMKSHRRIRAQIS 1022

Query: 1019 YRRYNFDEDDEPVDARTLQNLKLSEYMRFFRQRISIYSGKRAKLSIMVYSAMSKEEVQGK 1078
             +RYNF+++DEP+D + +++L    YM+FF+Q+ISIYS  R+K+S+MV S MS+ E+  +
Sbjct: 1023 SKRYNFEDEDEPIDLQLIESLDFVHYMQFFKQKISIYSSLRSKISVMVSSPMSRSEIYNR 1082

Query: 1079 MLYLQIESFLKMKGFNIPSKDLNAIVQKSKGKPTALLKGLLSYFRSQGESLKLLSTVLRE 1138
             ++LQ+ESFLK+KGF I  + L  IV+KS GKPT L+K L  YF S+GESLK+ + +L+E
Sbjct: 1083 KVFLQLESFLKLKGFKISGEQLQKIVRKSDGKPTVLMKELFRYFASRGESLKICTVMLKE 1142

Query: 1139 VVKQLFS 1145
            + +QL S
Sbjct: 1143 ITRQLSS 1149

>Kwal_55.20464 s55 complement(414783..418352) [3570 bp, 1189 aa] {ON}
            YPR122W (AXL1) - putative homolog of human
            insulin-degrading endoprotease [contig 148] FULL
          Length = 1189

 Score = 1060 bits (2740), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 546/1183 (46%), Positives = 769/1183 (65%), Gaps = 19/1183 (1%)

Query: 10   FDVKLYTPXXXXXXXXXXXXXXXXXXTFLISDPSETVASCAVSIATGSHNDPVEIPGLAH 69
            FD+  YTP                   FLISDPS+TV SC+VS+ATGSHNDP E  GLAH
Sbjct: 9    FDLVFYTPISGSSRGSKLCQLSNGMLVFLISDPSDTVGSCSVSVATGSHNDPDEALGLAH 68

Query: 70   FCEHMVLSSGSKRHPEPNAFHETLSKNNGSQNAHTSGEQTSFYFELPSSQSSDSLVFDQV 129
             CEH +LS GSK++P  N +HE L++N GS NA+T+GE T+FYFELP+   S  L FD+ 
Sbjct: 69   LCEHAILSGGSKKYPGANYYHEVLAQNGGSHNAYTTGETTTFYFELPAISDSGELHFDKA 128

Query: 130  VGILADALKEPIFHDVLINKEIYAINSEHVGNKSSLTKMMYHAVRLLASPEHPFHQFGTG 189
            + +LA +LK P+F D+LINKEIYAI SEH  NK+ + K +YHA RLLA+P HPF +F TG
Sbjct: 129  LDVLASSLKAPLFSDILINKEIYAIESEHNINKALVGKQLYHASRLLANPSHPFSRFCTG 188

Query: 190  NIFTLTNMPKLHKLSLKNELVKYFREHFFAENMVLCLRGPQSLNQLSKIAQARFSDIPSI 249
            N  TL  +P L+K ++K  L  + + ++   NM LCLRG QSLN L+K+A   F D+P+ 
Sbjct: 189  NFTTLCTLPSLNKFNIKAALTSFHKRYYKTSNMSLCLRGSQSLNTLTKLAIRFFGDLPA- 247

Query: 250  PTLQVPRLLRWRSSSSFDKNRNLSVRPLESFQILKDAWSARYAKKPVFDKTPMHNSIMVQ 309
                   + R  SSS F         P   F+ILK  W+ +Y     F +    N + +Q
Sbjct: 248  ---SGQNIARPSSSSLFSNKGTAQSMPY--FKILKYEWTPKYKDVRAFSQGS-SNVVAIQ 301

Query: 310  SSKSPVIRFVFPINYFSTRFTDRELATYTQIWCELLGDECEGSLCHYLRSHSYITELIAY 369
            SSK PV+R +FP+++ STR +  ++ T++  WC+  GDE  GSL   L+    I+ +++ 
Sbjct: 302  SSKCPVLRLIFPVSHKSTRLSSSDITTFSSTWCDFFGDESVGSLADCLKGCGLISGIVSS 361

Query: 370  SSNFAVNDTGLILQLHLTNHGWLNVQKIIPIVWKYLIPAILDAPLSSLAQYISELNSLDL 429
             S+FA  + GL L+L LT HGW N+  I+ I++   IP ++      +A+ +SELN+++L
Sbjct: 362  VSHFATEEDGLTLELTLTQHGWKNIPTIMCILFDDYIPKLIHDKTEDIARCLSELNAIEL 421

Query: 430  LKFLYQELERSPMDRCADLCESLLQDLSAIDLSFLLKSTLTYFECNNLSVANLGTYRENQ 489
            LKFLYQ  E+SPMD CA+L   LL DL  +D   LLK +    ECN    + +G Y EN 
Sbjct: 422  LKFLYQSTEKSPMDMCANLSAYLLLDLETLDPKCLLKGS-PLIECNQ-EHSRIGDYSENT 479

Query: 490  TSKDWWRGEAVKFQAFVNEFMSQDTVRIILLGNLSKCYFNCNPDKIT-TDTYFEYEYVKI 548
             S+ WW G A+KFQ  V+EF+++  +R ++LG+ SK  F  +    T TD Y+E++Y   
Sbjct: 480  ESQTWWIGRAIKFQNLVSEFVNRQNLRAVMLGDQSKSNFLASVRSTTKTDAYYEFDYRIA 539

Query: 549  FIDLEVLGCDDI---HYRFTIPGPNPFMVPVGHKLSFIKHALLASSVQSENSALSVVAQS 605
            ++D+  +  DD    +Y F  P  + F+  V  KLS IK AL  SS ++++++L ++ +S
Sbjct: 540  YVDMLSIQLDDYTAPNYHFHAPSYDTFLPMVARKLSLIKQALQVSSTRAQSASLHLIPRS 599

Query: 606  DLVRASPRLAGKNSYYELWLKEEDVDLSFRSKSIFSMELISTSLEPAPEYTMHLEILGQL 665
            D ++  PRLAGKNS YE+W+KEE++DLSF SKSI S E+IS S+  +P+ TM+LEILGQL
Sbjct: 600  DFLQTPPRLAGKNSNYEVWVKEEELDLSFSSKSIVSFEIISKSVCASPKNTMYLEILGQL 659

Query: 666  LYSILGPILYPAERAGYTYELSLSSKGDVRLGLTISGFTDGILNLLKIIVDAIVNLSQDL 725
            L   L   LYP+E+ GYTYE+S SSKGDVRLGLT+SGF +G+ NL+KIIV+ I + S   
Sbjct: 660  LAGTLSATLYPSEKLGYTYEISPSSKGDVRLGLTVSGFPEGVYNLIKIIVEEIKSFSSR- 718

Query: 726  NSIPKDIFRKARILVRTKYKEASSESCVTLASLGLLILLENCMWPLEDRLEALEDIYVES 785
            + I   +FR+ARI VR+KY+EA++ +C  LASLGLLI+LE CMWP+EDRLEALE+I  E+
Sbjct: 719  DIISSKVFREARIAVRSKYEEAAAANCTALASLGLLIILEECMWPIEDRLEALEEISQET 778

Query: 786  FRIFLEKFINGDNYLNILIQGSDMTIADNINEYLSERLTHHISRADDNVCRLSEPATYVI 845
            F +F   F+    Y+N+ IQG DM+  + IN +L   LT H+    +    + EP   ++
Sbjct: 779  FTMFCSHFLTSPTYMNLFIQG-DMSCMEKINSFLKWSLTSHLEDTREYQGPVREPGAKIL 837

Query: 846  PEGSNLFFKRVGFHDDPNNSIVYFIQTGERDNNYIYTLTVLTEFIMSQTLVPDLRQKKQI 905
              G+N+F KR  F DDPNNSIVYFIQTGER++   YT T L EF +S TLVPDLR KKQI
Sbjct: 838  KAGTNIFVKRNAFSDDPNNSIVYFIQTGEREDARAYTYTCLAEFFLSLTLVPDLRNKKQI 897

Query: 906  GYIVLGGLRVLSDTVGLHITTMAGSPPEFLEEKINEYLAYLEDMVLAKLTAPQFKHDYVD 965
            GY V GGLR+LS ++GLHIT M+ SPPE LE +I EYL+YLE  +L  +T  +F+  Y+ 
Sbjct: 898  GYAVFGGLRLLSTSIGLHITCMSNSPPEHLEVQIEEYLSYLEKCLLDTMTEEEFQEHYIR 957

Query: 966  ELLSLLTSNSLGKLEKTSGPANLMSQIEANVHSGQ-RNTSLAMKSHKRLRTQISYRRYNF 1024
            +   ++ +N + +++KT+GPA+LM QIEANV SG       AM+ HK  + QIS RRYNF
Sbjct: 958  KYRVMVENNQVNRMQKTAGPADLMGQIEANVRSGNLEEQGSAMRLHKNTKNQISNRRYNF 1017

Query: 1025 DEDDEPVDARTLQNLKLSEYMRFFRQRISIYSGKRAKLSIMVYSAMSKEEVQGKMLYLQI 1084
              ++EPV+   L+ + LSE+  FF ++ISIYS KR+KLS+M+ S M+ EE+  K L+LQ+
Sbjct: 1018 GMEEEPVNRDILRTITLSEFRSFFSEKISIYSLKRSKLSVMIASPMTAEEISQKRLFLQV 1077

Query: 1085 ESFLKMKGFNIPSKDLNAIVQKSKGKPTALLKGLLSYFRSQGESLKLLSTVLREVVKQLF 1144
            ESFLK+KG  I S DL+ I++ S G+ + +L+GL  YF + GE++KL + +++E+ K L 
Sbjct: 1078 ESFLKLKGLKISSSDLHDIIETSLGRTSGILRGLFRYFSANGETMKLCNVIIKEISKAL- 1136

Query: 1145 SKAXXXXXXXXXXXXXXXLQAMSQHVTPAITLEQVPEVNSYRS 1187
                              L+ +S+ VT A+ L ++ +VN +R+
Sbjct: 1137 --VLSLKNPSQRTRVDDALRGLSKIVTSALPLTEIKDVNQFRN 1177

>KLTH0E05104g Chr5 complement(449481..453038) [3558 bp, 1185 aa] {ON}
            similar to uniprot|P40851 Saccharomyces cerevisiae
            YPR122W AXL1 Haploid specific endoprotease that performs
            one of two N-terminal cleavages during maturation of a-
            factor mating pheromone required for axial budding
            pattern of haploid cells
          Length = 1185

 Score = 1002 bits (2591), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 523/1141 (45%), Positives = 746/1141 (65%), Gaps = 19/1141 (1%)

Query: 10   FDVKLYTPXXXXXXXXXXXXXXXXXXTFLISDPSETVASCAVSIATGSHNDPVEIPGLAH 69
            FDV  YTP                    LISDP++T  S +VS+A+GSH DP E+ GLAH
Sbjct: 11   FDVAFYTPISSSNKGVELCRLANGILVLLISDPADTSVSSSVSVASGSHADPDEVLGLAH 70

Query: 70   FCEHMVLSSGSKRHPEPNAFHETLSKNNGSQNAHTSGEQTSFYFELPSSQSSDSLVFDQV 129
             CEH +LS+GSK+ P  + +HE +++N GS NA+T+GE T+FYFELP+S  S  L+FD+V
Sbjct: 71   LCEHTILSAGSKKFPRSSHYHEIVAQNGGSHNAYTTGENTTFYFELPASNDSGELLFDKV 130

Query: 130  VGILADALKEPIFHDVLINKEIYAINSEHVGNKSSLTKMMYHAVRLLASPEHPFHQFGTG 189
            +  LA + K P+F D  INKEIYAI SEH  NK+S  K +YHA RLLA+P HPF +F TG
Sbjct: 131  LDTLASSFKNPVFSDSSINKEIYAIESEHNVNKASTPKQLYHATRLLANPRHPFSRFCTG 190

Query: 190  NIFTLTNMPKLHKLSLKNELVKYFREHFFAENMVLCLRGPQSLNQLSKIAQARFSDIPSI 249
            N  TL + P LHK+++K  L +YF+ ++ A  M LCLRGPQSLN L+K+A+  F D+P+ 
Sbjct: 191  NFATLCDEPNLHKVNVKATLCQYFKTNYDATRMALCLRGPQSLNALAKLAKKYFGDLPAS 250

Query: 250  PTLQVPRLLRWRSSSSFDKNRNLSVRPLESFQILKDAWSARYAKKPVFDKTPMHNSIMVQ 309
                  R    +  SS   +++L VRPL+ F+  K     + A  P        N + +Q
Sbjct: 251  RDRDPTRPPLKKRPSSGVASQDLHVRPLD-FKNSKQQTQVQDAFVP-----DTSNLVAIQ 304

Query: 310  SSKSPVIRFVFPINYFSTRFTDRELATYTQIWCELLGDECEGSLCHYLRSHSYITELIAY 369
            SSK+PV+R VFP+++ STR T  ++   ++ WC+  GDE  GSL H L++++ I  ++A 
Sbjct: 305  SSKNPVLRLVFPVSHKSTRLTSNDIVALSENWCDFFGDEGVGSLTHCLKTNNLINGVVAS 364

Query: 370  SSNFAVNDTGLILQLHLTNHGWLNVQKIIPIVWKYLIPAILDAPLSSLAQYISELNSLDL 429
             ++F+  + GL L+  LTN GW + Q II +++   IP ++      +A+ +SELN  DL
Sbjct: 365  VAHFSAGNDGLTLEFTLTNLGWSSAQLIITVLFDLFIPRLIHDKTKDIAKCLSELNCTDL 424

Query: 430  LKFLYQELERSPMDRCADLCESLLQDLSAIDLSFLLKSTLTYFECNNLSVANLGTYRENQ 489
            L FLYQ  E+S M+ CA L   LL     +D   LLK +    ECN    A +G Y E+ 
Sbjct: 425  LTFLYQGAEKSSMEMCAVLSSRLLSVFETLDPKCLLKGS-PLIECNQNPSA-IGDYSEST 482

Query: 490  TSKDWWRGEAVKFQAFVNEFMSQDTVRIILLGNLSKCYFNCNPDKIT-TDTYFEYEYVKI 548
             S+ WW G A+KFQ FV+EF+++  +RI++LGN  K     +   ++ TD Y+E+ Y   
Sbjct: 483  ESRTWWIGRAIKFQNFVSEFVNRQNLRIVMLGNCPKSDLLSSVTSVSKTDAYYEFTYQIS 542

Query: 549  FIDLEVLGCDDIHYR-----FTIPGPNPFMVPVGHKLSFIKHALLASSVQSENSALSVVA 603
             ID+  L   +  YR     F +P  + F+  VG KL  IK AL ASS +S+ S L+VVA
Sbjct: 543  KIDM--LSVREELYRIPGFSFRVPCYDMFLPTVGRKLGLIKQALQASSNRSQTSLLTVVA 600

Query: 604  QSDLVRASPRLAGKNSYYELWLKEEDVDLSFRSKSIFSMELISTSLEPAPEYTMHLEILG 663
            ++  ++  PRLAGKNS +ELW+KEED DLSF+SKSI S+E+ S ++E  P YTM LE+L 
Sbjct: 601  RNAYLQTIPRLAGKNSNHELWVKEEDSDLSFKSKSIISIEVASKTIEACPSYTMCLEVLA 660

Query: 664  QLLYSILGPILYPAERAGYTYELSLSSKGDVRLGLTISGFTDGILNLLKIIVDAIVNLSQ 723
            QLL   L  +LYP+E+ GYTYE+S S+KG  RL  TISGF +G+  ++++I+D   +L  
Sbjct: 661  QLLGDSLSTVLYPSEKLGYTYEISPSAKGHARLSFTISGFPEGVCAMVRVIIDQTKSLIN 720

Query: 724  DLNSIPKDIFRKARILVRTKYKEASSESCVTLASLGLLILLENCMWPLEDRLEALEDIYV 783
              +++   +FRKAR+ VR KY+EA+S +  TLA+LGLLI+LE CMWP+EDRL+ALE+I +
Sbjct: 721  S-DTVTPAMFRKARVAVRNKYEEAASANSTTLATLGLLIVLEECMWPVEDRLDALEEIDI 779

Query: 784  ESFRIFLEKFINGDNYLNILIQGSDMTIADNINEYLSERLTHHISRADDNVCRLSEPATY 843
            ESFR F   FI+   YLN+  QG D++  + I+ +L   LT H+SR   +   + EP T+
Sbjct: 780  ESFRTFCSGFISKPTYLNVFSQG-DLSYTEEISTFLDSGLTSHLSRRTWHEPAVREPVTH 838

Query: 844  VIPEGSNLFFKRVGFHDDPNNSIVYFIQTGERDNNYIYTLTVLTEFIMSQTLVPDLRQKK 903
             +  G+N+F +R  F +DP++SIVYFIQTG+RD+  + +LT LTEF+MS TLVPDLR KK
Sbjct: 839  ALKPGTNMFIRRSAFVEDPSSSIVYFIQTGDRDDAQMLSLTCLTEFLMSMTLVPDLRTKK 898

Query: 904  QIGYIVLGGLRVLSDTVGLHITTMAGSPPEFLEEKINEYLAYLEDMVLAKLTAPQFKHDY 963
            QIGY V  GLR+LS T+GLHIT M+ SPPE LE +I++YLAY+E  VL+ ++  +F+  Y
Sbjct: 899  QIGYAVFSGLRLLSTTMGLHITCMSSSPPEHLESQIDQYLAYMEHDVLSAMSEEEFQERY 958

Query: 964  VDELLSLLTSNSLGKLEKTSGPANLMSQIEANVHSGQ-RNTSLAMKSHKRLRTQISYRRY 1022
            + +  ++    ++      +GPA+L++QIEANVHSG       AM+ HKR+R QIS  RY
Sbjct: 959  IRKFRAMFERENVTSTSDAAGPADLLAQIEANVHSGNLPEQGAAMRQHKRIRNQISIHRY 1018

Query: 1023 NFDEDDEPVDARTLQNLKLSEYMRFFRQRISIYSGKRAKLSIMVYSAMSKEEVQGKMLYL 1082
            NF  D EP D   L+ L L ++ RFF+++ISI S  R+KLS+MV S +S +E+  K L+L
Sbjct: 1019 NFTSDLEPADLGLLRALTLGQFRRFFQEKISICSTTRSKLSVMVASPVSADEIAEKRLFL 1078

Query: 1083 QIESFLKMKGFNIPSKDLNAIVQKSKGKPTALLKGLLSYFRSQGESLKLLSTVLREVVKQ 1142
            QIES+LK+KG  IPS +L AIV+ S+GKP+ L++GL  +F ++GE+L+L + +L+E+ K 
Sbjct: 1079 QIESYLKLKGLKIPSSELRAIVESSQGKPSTLMRGLFKFFLARGETLRLCNVILKELSKA 1138

Query: 1143 L 1143
            +
Sbjct: 1139 V 1139

>NCAS0A11630 Chr1 (2311038..2314643) [3606 bp, 1201 aa] {ON} Anc_3.455
            YPR122W
          Length = 1201

 Score =  961 bits (2485), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 500/1143 (43%), Positives = 746/1143 (65%), Gaps = 17/1143 (1%)

Query: 10   FDVKLYTPXXXXXXXXXXXXXXXXXXTFLISDPSETVASCAVSIATGSHNDPVEIPGLAH 69
            FDV LY P                  T LISDP++TV SC++S+A+GSHNDP +I GLAH
Sbjct: 9    FDVPLYLPLAYSNRVHKLCLLPNGLLTLLISDPADTVTSCSLSVASGSHNDPKDIQGLAH 68

Query: 70   FCEHMVLSSGSKRHPEPNAFHETLSKNNGSQNAHTSGEQTSFYFELPSSQSSDSLVFDQV 129
             CEHM+L++GSK +P+P  +HETLSKNNG  NA T+GEQT+FYFE+P+      LVFD++
Sbjct: 69   LCEHMILAAGSKSYPDPGLYHETLSKNNGVHNAFTTGEQTTFYFEVPNVHHGGELVFDEI 128

Query: 130  VGILADALKEPIFHDVLINKEIYAINSEHVGNKSSLTKMMYHAVRLLASPEHPFHQFGTG 189
            + I A   KEP+F+ +L NKEIYAI SEH GN SS+TK++YHA R+L+ P HPF QF TG
Sbjct: 129  LDIFASFFKEPLFNPLLTNKEIYAIQSEHDGNMSSVTKILYHATRMLSDPGHPFSQFSTG 188

Query: 190  NIFTLTNMPKLHKLSLKNELVKYFREHFFAENMVLCLRGPQSLNQLSKIAQARFSDIPSI 249
            N+ TL ++PKL  ++L+  L +YF+++++A  M LCLRGPQS+N L+K A ++F DI   
Sbjct: 189  NMNTLASIPKLQGVNLQRTLFQYFKKNYYASKMTLCLRGPQSVNILTKYALSKFGDIKEN 248

Query: 250  PTLQVPRL----LRWRSSSSFDKNRNLSVR-PLESFQILKDAWSARYAKKPVFDKTPMHN 304
              L   R           SS     N S +  LESF IL+++W  +Y   P F +    N
Sbjct: 249  TALTRSRFGSMSSISTKRSSKSSTENHSTKNDLESFNILEESWRQKYCDIPCFPEISKEN 308

Query: 305  SIMVQSSKSPVIRFVFPINYFSTRFTDRELATYTQIWCELLGDECEGSLCHYLRSHSYIT 364
             I ++SSK P +R +FP+    TRFT  E+  +  +WCEL GDE +GSLC+YL   S+IT
Sbjct: 309  MIFIKSSKQPTLRILFPVTDNKTRFTKGEIKIFGDLWCELFGDETKGSLCYYLVGKSWIT 368

Query: 365  ELIAYSSNFAVNDTGLILQLHLTNHGWLNVQKIIPIVWKYLIPAILDAPLSSLAQYISEL 424
               AY+S+FA+ + GLI++L LT+ GW N   II IV   L+    +  +  LA ++ + 
Sbjct: 369  SCYAYTSSFALGNIGLIIELTLTSTGWENSDTIIEIVLGKLVETFSEQYVHELANFMEDQ 428

Query: 425  NSLDLLKFLYQELERSPMDRCADLCESLLQDLSAIDLSFLLKSTLTYFECNNLSVANLGT 484
            NS+DL++FLYQ  +++PM+ C++L E L  DL A +++++ K +    + +  +V  + +
Sbjct: 429  NSIDLIRFLYQVPKKNPMEECSNLSELLQNDLKAPNMAYIFKGSPPITDMHEGNVGGINS 488

Query: 485  YRENQTSKDWWRGEAVKFQAFVNEFMSQDTVRIILLGNLSKC---YFNCNPDKITTDTYF 541
                + +++WW  +A+KFQ+F+ +FM+    R+ILLG+L +    +     + +TT+ ++
Sbjct: 489  ----EHNQEWWIDQAIKFQSFMKKFMNSSNARVILLGSLERIPELFKKEIQNTLTTEPFY 544

Query: 542  EYEYVKIFIDLEVLGCDDIHYRFTIPGPNPFMVPVGHKLSFIKHALLASSVQSENSALSV 601
            E+EY    I+L+     +  Y F IP  N F+         ++   L SS++S+ S L +
Sbjct: 545  EFEYKISTINLKASQSVNT-YEFCIPHKNKFIPSACKGDGVLEQLFLESSLKSQYSNLHL 603

Query: 602  VAQSDLVRASPRLAGKNSYYELWLKEEDVDLSFRSKSIFSMELISTSLEPAPEYTMHLEI 661
               S      P+L G+N  YE+W  +ED++     KSI S E++ST ++ +PE T+HLEI
Sbjct: 604  QINSMSFENKPQLVGRNQRYEMWTLKEDLNSIMDLKSIVSFEVLSTDMKGSPENTIHLEI 663

Query: 662  LGQLLYSILGPILYPAERAGYTYELSLSSKGDVRLGLTISGFTDGILNLLKIIVDAIVNL 721
            L Q++++++ P LYPA + GY YE+S SSKGDV+L  TI GF++GIL L++II+  I+ +
Sbjct: 664  LNQIIFTLISPQLYPAIKLGYFYEISASSKGDVQLRFTIGGFSEGILMLIEIIIKTIIFI 723

Query: 722  SQDLNSIPKDIFRKARILVRTKYKEASSESCVTLASLGLLILLENCMWPLEDRLEALEDI 781
            +   +   K++ R+AR+LVR+ Y+ A++++CV LASLGLLI+LE  MW LEDR++ALED+
Sbjct: 724  TTTPDFPSKELLRRARVLVRSNYENAAADNCVKLASLGLLIVLEENMWSLEDRIDALEDV 783

Query: 782  YVESFRIFLEKFINGDNYLNILIQGSDMTIADNINEYLSERLTHHISRADDNVCRL-SEP 840
             + SF+ F + F+NG  YL + IQG +++ AD IN++L+   T H+    D    L +  
Sbjct: 784  TMASFKEFCQSFLNGSKYLTLFIQG-NLSYADKINQFLNLNFTKHLDINKDTSLPLNAHT 842

Query: 841  ATYVIPEGSNLFFKRVGFHDDPNNSIVYFIQTGERDNNYIYTLTVLTEFIMSQTLVPDLR 900
            +T+++  G+N+F +  G  DDPNNSIVYFIQTG R +  + TLT  TE+IMS TLVP+LR
Sbjct: 843  STHILKPGTNIFAEYPGPLDDPNNSIVYFIQTGLRSDTDLCTLTSFTEYIMSLTLVPELR 902

Query: 901  QKKQIGYIVLGGLRVLSDTVGLHITTMAGSPPEFLEEKINEYLAYLEDMVLAKLTAPQFK 960
             KKQIGY+V+GGLRVL+DT+G++IT M+GS P  LE KI+EY+A++E+ VL +LT   F+
Sbjct: 903  NKKQIGYLVMGGLRVLTDTIGVYITVMSGSEPIDLESKIDEYIAFIENGVLNRLTEATFE 962

Query: 961  HDYVDELLSLLTSNSLGKLEKTSGPANLMSQIEANVHSGQRN--TSLAMKSHKRLRTQIS 1018
             +Y    L+LL  N+  K  K SGPANL+++I  NV  G  +   S +MK H+R R QIS
Sbjct: 963  REYKQAYLTLLGDNNQNKGGKLSGPANLLNEIVPNVQVGSSDQLNSTSMKLHRRFRNQIS 1022

Query: 1019 YRRYNFDEDDEPVDARTLQNLKLSEYMRFFRQRISIYSGKRAKLSIMVYSAMSKEEVQGK 1078
             ++YNF +++  +D   ++ L LS Y+ FF+ +ISI+S  R+KLSIM+ S+M+ +++  +
Sbjct: 1023 DKQYNFTDEELHIDIPLIEKLTLSSYLNFFKDKISIFSPTRSKLSIMITSSMAAKDIINR 1082

Query: 1079 MLYLQIESFLKMKGFNIPSKDLNAIVQKSKGKPTALLKGLLSYFRSQGESLKLLSTVLRE 1138
              YLQ+E+FLK+KGF I  + L  IV  + G  + L+K L +YFRS+ E  KL + VL+E
Sbjct: 1083 KTYLQLEAFLKIKGFTIKKEKLQEIVDSADGNSSLLIKNLFNYFRSRNEGWKLCTVVLKE 1142

Query: 1139 VVK 1141
            VVK
Sbjct: 1143 VVK 1145

>Kpol_1050.88 s1050 (199457..203098) [3642 bp, 1213 aa] {ON}
            (199457..203098) [3642 nt, 1214 aa]
          Length = 1213

 Score =  954 bits (2465), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 496/1209 (41%), Positives = 743/1209 (61%), Gaps = 37/1209 (3%)

Query: 10   FDVKLYTPXXXXXXXXXXXXXXXXXXTFLISDPSETVASCAVSIATGSHNDPVEIPGLAH 69
            +D+  YTP                    LISDP E+   C++S+ATGSHNDP EIPGLAH
Sbjct: 9    YDIPFYTPISYRGRTNKLCRLPNGMLVLLISDPGESSFGCSLSVATGSHNDPKEIPGLAH 68

Query: 70   FCEHMVLSSGSKRHPEPNAFHETLSKNNGSQNAHTSGEQTSFYFELPSSQSSDSLVFDQV 129
             CEHM+L++GSK++P P  +HE ++KN G QNA+T+GEQT+FYFELP+   + + VF+ +
Sbjct: 69   LCEHMILAAGSKKYPNPGLYHELIAKNKGLQNAYTTGEQTTFYFELPNVNQTSTPVFEDI 128

Query: 130  VGILADALKEPIFHDVLINKEIYAINSEHVGNKSSLTKMMYHAVRLLASPEHPFHQFGTG 189
            + + A   K+P+F+  L +KEIYAI SEH GN S+ TK+ YHA RLLA+  HPF  F TG
Sbjct: 129  IDVFASFFKDPLFNQTLTSKEIYAIESEHTGNTSNPTKIFYHAERLLANSNHPFSHFSTG 188

Query: 190  NIFTLTNMPKLHKLSLKNELVKYFREHFFAENMVLCLRGPQSLNQLSKIAQARFSDIPSI 249
            NI TL++ P+L K++LK+ L  YF+ +F AENM LC++GPQS+N L+KIA   FSDI  +
Sbjct: 189  NINTLSSGPQLRKINLKSLLDSYFKVNFKAENMTLCIKGPQSVNILTKIAIRYFSDIKGL 248

Query: 250  PTLQVPRLLRWRSSSSFDKNRNLSVRP-------------------LESFQILKDAWSAR 290
             +++ P+       S     +++ + P                   L S +IL++ WS +
Sbjct: 249  NSIKKPKRFGTIRKSISTSEKSIPLSPSSPTSCKSISSVLSETNSSLLSTKILENVWSPK 308

Query: 291  YAKKPVFDKTPMHNSIMVQSSKSPVIRFVFPINYFSTRFTDRELATYTQIWCELLGDECE 350
            Y     FD  P +N+I+V+S+K PV+R VFP+     +F+  EL T+  +WCE LGDE E
Sbjct: 309  YNNMVCFDPKPKYNTIIVKSNKKPVLRLVFPVVTNKGKFSKEELITFCNLWCETLGDESE 368

Query: 351  GSLCHYLRSHSYITELIAYSSNFAVNDTGLILQLHLTNHGWLNVQKIIPIVWKYLIPAIL 410
             S+C+ L +  YIT+++A++S+FA+N+ GLIL+  LT+ G  NV  II  + +  IP + 
Sbjct: 369  NSICNILMNEEYITDILAFTSDFALNNIGLILEFSLTDKGLNNVSHIINSIMESAIPKLS 428

Query: 411  DAPLSSLAQYISELNSLDLLKFLYQELERSPMDRCADLCESLLQDLSAIDLSFLLKSTLT 470
                  LA+++SE +S+DLL FL++E E SPM+ C+DL   +  DL  +    L K +  
Sbjct: 429  KEYTEELARFLSECDSIDLLNFLHKESELSPMEECSDLSGLMQTDLDILKPECLFKQSPM 488

Query: 471  YFECNNLSVANLGTYRENQTSKDWWRGEAVKFQAFVNEFMSQDTVRIILLGNLS-KCYF- 528
                   ++ N G   E+  S+ WW  +A  +Q F+  +M++D +RI LL + S K YF 
Sbjct: 489  IVGNKYPTIGNFG---ESSESRQWWLNKATMYQEFLEMYMNKDLLRIALLCDFSEKQYFG 545

Query: 529  -NCNPDKITTDTYFEYEYVKIFIDLEVLGCD--DIHYRFTIPGPNPFMVPVGHKLSFIKH 585
             N +  K+ TDT++E++Y+K+ +  E +  D  DI      P  N ++  +G  L +++ 
Sbjct: 546  KNVSEQKLVTDTFYEFDYIKLSVLPEKVPEDQVDIFSNLKFPAKNEYIPELGRSLLYLRE 605

Query: 586  ALLASSVQSENSALSVVAQSDLVRASPRLAGKNSYYELWLKEEDVDLSFRSKSIFSMELI 645
             L   S +S +  LS+   S   R  P+LA K   YE+W+ E+    S   K+I + +L+
Sbjct: 606  MLKKVSYESRSPILSLTTPSKATRPIPKLAEKGDMYEMWVMEDKFRPSTEKKTIVTFDLL 665

Query: 646  STSLEPAPEYTMHLEILGQLLYSILGPILYPAERAGYTYELSLSSKGDVRLGLTISGFTD 705
            S  + P P+ TMHLEILGQ+LY +L P LYP+ + GYTYE++ SSKGDVRL  T+SG++D
Sbjct: 666  SLDVPPTPKNTMHLEILGQILYVLLSPKLYPSLKLGYTYEIASSSKGDVRLSFTLSGYSD 725

Query: 706  GILNLLKIIVDAIVNLSQDLNSIP-KDIFRKARILVRTKYKEASSESCVTLASLGLLILL 764
            G+  ++K ++     ++ D + IP K + R+ARIL R KY+ A++E+C  LAS+GL+I+L
Sbjct: 726  GLTEVVKTVIKTCFTIAID-DEIPSKRLLRRARILTRRKYESAAAENCAKLASVGLIIML 784

Query: 765  ENCMWPLEDRLEALEDIYVESFRIFLEKFINGDNYLNILIQGSDMTIADNINEYLSERLT 824
            E  +WPLEDRL ALE+  + SF+ F   F+    YLN+++QG ++  A+ IN+YL++  T
Sbjct: 785  EKYIWPLEDRLNALEESDIHSFKEFCIAFLRSKKYLNLIVQG-NLKCANEINKYLNDSFT 843

Query: 825  HHISRADDNVCRLSE--PATYVIPEGSNLFFKRVGFHDDPNNSIVYFIQTGERDNNYIYT 882
            +H+        +  +    T ++  G+N  F+  G  DDPNN IVYFIQTG+RD+     
Sbjct: 844  NHLGEKSGKNTKSVDCSKTTKLLEPGTNCIFEHFGHPDDPNNCIVYFIQTGKRDDKKALA 903

Query: 883  LTVLTEFIMSQTLVPDLRQKKQIGYIVLGGLRVLSDTVGLHITTMAGSPPEFLEEKINEY 942
            LT  TE+++S TLVPDLR KKQIGY+V GG+RVLSDTVG+HIT M+GS P  LEEKI+EY
Sbjct: 904  LTSFTEYLLSLTLVPDLRNKKQIGYVVFGGMRVLSDTVGIHITVMSGSNPLDLEEKIDEY 963

Query: 943  LAYLEDMVLAKLTAPQFKHDYVDELLSLLTSNSLGKLEKTSGPANLMSQIEANVHSGQRN 1002
            L +LE  VL KL+  QF   +V + LS +  +S G +  T+GP N++  I ANV +G  +
Sbjct: 964  LYFLESEVLKKLSEEQFGKKFVKDYLSTMGGDSTGDMMSTAGPPNVLDGIAANVQAGDFS 1023

Query: 1003 T--SLAMKSHKRLRTQISYRRYNFDEDDEPVDARTLQNLKLSEYMRFFRQRISIYSGKRA 1060
               SL M +H+R++ +I+ +RYNF  DD   D   +++L L +Y++FF + ISI S  R+
Sbjct: 1024 VLNSLQMITHRRIKNEITSKRYNFSNDDIETDLNFIKHLTLKKYLKFFEENISISSVNRS 1083

Query: 1061 KLSIMVYSAMSKEEVQGKMLYLQIESFLKMKGFNIPSKDLNAIVQKSKGKPTALLKGLLS 1120
            KLS+ + S M+ +E+  +  +LQ+E FLK+ GF I +  L ++V +S+G+P  L K L +
Sbjct: 1084 KLSVAITSPMATQEIMNRKFFLQLEGFLKLNGFTINNDTLKSMVSESQGRPGKLFKLLFN 1143

Query: 1121 YFRSQGESLKLLSTVLREVVKQL---FSKAXXXXXXXXXXXXXXXLQAMSQHVTPAITLE 1177
            YF ++GE  K    V  EV+K +                      +Q  S  V PAITL 
Sbjct: 1144 YFSNRGEGWKFCKIVTSEVLKIIAISVKPNFSGIFPSSKQSDSSNIQTWSSSVKPAITLT 1203

Query: 1178 QVPEVNSYR 1186
            +V +V+ ++
Sbjct: 1204 KVNDVHIFK 1212

>Smik_16.371 Chr16 (659341..662967) [3627 bp, 1208 aa] {ON} YPR122W
            (REAL)
          Length = 1208

 Score =  954 bits (2465), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 489/1122 (43%), Positives = 726/1122 (64%), Gaps = 22/1122 (1%)

Query: 38   LISDPSETVASCAVSIATGSHNDPVEIPGLAHFCEHMVLSSGSKRHPEPNAFHETLSKNN 97
            LISDP++T +SC++S+ TGSHNDP++IPGLAH CEHM+LS+GSK++P+P  FH  ++KNN
Sbjct: 37   LISDPTDTSSSCSLSVCTGSHNDPMDIPGLAHLCEHMILSAGSKKYPDPGLFHALIAKNN 96

Query: 98   GSQNAHTSGEQTSFYFELPSSQSSDSLVFDQVVGILADALKEPIFHDVLINKEIYAINSE 157
            GSQNA+T+GEQT+FYFELP++Q++    F+ ++ + A   K+P+F+ +LI+KEIYAI SE
Sbjct: 97   GSQNAYTTGEQTTFYFELPNTQNNGEFAFESILDVFASFFKDPLFNPLLISKEIYAIQSE 156

Query: 158  HVGNKSSLTKMMYHAVRLLASPEHPFHQFGTGNIFTLTNMPKLHKLSLKNELVKYFREHF 217
            H GN SS TK+ YHA R+LA+ +HPF +F TGNI +L+++P+L K++LK+ L  YFR +F
Sbjct: 157  HEGNISSTTKIFYHAARILANSDHPFSRFSTGNIHSLSSIPQLKKINLKSSLNTYFRSNF 216

Query: 218  FAENMVLCLRGPQSLNQLSKIAQARFSDIPSIPTLQVPRLL----RWRSSSSFDKNRNL- 272
            F EN+ LC+RG QS+N L+K+A ++F D+     ++          +R S+S  ++ N  
Sbjct: 217  FGENITLCIRGSQSVNILTKLAISKFGDVKPKSIVKERHFSIGKGPFRKSTSLRRSLNSP 276

Query: 273  --SVRPLESFQILKDAWSARYAKKPVFDKTPMHNSIMVQSSKSPVIRFVFPINYFSTRFT 330
                R LE F+IL   W  +Y     F   P  NSI + S+K PV+RF+FP++  +TRFT
Sbjct: 277  KNDYRNLEDFKILDTVWEKKYQNTMCFQHAPECNSIFINSNKMPVMRFLFPVSDRNTRFT 336

Query: 331  DRELATYTQIWCELLGDECEGSLCHYLRSHSYITELIAYSSNFAVNDTGLILQLHLTNHG 390
              ++  Y+ +WCEL GDE  GSL HYL S  +IT+  A++S FA+ D GLIL+L LTN G
Sbjct: 337  KDDIKIYSHLWCELFGDESPGSLSHYLVSRGWITKCFAFTSEFAIGDIGLILELELTNSG 396

Query: 391  WLNVQKIIPIVWKYLIPAILDAPLSSLAQYISELNSLDLLKFLYQELERSPMDRCADLCE 450
            W +++ I   ++  L+P+     +  L  ++ E N +DL +FLYQ  E  PM+ C++L  
Sbjct: 397  WKSIKNITTTIFSELLPSFYVKNIDHLVTFLKEQNLIDLARFLYQSSENLPMEECSNLSS 456

Query: 451  SLLQDLSAIDLSFLLKSTLTYFECNNLSVANLGTYRENQTSKDWWRGEAVKFQAFVNEFM 510
             L ++L  +  S + K   +  E ++    N+  Y E + +  WW G+A+KFQ F+   M
Sbjct: 457  FLQENLECLTPSNVFKGFKSLIEIDD---PNIEKYEETKANVRWWTGQAIKFQNFLKSHM 513

Query: 511  SQDTVRIILLGNL-SKCYFNC--NPDKITTDTYFEYEYVKIFIDL--EVLGCDDIHYRFT 565
              D  R++LLG++ S   F+   N  +I TD ++E+EY    + L  E        Y F 
Sbjct: 514  KHDNTRLLLLGDIKSHKIFHIIENKSEIRTDFFYEFEYYTGSVHLAEENKYYPKSSYEFN 573

Query: 566  IPGPNPFMVPVGHKLSFIKHALLASSVQSENSALSVVAQSDLVRASPRLAGKNSYYELWL 625
             P  N F+         ++   L  S++S+ + L     S+  R  P+L  +N  YE+W+
Sbjct: 574  FPKSNLFLPDYISDPLKLRQLFLECSLKSKFATLRPQIYSEPTRREPQLVSENLNYEMWI 633

Query: 626  KEEDVDLSFRSKSIFSMELISTSLEPAPEYTMHLEILGQLLYSILGPILYPAERAGYTYE 685
             +ED + +  +KS+ S E++   ++P+PE T+HLE+L Q+L+ I    LYPA R GYTYE
Sbjct: 634  LKEDPNFASNNKSVVSFEVLGLGIKPSPEATIHLEVLAQVLFIITSSHLYPALRIGYTYE 693

Query: 686  LSLSSKGDVRLGLTISGFTDGILNLLKIIVDAIVNLSQDLNSIPKDIFRKARILVRTKYK 745
            ++ SSKG V L  TISGF +G+  ++K  VD +  ++ D   + KD  RKARI VR+KY+
Sbjct: 694  IASSSKGSVTLRFTISGFPEGVFKIVKTFVDTLKLIATDPTFLSKDTLRKARIFVRSKYE 753

Query: 746  EASSESCVTLASLGLLILLENCMWPLEDRLEALEDIYVESFRIFLEKFINGDNYLNILIQ 805
             ASS++CV LAS+GLLI+LE  +W L+DR+ ALE   +ESF+ F   F      L +L+Q
Sbjct: 754  SASSDNCVKLASIGLLIVLEEFIWTLQDRINALELTEMESFKEFCSLFWKNPKQLVLLVQ 813

Query: 806  GSDMTIADNINEYLSERLTHHISRADDN----VCRLSEPATYVIPEGSNLFFKRVGFHDD 861
            GS +  AD IN YL+   T H+   ++     +     P+T  + EG+N F    G  DD
Sbjct: 814  GS-LDYADEINHYLNRNFTQHLKVCNEGSKSTIHLYPSPSTKNLDEGTNAFISYNGHQDD 872

Query: 862  PNNSIVYFIQTGERDNNYIYTLTVLTEFIMSQTLVPDLRQKKQIGYIVLGGLRVLSDTVG 921
            PNNSIVYFIQT +RD+     LT LTE++ S TLVPDLR +KQIGYIVLGGLRVL+DTVG
Sbjct: 873  PNNSIVYFIQTAQRDDIENLALTFLTEYLFSLTLVPDLRNRKQIGYIVLGGLRVLTDTVG 932

Query: 922  LHITTMAGSPPEFLEEKINEYLAYLEDMVLAKLTAPQFKHDYVDELLSLLTSNSLGKLEK 981
            +H+T M+GS    LE KINEYL+YLE  VL  LT   F+   ++  L+LL  NS+ K E+
Sbjct: 933  IHVTVMSGSSAHNLETKINEYLSYLELQVLDNLTEIDFRKMLLEPFLTLLKQNSITKFEE 992

Query: 982  TSGPANLMSQIEANVHSGQRNT--SLAMKSHKRLRTQISYRRYNFDEDDEPVDARTLQNL 1039
            ++GP +L+++I ANV +G   T  +  MK H+++R +I+ +R NF E+ E V+   LQ L
Sbjct: 993  SAGPVDLLNEIVANVQNGDNYTLNNRQMKQHRKVRNKITEKRLNFQEEYEMVNIPFLQKL 1052

Query: 1040 KLSEYMRFFRQRISIYSGKRAKLSIMVYSAMSKEEVQGKMLYLQIESFLKMKGFNIPSKD 1099
             L +Y+RFF+ +ISIYS +R+K+SIM+ S M++E++  + ++LQ+E+FLK+KGF I ++D
Sbjct: 1053 TLKKYLRFFQAKISIYSTQRSKISIMIASPMAEEKIASRRIFLQLEAFLKIKGFAIKNED 1112

Query: 1100 LNAIVQKSKGKPTALLKGLLSYFRSQGESLKLLSTVLREVVK 1141
            L  IV+ S+G P  L+K L ++FR + E+ KL + VL+E++K
Sbjct: 1113 LKKIVEHSEGSPMLLVKNLFTHFRKRNEAFKLGTVVLQEILK 1154

>Skud_16.412 Chr16 (741265..744891) [3627 bp, 1208 aa] {ON} YPR122W
            (REAL)
          Length = 1208

 Score =  953 bits (2464), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 496/1156 (42%), Positives = 729/1156 (63%), Gaps = 34/1156 (2%)

Query: 10   FDVKLYTPXXXXXXXXXXXXXXXXXXTFLISDPSETVASCAVSIATGSHNDPVEIPGLAH 69
            ++V +Y P                    LISDP++T +SC++S+ TGSHNDP +  GLAH
Sbjct: 9    YEVPIYIPLSYSNRTHKICKLPNGILALLISDPTDTSSSCSLSVCTGSHNDPKDTLGLAH 68

Query: 70   FCEHMVLSSGSKRHPEPNAFHETLSKNNGSQNAHTSGEQTSFYFELPSSQSSDSLVFDQV 129
             CEHM+L++GSK++P+   FH  ++KNNGSQNA+T+GEQT+FYFELP+SQS+    F+ +
Sbjct: 69   LCEHMILAAGSKQYPDAGLFHTLIAKNNGSQNAYTTGEQTTFYFELPNSQSNGEFAFEFI 128

Query: 130  VGILADALKEPIFHDVLINKEIYAINSEHVGNKSSLTKMMYHAVRLLASPEHPFHQFGTG 189
            + + A   K P+F+ +LI+KEIYAI SEH GN SS TK+ YHA RLLA+ +HPF +F TG
Sbjct: 129  LDVFASFFKNPLFNPLLISKEIYAIQSEHEGNISSTTKIFYHAARLLANSDHPFSRFSTG 188

Query: 190  NIFTLTNMPKLHKLSLKNELVKYFREHFFAENMVLCLRGPQSLNQLSKIAQARFSDIP-- 247
            NI +L+++P+L K++LKN L  YF+ ++F EN+ +C+RGPQS+N L+K+A ++F DI   
Sbjct: 189  NIHSLSSIPQLKKINLKNSLNAYFKNNYFGENITICIRGPQSVNILAKLAISKFGDIKPK 248

Query: 248  --------SIPTLQVPRLLRWRSSSSFDKNRNLSVRPLESFQILKDAWSARYAKKPVFDK 299
                    SI      R    +S+  F KN +   R LESF+IL+  W  +Y     F+ 
Sbjct: 249  NSVEGNNFSIRAGSFRRSRSVKSTGDFSKNDH---RKLESFKILETVWEEKYKNSKCFEH 305

Query: 300  TPMHNSIMVQSSKSPVIRFVFPINYFSTRFTDRELATYTQIWCELLGDECEGSLCHYLRS 359
             P  N+I + S+KSPVIRF+FP++  +TRFT  ++  Y+ +WCEL GDE  GSL  YL S
Sbjct: 306  PPGKNTIFINSNKSPVIRFLFPVSDKNTRFTKEDIKIYSHLWCELFGDESPGSLGSYLVS 365

Query: 360  HSYITELIAYSSNFAVNDTGLILQLHLTNHGWLNVQKIIPIVWKYLIPAILDAPLSSLAQ 419
              +IT+  A++S FA+ + GL+L+L LTN GW +++ I   ++  L+P+     +  L  
Sbjct: 366  RGWITKCFAFTSEFAIGNIGLMLELELTNSGWESIKDITTTIFSKLLPSFYVKNIDYLIT 425

Query: 420  YISELNSLDLLKFLYQELERSPMDRCADLCESLLQDLSAIDLSFLLKSTLTYFECNNLSV 479
            ++ E N +D+ +FLYQ  E  PM+ C++L   L ++L  +  S + K   +  E ++   
Sbjct: 426  FLKEQNLIDIARFLYQSSEDIPMEECSNLSTILQENLEYLTPSNVFKGFKSLIEIDD--- 482

Query: 480  ANLGTYRENQTSKDWWRGEAVKFQAFVNEFMSQDTVRIILLGNLSKCYFNCNPDK---IT 536
             N+  Y  ++ +  WW G+A+KFQ F+   M+ +  R+++LGN+         +K   + 
Sbjct: 483  PNIDKYENSEANMQWWIGQAIKFQNFLKSHMNHENTRLLILGNVKSYEVFDKIEKRSEMY 542

Query: 537  TDTYFEYEYVKIFIDLEVLGCDD-----IHYRFTIPGPNPFMVPVGHKLSFIKHALLASS 591
            TD ++E+EY    +DL     DD      +Y F  P  N F+    +    ++   L  S
Sbjct: 543  TDFFYEFEYYTGKVDLTR---DDESYAKSYYEFNFPTSNIFLPDYINDPLKLQQLFLECS 599

Query: 592  VQSENSALSVVAQSDLVRASPRLAGKNSYYELWLKEEDVDLSFRSKSIFSMELISTSLEP 651
            ++S+ + L    QS+  +  P+L  KN  YE+W+ +ED +    +KSI S E++   ++P
Sbjct: 600  LKSKFATLRPQIQSEPTKRLPQLVSKNLNYEMWVLKEDPNFISDNKSIVSFEILGLGIKP 659

Query: 652  APEYTMHLEILGQLLYSILGPILYPAERAGYTYELSLSSKGDVRLGLTISGFTDGILNLL 711
            +PE T+HLE+L Q+L+ I    LYPA R GYTYE++ SSKG+V L  TISGF++G+  + 
Sbjct: 660  SPEATIHLEVLAQVLFIITSSYLYPALRVGYTYEIASSSKGNVTLRFTISGFSEGVYTIA 719

Query: 712  KIIVDAIVNLSQDLNSIPKDIFRKARILVRTKYKEASSESCVTLASLGLLILLENCMWPL 771
            K  VD +  ++ D   + KD  RKARILVR KY+ ASS++CV LAS+GLLI+LE  MW L
Sbjct: 720  KTFVDTLKKIATDATFLSKDTVRKARILVRRKYEGASSDNCVKLASIGLLIVLEEYMWTL 779

Query: 772  EDRLEALEDIYVESFRIFLEKFINGDNYLNILIQGSDMTIADNINEYLSERLTHHISRAD 831
            +DR++ALE     SF+ F   F N    L +LIQG ++  AD IN YL+   T H+  ++
Sbjct: 780  QDRIDALELTETSSFKEFCYLFWNNPKRLVLLIQG-NLEYADEINHYLNNNFTQHLKVSN 838

Query: 832  DN----VCRLSEPATYVIPEGSNLFFKRVGFHDDPNNSIVYFIQTGERDNNYIYTLTVLT 887
            ++    +C    P+T  +  G+N F    G  DDPNNSIVYFIQT +R++    TLT LT
Sbjct: 839  EDNRPTICLYPSPSTKNLDRGTNTFVSYNGHQDDPNNSIVYFIQTAKRNDIESMTLTFLT 898

Query: 888  EFIMSQTLVPDLRQKKQIGYIVLGGLRVLSDTVGLHITTMAGSPPEFLEEKINEYLAYLE 947
            E++ S TLVPDLR KKQIGYIVLGGLRVL++TVG+HIT M+G P   LE KINEYL+YL+
Sbjct: 899  EYLFSLTLVPDLRNKKQIGYIVLGGLRVLTETVGIHITVMSGGPAHNLENKINEYLSYLQ 958

Query: 948  DMVLAKLTAPQFKHDYVDELLSLLTSNSLGKLEKTSGPANLMSQIEANVHSGQRNT--SL 1005
              VL   T   F+   ++  L+LL  NS  KLE +SGP NL+++I ANV +G   T  + 
Sbjct: 959  LQVLNTFTESDFRRILLEPFLALLKQNSFNKLESSSGPVNLLNEIVANVQNGDNYTLNNR 1018

Query: 1006 AMKSHKRLRTQISYRRYNFDEDDEPVDARTLQNLKLSEYMRFFRQRISIYSGKRAKLSIM 1065
             MK H+++R +I  RR++F ++ E  D   LQ L L  Y+ FF  +ISIYS +R+KLSIM
Sbjct: 1019 QMKQHRKIRNKIIERRFSFQDEYEMFDIPFLQGLTLKRYLEFFESKISIYSRQRSKLSIM 1078

Query: 1066 VYSAMSKEEVQGKMLYLQIESFLKMKGFNIPSKDLNAIVQKSKGKPTALLKGLLSYFRSQ 1125
            + S M++E++  + ++LQ+E+FLK+KGF I S+DL +IV  SKG P  L+K L + FR +
Sbjct: 1079 ITSPMAEEDIVSRKMFLQLEAFLKIKGFAIKSEDLKSIVDNSKGSPVLLIKNLFTSFRRR 1138

Query: 1126 GESLKLLSTVLREVVK 1141
             E+ KL + VL+E+ K
Sbjct: 1139 NEAFKLGAVVLQEISK 1154

>YPR122W Chr16 (782045..785671) [3627 bp, 1208 aa] {ON}  AXL1Haploid
            specific endoprotease that performs one of two N-terminal
            cleavages during maturation of a-factor mating pheromone;
            required for axial budding pattern of haploid cells
          Length = 1208

 Score =  952 bits (2462), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 501/1202 (41%), Positives = 741/1202 (61%), Gaps = 31/1202 (2%)

Query: 10   FDVKLYTPXXXXXXXXXXXXXXXXXXTFLISDPSETVASCAVSIATGSHNDPVEIPGLAH 69
            ++V  Y P                    +ISDP++T +SC++++ TGSHNDP +I GLAH
Sbjct: 9    YEVSFYIPLSYSNRTHKVCKLPNGILALIISDPTDTSSSCSLTVCTGSHNDPKDIAGLAH 68

Query: 70   FCEHMVLSSGSKRHPEPNAFHETLSKNNGSQNAHTSGEQTSFYFELPSSQSSDSLVFDQV 129
             CEHM+LS+GSK++P+P  FH  ++KNNGSQNA T+GEQT+FYFELP++Q++    F+ +
Sbjct: 69   LCEHMILSAGSKKYPDPGLFHTLIAKNNGSQNAFTTGEQTTFYFELPNTQNNGEFTFESI 128

Query: 130  VGILADALKEPIFHDVLINKEIYAINSEHVGNKSSLTKMMYHAVRLLASPEHPFHQFGTG 189
            + + A   KEP+F+ +LI+KEIYAI SEH GN SS TK+ YHA R+LA+P+HPF +F TG
Sbjct: 129  LDVFASFFKEPLFNPLLISKEIYAIQSEHEGNISSTTKIFYHAARILANPDHPFSRFSTG 188

Query: 190  NIFTLTNMPKLHKLSLKNELVKYFREHFFAENMVLCLRGPQSLNQLSKIAQARFSDIPSI 249
            NI +L+++P+L K+ LK+ L  YF  +FF EN+ LC+RGPQS+N L+K+A ++F DI   
Sbjct: 189  NIHSLSSIPQLKKIKLKSSLNTYFENNFFGENITLCIRGPQSVNILTKLALSKFGDIKPK 248

Query: 250  PTLQVP----RLLRWRSSSSFDKNRNLS---VRPLESFQILKDAWSARYAKKPVFDKTPM 302
              ++      R   +R S S  K ++ S      L++F+IL   W  +Y     F + P 
Sbjct: 249  SAVKERSISIRTRSFRRSKSLKKRQDSSKNDYSDLKTFKILNTTWEKKYKNTMCFQQFPE 308

Query: 303  HNSIMVQSSKSPVIRFVFPINYFSTRFTDRELATYTQIWCELLGDECEGSLCHYLRSHSY 362
             NSI + S+K P++R +FP++  +TRFT  ++  Y+ +WCEL GDE  GSL +YL S  +
Sbjct: 309  CNSIFINSNKVPIMRLLFPVSDKNTRFTKDDIKIYSHLWCELFGDESPGSLSYYLASKGW 368

Query: 363  ITELIAYSSNFAVNDTGLILQLHLTNHGWLNVQKIIPIVWKYLIPAILDAPLSSLAQYIS 422
            +T   A++S FA+ D GLIL+L LTN GW N+++I  IV   L+P+     +  L  ++ 
Sbjct: 369  LTGCFAFTSEFAIGDIGLILELELTNSGWENIKRITTIVLNRLLPSFYVMNIDYLITFLK 428

Query: 423  ELNSLDLLKFLYQELERSPMDRCADLCESLLQDLSAIDLSFLLKSTLTYFECNNLSVANL 482
            E N +DL+ FLYQ  E  PM+ C+ L   L  DL  +    + K   +  E ++    N+
Sbjct: 429  EQNLIDLVSFLYQSSEDLPMEECSKLSGILQDDLECLTPPNIFKGFKSLIEIDD---PNI 485

Query: 483  GTYRENQTSKDWWRGEAVKFQAFVNEFMSQDTVRIILLGNL-SKCYFN--CNPDKITTDT 539
              Y   + +  WW G+A+KFQ F+  FM+ D +R++LLGN+ S   F+   N   I TD 
Sbjct: 486  EKYENTKANIQWWTGQAIKFQNFLKSFMNHDNMRLLLLGNIKSGNIFDKMKNKSDICTDF 545

Query: 540  YFEYEYVKIFIDLEVLGCDDIH----YRFTIPGPNPFMVPVGHKLSFIKHALLASSVQSE 595
            ++E+EY     ++ +   +  H    Y F  P  N F+         ++   L  S++S+
Sbjct: 546  FYEFEYYT--ANVHLASDNKFHSNSSYEFNFPTGNLFLPDCVSDPLKLQQLFLECSLKSK 603

Query: 596  NSALSVVAQSDLVRASPRLAGKNSYYELWLKEEDVDLSFRSKSIFSMELISTSLEPAPEY 655
             + L     S+  R  P+L  +N  YE+W+ +ED + +  +KS+ S E++   ++P+PE 
Sbjct: 604  FATLRPQIYSEPTRTKPQLVSENQNYEMWILKEDPNFASDNKSVVSFEVLGLGIKPSPEA 663

Query: 656  TMHLEILGQLLYSILGPILYPAERAGYTYELSLSSKGDVRLGLTISGFTDGILNLLKIIV 715
            T+HLE+L Q L+ I    LYPA R GYTYE++ SSKG+V L  TISGF +G+  ++K  V
Sbjct: 664  TIHLEVLAQALFIITSSFLYPALRIGYTYEIASSSKGNVTLRFTISGFPEGVFTIVKTFV 723

Query: 716  DAIVNLSQDLNSIPKDIFRKARILVRTKYKEASSESCVTLASLGLLILLENCMWPLEDRL 775
            D +  ++ D   + KD  RKARILVR KYK ASS++CV LAS+GLLI+LE  +W LEDR+
Sbjct: 724  DTLKLIATDPTFLSKDTLRKARILVRNKYKNASSDNCVKLASVGLLIVLEKYIWTLEDRI 783

Query: 776  EALEDIYVESFRIFLEKFINGDNYLNILIQGSDMTIADNINEYLSERLTHHISRADDN-- 833
             ALE   +ESF  F   F     +L + +QGS +  AD IN YL+   T H+  +++   
Sbjct: 784  NALELTELESFEKFCFLFWRNPKHLVLFMQGS-LEYADAINRYLNNNFTQHLKISNEGSK 842

Query: 834  -VCRL-SEPATYVIPEGSNLFFKRVGFHDDPNNSIVYFIQTGERDNNYIYTLTVLTEFIM 891
               RL   P+T  + +G+N F    G  DDPNNSIVYFIQT +RD+    TLT LTE++ 
Sbjct: 843  PTIRLYPPPSTKDLDQGTNAFISYNGHQDDPNNSIVYFIQTAQRDDIKNLTLTFLTEYLF 902

Query: 892  SQTLVPDLRQKKQIGYIVLGGLRVLSDTVGLHITTMAGSPPEFLEEKINEYLAYLEDMVL 951
            S TLVPDLR KKQIGYIVLGGLRVL+DTVG+HIT M+GS    LE +INEYL+YL+  VL
Sbjct: 903  SLTLVPDLRNKKQIGYIVLGGLRVLTDTVGIHITVMSGSSGHNLETRINEYLSYLQLQVL 962

Query: 952  AKLTAPQFKHDYVDELLSLLTSNSLGKLEKTSGPANLMSQIEANVHSGQRNT--SLAMKS 1009
             + T   F+   ++  L+LL  NS  + E ++GP +L+++I ANV +G   T  +  M+ 
Sbjct: 963  NRFTEFDFRRILLEPFLNLLKQNSTKQFEGSAGPVDLLNEIVANVQNGDNYTLNNKQMRQ 1022

Query: 1010 HKRLRTQISYRRYNFDEDDEPVDARTLQNLKLSEYMRFFRQRISIYSGKRAKLSIMVYSA 1069
            H+++R +I+  R NF ED E +D   LQ L L +Y+ FF  +ISIYS +R+KLSIM+ S 
Sbjct: 1023 HRKVRNKIAEGRLNFQEDHEMIDISFLQKLTLKKYLAFFESKISIYSAQRSKLSIMITSP 1082

Query: 1070 MSKEEVQGKMLYLQIESFLKMKGFNIPSKDLNAIVQKSKGKPTALLKGLLSYFRSQGESL 1129
            M+++E+  + ++LQ+E+FLK+ GF I ++DL  IV+ SKG P  L+K L +YFR + E  
Sbjct: 1083 MAEKEIASRKMFLQLEAFLKINGFAIKNEDLKKIVEHSKGNPILLVKNLFTYFRRRNEVF 1142

Query: 1130 KLLSTVLREVVK----QLFSKAXXXXXXXXXXXXXXXLQAM-SQHVTPAITLEQVPEVNS 1184
            KL + VL+E++K     L  +                ++   +   +P + L+++PE N 
Sbjct: 1143 KLGTVVLQEILKIIGMNLKQRYGSILGFSSQDGEGQEIEKFWNNDTSPIVPLQELPEPNF 1202

Query: 1185 YR 1186
            +R
Sbjct: 1203 FR 1204

>NDAI0A04650 Chr1 complement(1046461..1050060) [3600 bp, 1199 aa] {ON}
            Anc_3.455 YPR122W
          Length = 1199

 Score =  932 bits (2410), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 489/1197 (40%), Positives = 742/1197 (61%), Gaps = 32/1197 (2%)

Query: 10   FDVKLYTPXXXXXXXXXXXXXXXXXXTFLISDPSETVASCAVSIATGSHNDPVEIPGLAH 69
            +D   Y P                  T LISDP +T+++C++S+ATGSHNDP ++PGLAH
Sbjct: 9    YDTPFYIPRCYSDRVHKLCRLPNGILTLLISDPKDTISACSLSVATGSHNDPADLPGLAH 68

Query: 70   FCEHMVLSSGSKRHPEPNAFHETLSKNNGSQNAHTSGEQTSFYFELPSSQSSDSLVFDQV 129
             CEHMVL++GSK +P    +H  L+KNNG+QNA T+GEQT+FYFE+P++Q+S  L+FD++
Sbjct: 69   LCEHMVLAAGSKDYPNAGLYHSMLTKNNGTQNAFTTGEQTTFYFEVPTTQNSGELIFDKL 128

Query: 130  VGILADALKEPIFHDVLINKEIYAINSEHVGNKSSLTKMMYHAVRLLASPEHPFHQFGTG 189
            V + +   KEP+F+ +L NKEIYAI SEH GN SSL K++YHA RL+A+ +HPF QF TG
Sbjct: 129  VDVFSSFFKEPLFNPLLTNKEIYAIQSEHEGNISSLNKILYHATRLMANKDHPFSQFSTG 188

Query: 190  NIFTLTNMPKLHKLSLKNELVKYFREHFFAENMVLCLRGPQSLNQLSKIAQARFSDIPSI 249
            NI TL+++P+L K++LK  L+ YF  +F+   M LC+RGPQS+N L+K+  ++F DI + 
Sbjct: 189  NINTLSSIPQLKKINLKKALLDYFARNFYGSKMTLCVRGPQSVNTLTKLVVSKFGDIRAN 248

Query: 250  PTLQVPRLLRWRSSSSFDKNRNLSVRP--LESFQILKDAWSARYAKKPVFD-KTPMHNSI 306
              L+  +     S  S    ++   +P  LE + ILK  W  +Y + P F   +   N I
Sbjct: 249  NGLKRSKFGSISSRLSISSFQSKERQPTDLEQYNILKSTWKPKYREAPCFTHDSDSANMI 308

Query: 307  MVQSSKSPVIRFVFPINYFSTRFTDRELATYTQIWCELLGDECEGSLCHYLRSHSYITEL 366
             ++S+K   +RF+FP+    ++F+ + ++ +   WCEL GDE +GSLC+ L   S+IT+ 
Sbjct: 309  FIRSNKQSTLRFLFPVEDKFSKFSSKTVSLFKNFWCELFGDETKGSLCYLLVGKSWITDC 368

Query: 367  IAYSSNFAVNDTGLILQLHLTNHGWLNVQKIIPIVWKYLIPAILDAPLSSLAQYISELNS 426
             AY+S F+    GLILQ  LTN GW NV KII IV    I A +D P   L+ ++ E N+
Sbjct: 369  FAYTSEFSSGSYGLILQFALTNTGWDNVDKIINIVLDNTIAAFIDKPTDQLSCFLKEQNT 428

Query: 427  LDLLKFLYQELERSPMDRCADLCESLLQDLSAIDLSFLLKSTLTYFEC--NNLSVANLGT 484
            +DL++FLYQ  E+SPM+ C+++   L +DL  +D+S+L K   T  +C  N+ +  ++  
Sbjct: 429  IDLIRFLYQPTEKSPMEECSNISCLLQEDLEDLDISYLFKGAPTISDCYSNDNNTVDMIE 488

Query: 485  YRENQTSKDWWRGEAVKFQAFVNEFMSQDTVRIILLGNLSKCYFNCNPDKITTDTYFEYE 544
            Y +     + W  +A +FQ F+  FM++  V + LLGN    +       + +     Y 
Sbjct: 489  YEQ-----ECWLKQAREFQEFLKVFMNRSNVFLFLLGNEKIAH------SLRSIIRIRYF 537

Query: 545  YVKIFIDLEVLGCD--------DIHYRFTIPGPNPFMVPVGHKLSFIKHALLASSVQSEN 596
             +   + L +L              Y F +P PN F+ P    ++ ++   L SS++S  
Sbjct: 538  LLMQCMSLNILNVIYLRFPKLLSTQYTFQVPPPNAFIPPSCQDVTILQQLFLESSLKSRF 597

Query: 597  SALSVVAQSDLVRASPRLAGKNSYYELWLKEEDVDLSFRSKSIFSMELISTSLEPAPEYT 656
            S   +   +  +   P L  +NS YE+W  +  +D S   KSI S E+ + S+ P+PE +
Sbjct: 598  STFRLQLLNTNLGNVPHLISRNSSYEMWALDNPIDASIDKKSIMSFEIFNRSMIPSPENS 657

Query: 657  MHLEILGQLLYSILGPILYPAERAGYTYELSLSSKGDVRLGLTISGFTDGILNLLKIIVD 716
            ++LEIL Q+L +++ P LYP+ R GY+YE+S S KGD++L +TI GF++GI+++L  IV 
Sbjct: 658  INLEILSQILSTLISPQLYPSIRLGYSYEISSSPKGDIQLKVTIGGFSEGIISILDTIVK 717

Query: 717  AIVNLSQDLNSIPKDIFRKARILVRTKYKEASSESCVTLASLGLLILLENCMWPLEDRLE 776
             ++ + +      K++ R++R+LVR  Y+ A+S++CVTLAS+GLLI+LE  MW L+DRLE
Sbjct: 718  TLLFIMKTPQFPSKELLRRSRVLVRNLYEAAASDNCVTLASMGLLIILERNMWTLQDRLE 777

Query: 777  ALEDIYVESFRIFLEKFINGDNYLNILIQGSDMTIADNINEYLSERLTHHISRAD-DNVC 835
            ALE+I + SF+ F  +F+    Y+N+LIQG ++   + IN YL+  LTHH+  ++  N  
Sbjct: 778  ALEEIDMVSFKEFCVQFLEEPMYMNLLIQG-NLDYGEEINNYLNTNLTHHLECSNVKNEK 836

Query: 836  RLSEPATYVIPEGSNLFFKRVGFHDDPNNSIVYFIQTGERDNNYIYTLTVLTEFIMSQTL 895
            + S  +T ++  GSN + K  G  DDPNNSIVYFIQTG R N    TLT  TE+IMS TL
Sbjct: 837  QSSTLSTILLEPGSNFYAKYNGHMDDPNNSIVYFIQTGLRTNRRTVTLTYFTEYIMSLTL 896

Query: 896  VPDLRQKKQIGYIVLGGLRVLSDTVGLHITTMAGSPPEFLEEKINEYLAYLEDMVLAKLT 955
            VPDLR K+QIGY V GGLR L+ T+G+HIT M+G  P  LE KI+EY+AYLE+ +L  LT
Sbjct: 897  VPDLRNKRQIGYAVFGGLRELTSTIGIHITVMSGISPSDLEIKIDEYIAYLEETLLNSLT 956

Query: 956  APQFKHDYVDELLSLLTSNSLGKLEKTSGPANLMSQIEANVHSGQRN--TSLAMKSHKRL 1013
              QF   Y    L LL+++   +LEK+ GPA+L++++ ANV SG  +   S  MKSHK  
Sbjct: 957  ENQFTLQYKQGYLDLLSNHKFMELEKSGGPADLLNEVVANVQSGNADELNSHFMKSHKHF 1016

Query: 1014 RTQISYRRYNFDEDDEPVDARTLQNLKLSEYMRFFRQRISIYSGKRAKLSIMVYSAMSKE 1073
              +IS +RY F  D E VD   ++NL   E+++FFR+++SI S  R+K+S+M+ S M++ 
Sbjct: 1017 FNEISNKRYQFKGDSELVDIEVIKNLTKKEFLKFFREKVSIKSKVRSKISVMIESPMAEM 1076

Query: 1074 EVQGKMLYLQIESFLKMKGFNIPSKDLNAIVQKSKGKPTALLKGLLSYFRSQGESLKLLS 1133
            E+  +  +LQ+++FLK++GF I S+ L  IV+++ G+P+AL+K L  YFR + E+L+L +
Sbjct: 1077 EIVNRKTFLQLQAFLKLEGFTINSEILRDIVERANGRPSALIKDLFKYFRERNEALRLCT 1136

Query: 1134 TVLREVVK----QLFSKAXXXXXXXXXXXXXXXLQAMSQHVTPAITLEQVPEVNSYR 1186
             +L+EVVK     L  +                     Q   PAI L+++ ++N ++
Sbjct: 1137 VILKEVVKVSASSLKHRYTPKVSSSKMKPKRQSSSNWDQDTEPAIPLKEIKDLNEFK 1193

>KLLA0D15631g Chr4 (1319185..1322697) [3513 bp, 1170 aa] {ON} similar
            to uniprot|P40851 Saccharomyces cerevisiae YPR122W AXL1
            Haploid specific endoprotease that performs one of two
            N-terminal cleavages during maturation of a- factor
            mating pheromone required for axial budding pattern of
            haploid cells
          Length = 1170

 Score =  926 bits (2393), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 490/1155 (42%), Positives = 742/1155 (64%), Gaps = 53/1155 (4%)

Query: 11   DVKLYTPXXXXXXXXXXXXXXXXXXTFLISDPSETVASCAVSIATGSHNDPVEIPGLAHF 70
            DV +YTP                    LISDP E+ AS   S+ATGSHNDP E+PGLAH 
Sbjct: 10   DVPIYTPISNSNRAHQFVQLSNGITALLISDPGESFASLCASVATGSHNDPDEVPGLAHL 69

Query: 71   CEHMVLSSGSKRHPEPNAFHETLSKNNGSQNAHTSGEQTSFYFELPSSQS-SDSLVFDQV 129
            CEHM++SS SK+ P+ + +H+ L + NG+QNA T+GEQTSFYFE+P+S + +   +FD++
Sbjct: 70   CEHMIISSESKKFPKRSHYHDLLIEYNGNQNAFTTGEQTSFYFEIPNSNNKTGKPIFDEL 129

Query: 130  VGILADALKEPIFHDVLINKEIYAINSEHVGNKSSLTKMMYHAVRLLASPEHPFHQFGTG 189
            VG++AD L  PIF    INKEI AI++EH  NK+ ++K +YH  + LA+    F +F TG
Sbjct: 130  VGVIADKLGSPIFQSADINKEIQAIDNEHENNKNLVSKALYHGTKKLATQRSKFSRFSTG 189

Query: 190  NIFTLTNMPKLHK--LSLKNELVKYFREHFFAENMVLCLRGPQSLNQLSKIAQARFSDIP 247
            NI+TLT  P +    ++LKN L K++ ++F AEN+ + +RG QSL+ L K+ Q  F D  
Sbjct: 190  NIYTLTQFPIVAGKIINLKNVLQKHYADNFVAENISIVIRGSQSLHYLKKLVQTTFGDFR 249

Query: 248  SIPTLQVPRLLRWRSSSSFDKNRNLSVRPLESFQILKDAWSARYAKKPVFDK----TPMH 303
            +  T++         S SF          +ESF+ L+  W+ARY + P+F K    TP  
Sbjct: 250  TKSTIK---------SQSFS---------IESFKKLQKVWAARYTE-PLFSKQEPETP-- 288

Query: 304  NSIMVQSSKSPVIRFVFPINYFSTRFTDRELATYTQIWCELLGDECEGSLCHYLRSHSYI 363
            NSI++QSSK+P++R VFP+++    F+  EL  ++++W +L GDE  GS+     + + +
Sbjct: 289  NSILIQSSKAPILRLVFPVSHQEALFSRSELKIFSKVWSDLFGDESSGSIHSKFSARNIL 348

Query: 364  TELIAYSSNFAVNDTGLILQLHLTNHGW-LNVQKIIPIVWKYLIPAILDAPLSSLAQYIS 422
            T  +   S F ++D GL+LQ  LTN GW   V+ ++  +++  +P         +AQY++
Sbjct: 349  TRQVTQLSKFTIDDEGLVLQFELTNSGWKTGVESLLTDLFQGFLPFFQSIDPDEIAQYLN 408

Query: 423  ELNSLDLLKFLYQELERSPMDRCADLCESLLQDLSAIDLSFLLKSTLTYFECNNLSVANL 482
            E N+++LL+F+YQ+L+ S MD+C+DLC  LLQ     D  F+L +++  F CN    +++
Sbjct: 409  EWNTINLLQFMYQDLDNSTMDKCSDLCSELLQ---CEDPQFILNNSIA-FSCNRKG-SDI 463

Query: 483  GTYRENQTSKDWWRGEAVKFQAFVNEFMSQDTVRIILLGNLSKCYF---NCNPDKITTDT 539
            G+Y E+  SK+WW  +A KF +FV  +MS +  ++I LG+L    F      P  +  D 
Sbjct: 464  GSYYESPKSKEWWNSQAKKFLSFVKTYMSWNNCKLIFLGDLQSNDFLKSRQVPTNVKFDE 523

Query: 540  YFEYEYVKIFIDLEVLGCDDIHYRFTIPGPNPFMVPVGHKLSFIKHALLASSVQSENSAL 599
            ++ ++Y    I L  +      +R  +P    F+  +   LS +K +L A   +S+ SAL
Sbjct: 524  HYRFQYELSLIKLNHVKMSPKDFR--LPSSTAFLFGLEKNLSALKQSLTAVLRKSQGSAL 581

Query: 600  SVVAQSDLVRASPRLAGKNSYYELWLKEEDVDLSFRSKSIFSMELISTSLEPAPEYTMHL 659
            S++ QS L++ +PRL  KN  YELW+KEE+  L + S+S+ ++ELI+  +EP+ + TM+L
Sbjct: 582  SIITQSKLLQTTPRLMSKNENYELWVKEEN-SLEYSSRSVITIELINMGMEPSAKNTMNL 640

Query: 660  EILGQLLYSILGPILYPAERAGYTYELSLSSKGDVRLGLTISGFTDGILNLLKIIVDAIV 719
            EIL QLLY  +   LYP+ER GY Y+++ +++GDVRL +TI+GF  G+  +L+II+D +V
Sbjct: 641  EILTQLLYFYINESLYPSERVGYMYQIAANNRGDVRLAVTINGFPQGVAMILQIIMDKMV 700

Query: 720  NLSQDLNSIPKDIFRKARILVRTKYKEASSESCVTLASLGLLILLENCMWPLEDRLEALE 779
            ++ +    I   +FR +RILVRTKY+EA+  +  TLASLG+LILLE  +  LE+RL+ALE
Sbjct: 701  DIGKPDFDITNSMFRHSRILVRTKYEEAARANSCTLASLGVLILLEKELTTLEERLDALE 760

Query: 780  DIYVESFRIFLEK-FINGDNYLNILIQGSDMTIADNINEYLSERLTHHISRADDN---VC 835
            DI +ESF++F +  +I   NY+N++IQG D++IA+ +N+Y+ + + HH+S  + N   V 
Sbjct: 761  DIDIESFKMFCKDLWIPKSNYMNLVIQG-DLSIAETVNQYM-DGIIHHLSGPNVNQTSVF 818

Query: 836  RLSEPATYVIPEGSNLFFKRVGFHDDPNNSIVYFIQTGERDNNYIYTLTVLTEFIMSQTL 895
            RL EP T  + +GSN F +   F +DP NS+VYFI+TG+R N   YT++ L E+ MS TL
Sbjct: 819  RLREPETIKLAQGSNFFIEMTSFKEDPTNSVVYFIETGDRTNPVDYTMSSLFEYFMSMTL 878

Query: 896  VPDLRQKKQIGYIVLGGLRVLSDTVGLHITTMAGSPPEFLEEKINEYLAYLEDMVLAKLT 955
            VPDLR KKQIGY+VLGGLR+L+DT+G+HI+ M+  PP  +E++I EYL YLE  VL  +T
Sbjct: 879  VPDLRNKKQIGYVVLGGLRLLTDTLGIHISVMSNLPPHTIEDRIEEYLYYLETNVLGAMT 938

Query: 956  APQFKHDYVDELLSLLTSNSLGKLEKTSGPANLMSQIEANVHSGQRNTSL-----AMKSH 1010
              +F+ + + + + L+ SNSL KL K +GPANLM+QIEA+VHSG   ++L      +  H
Sbjct: 939  EAEFQDNILQKYMQLIKSNSLEKLIKNAGPANLMAQIEASVHSGNYPSNLQSQGYTVGQH 998

Query: 1011 KRLRTQISYRRYNFDEDDEPVDARTLQNLKLSEYMRFFRQRISIYSGKRAKLSIMVYSAM 1070
            K+L+ +IS+R Y F E    VD   L  L L E+ R F ++ISI S +R KLS+   + M
Sbjct: 999  KKLKDEISFRTYAFSETK--VDVCLLSKLTLQEFKRLFMEKISILSLQRRKLSVRFKTPM 1056

Query: 1071 SKEEVQGKMLYLQIESFLKMKGFNIPSKDLNAIVQKSKGKPTALLKGLLSYFRSQGESLK 1130
            +K ++   M+ +Q++ FLK KGF+I   +L  IV K+ GKPT+L K L  +FR+QG+SL+
Sbjct: 1057 TKPDIGISMMTMQLDGFLKSKGFHITRDELQEIVTKTAGKPTSLFKELFHHFRTQGQSLR 1116

Query: 1131 LLSTVLREVVKQLFS 1145
            L + VL+E+VKQ+ +
Sbjct: 1117 LCTLVLKEIVKQILA 1131

>KAFR0A05370 Chr1 (1059317..1062922) [3606 bp, 1201 aa] {ON} Anc_3.455
            YPR122W
          Length = 1201

 Score =  924 bits (2389), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 495/1197 (41%), Positives = 755/1197 (63%), Gaps = 27/1197 (2%)

Query: 11   DVKLYTPXXXXXXXXXXXXXXXXXXTFLISDPSETVASCAVSIATGSHNDPVEIPGLAHF 70
            DV+L TP                  T LISDP++T ++C++++ATGSHNDP  IPGLAH 
Sbjct: 10   DVQLCTPLSYSNRTHKLCTLPNGIPTLLISDPADTSSACSLTVATGSHNDPPNIPGLAHL 69

Query: 71   CEHMVLSSGSKRHPEPNAFHETLSKNNGSQNAHTSGEQTSFYFELPSSQSSDSLVFDQVV 130
             EHM+L++GSK++P+P  +HE +SKNNGSQNA T+GEQT+FYFELP +     L FD+V+
Sbjct: 70   AEHMILAAGSKQYPDPGLYHELISKNNGSQNAFTTGEQTTFYFELPDTHKQGELEFDKVL 129

Query: 131  GILADALKEPIFHDVLINKEIYAINSEHVGNKSSLTKMMYHAVRLLASPEHPFHQFGTGN 190
             + A   K P+F+  +INKEIYAI +EH  N S  TK++YH+ RLLA+  HPF QF TGN
Sbjct: 130  DVFASFFKNPLFNSSIINKEIYAIENEHTNNMSRQTKILYHSTRLLANKFHPFSQFTTGN 189

Query: 191  IFTLTNMPKLHKLSLKNELVKYFREHFFAENMVLCLRGPQSLNQLSKIAQARFSDIPSIP 250
            IF+L N  +L  +S+K+ LV YF EHF A  M LCLRGP S+N L+K+A A+FSDI S  
Sbjct: 190  IFSLDNNSQLRSISIKSLLVNYFAEHFKANKMTLCLRGPHSVNVLTKLAIAKFSDIKSQN 249

Query: 251  TLQVPRLLRWRSSSSFDKNRNLSVRPLESFQILKDAWSARYAKKPVF-DKTPMHNSIMVQ 309
             LQ  +     S     + R      +ES  IL++ WS RYA  P F +++   NSI ++
Sbjct: 250  DLQRNKFGSISSKRDSRQPRQ-GYSKIESSNILENIWSKRYANLPCFVNESKKVNSIFIK 308

Query: 310  SSKSPVIRFVFPINYFSTRFTDRELATYTQIWCELLGDECEGSLCHYLRSHSYITELIAY 369
            S K P++RF+FP++  ST FT RE+  ++  WC L GDE EGSL H+L    + T   +Y
Sbjct: 309  SKKKPLVRFLFPLSSQSTIFTQREIILFSNFWCTLFGDESEGSLMHFLVEKGWSTSGHSY 368

Query: 370  SSNFAVNDTGLILQLHLTNHGWLNVQKIIPIVWKYLIPAILDAPLSSLAQYISELNSLDL 429
             S FAV   GL+++L LTN G   +  II ++++ ++  +     + +A +++E N ++ 
Sbjct: 369  VSTFAVGSIGLVIELALTNSGVGQITDIINVLFEKIVKILTTKHTTLMADFLNEQNIIEQ 428

Query: 430  LKFLYQELERSPMDRCADLCESLLQDLSAIDLSFLLKSTLTYFECNNLSVANLGTYRENQ 489
            ++FLY+ +E+ PM+ C+DL   L +++  +D+ +L K + +  +      +    Y E+ 
Sbjct: 429  VRFLYRGVEKDPMEECSDLSGLLQENMQVLDIKYLFKGSPSITQL----YSGKNQYSESM 484

Query: 490  T-SKDWWRGEAVKFQAFVNEFMSQDTVRIILLGNLSKCYFNCNPDK----ITTDTYFEYE 544
            T  K  W   A+KFQ F+  FM+ + +R++ LG+ +K       +K      TD ++E++
Sbjct: 485  TDGKIQWTAYAIKFQNFLLTFMNYENLRLLFLGSNAKETRLITKEKKRIEFETDFFYEFD 544

Query: 545  YVKIFIDLEVLGCD--DIHYRFTIPGPNPFMVPVGHKLSFIKHALLASSVQSENSALSVV 602
            + + F D      D    +Y FT+P  N F+       ++++ A   SS++S+ ++L   
Sbjct: 545  FYRTFTDFRKCSSDIETENYIFTLPSSNLFIPKSCRSYTYLQQAFQESSLKSKLASLRPQ 604

Query: 603  AQSDLVRASPRLAGKNSYYELWLKEEDVDL--SFRSKSIFSMELISTSLEPAPEYTMHLE 660
             Q + +  +P L   +  YE+W     ++   S RSK+I + ELIST++ P+ E T+HLE
Sbjct: 605  VQIEKIHFAPTLVSDSPNYEMWTLPCAINSSPSLRSKTIVTFELISTNMIPSAESTIHLE 664

Query: 661  ILGQLLYSILGPILYPAERAGYTYELSLSSKGDVRLGLTISGFTDGILNLLKIIVDAIVN 720
            IL QLL+ ++   LYP+ + GY+Y+++ SSKGDVRL  TISGF++G+L +L+ I+ ++++
Sbjct: 665  ILAQLLFYLVSSKLYPSLKLGYSYDIASSSKGDVRLKFTISGFSEGLLLVLEEIIQSVLH 724

Query: 721  LSQDLNSI--PKDIFRKARILVRTKYKEASSESCVTLASLGLLILLENCMWPLEDRLEAL 778
            +++D  +I    ++ RKAR+LVR KY EA  E+C  L S+GLLILLE+ +W LEDR++AL
Sbjct: 725  IAKDKENIYVTNELLRKARVLVRRKYDEACCENCAKLGSVGLLILLESFLWTLEDRIDAL 784

Query: 779  EDIYVESFRIFLEKFI-NGDNYLNILIQGSDMTIADNINEYLSERLTHHISRADDNVCRL 837
            ED  + SF+ F+ +F+    NY  + IQG ++  A  I+ YL++ LTHH+    + V  L
Sbjct: 785  EDTDMTSFKNFVNEFLFESFNYFTLFIQG-NLDRAHEIHHYLNDNLTHHLDILPEKVI-L 842

Query: 838  SEPATYVIPEGSNLFFKRVGFHDDPNNSIVYFIQTGERDNNYIYTLTVLTEFIMSQTLVP 897
            ++P T ++ EGSN F    G  +DPNN+IVYFIQ+G R ++  YTLT  TE++MS TL+P
Sbjct: 843  NKPRTKILQEGSNFFVAYDGHEEDPNNAIVYFIQSGLRSDSIAYTLTAFTEYLMSMTLLP 902

Query: 898  DLRQKKQIGYIVLGGLRVLSDTVGLHITTMAGSPPEFLEEKINEYLAYLEDMVLAKLTAP 957
            DLR KKQIGYIV+GG+RVL D++GLHIT ++G+PP+ LE+KI+EY+ +LE ++L +LT  
Sbjct: 903  DLRHKKQIGYIVVGGMRVLVDSIGLHITVVSGTPPQDLEDKIDEYMNFLERIILGRLTEE 962

Query: 958  QFKHDYVDELLSLLTSNSLGKLEKTSGPANLMSQIEANVHSGQRN--TSLAMKSHKRLRT 1015
            +F++ YV   L +L   + G L  T+G  NL++ I +NV +G+     S  M+ HKRL  
Sbjct: 963  EFRNQYVQNYLDMLNGKNNGTLNGTAGAHNLLNDIVSNVANGEYEILNSSEMREHKRLWN 1022

Query: 1016 QISYRRYNFDEDDEPVDARTLQNLKLSEYMRFFRQRISIYSGKRAKLSIMVYSAMSKEEV 1075
            QIS   ++F +D E ++   ++ L L  YM+FF+++ISI+S KR+KLS+MV S M + E+
Sbjct: 1023 QISDDDHSFLDDIELINREVIETLTLKGYMQFFKKKISIHSNKRSKLSVMVTSPMPENEI 1082

Query: 1076 QGKMLYLQIESFLKMKGFNIPSKDLNAIVQKSKGKPTALLKGLLSYFRSQGESLKLLSTV 1135
              + L+LQ+E+FLK+KGF I S  L  IV K+ GKP+ +LK LLS FR + E+ KLL  V
Sbjct: 1083 INRKLFLQLEAFLKIKGFAIKSNQLKEIVDKADGKPSVVLKLLLSEFRERNEAWKLLRAV 1142

Query: 1136 LREVVK----QLFSKAXXXXXXXXXXXXXXXLQAMSQH-VTPAITLEQVPEVNSYRS 1187
            L+EV+K     L  +                L+  S + V P I L+++ ++N ++S
Sbjct: 1143 LKEVLKTTGQTLKHRYGKVLPSPTKSDNSASLEKSSNYSVKPVIPLKRIEDLNIFKS 1199

>Suva_16.451 Chr16 (784213..787869) [3657 bp, 1218 aa] {ON} YPR122W
            (REAL)
          Length = 1218

 Score =  921 bits (2380), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 489/1132 (43%), Positives = 710/1132 (62%), Gaps = 32/1132 (2%)

Query: 38   LISDPSETVASCAVSIATGSHNDPVEIPGLAHFCEHMVLSSGSKRHPEPNAFHETLSKNN 97
            +ISDP+++ +SC++S+ TGSHNDP +IPGLAH CEHM+L++GSK++P+P  FH  ++KNN
Sbjct: 37   IISDPTDSSSSCSLSVCTGSHNDPEDIPGLAHLCEHMILAAGSKKYPDPGLFHTLIAKNN 96

Query: 98   GSQNAHTSGEQTSFYFELPSSQSSDSLVFDQVVGILADALKEPIFHDVLINKEIYAINSE 157
            GSQNA T+GEQT+FYFELP++QS+  L F+  + + A   KEP+F+ +LI KEIYAI SE
Sbjct: 97   GSQNAFTTGEQTTFYFELPNTQSNGELAFESTLDVFASFFKEPLFNPLLIGKEIYAIQSE 156

Query: 158  HVGNKSSLTKMMYHAVRLLASPEHPFHQFGTGNIFTLTNMPKLHKLSLKNELVKYFREHF 217
            H GN SS TK+ YHA R+LA+ +HPF  F TGNI +L+++P L K+++KN L  YF+ +F
Sbjct: 157  HEGNMSSTTKIFYHAARMLANADHPFSHFSTGNIHSLSSVPHLEKINVKNSLNTYFKNNF 216

Query: 218  FAENMVLCLRGPQSLNQLSKIAQARFSDIPSIPTLQVPRLL-----------------RW 260
            + ENM LC+RG QS+N L+K+A ++F DI     ++                        
Sbjct: 217  YGENMTLCMRGSQSVNILTKLAISKFGDISLKNDIKGSNFSIKAGSFRRSRSLRRSQDAS 276

Query: 261  RSSSSFDKNRNLSVRPLESFQILKDAWSARYAKKPVFDKTPMHNSIMVQSSKSPVIRFVF 320
            ++ S   ++ N S   LE+ +I    W  +Y     F+    +NSI + SSK+P++RF+F
Sbjct: 277  KTGSPTSESSNTSSYNLENSKISDTVWEEKYGSVSCFENPSKYNSIFINSSKAPIVRFLF 336

Query: 321  PINYFSTRFTDRELATYTQIWCELLGDECEGSLCHYLRSHSYITELIAYSSNFAVNDTGL 380
            P++  +TRFT  ++  Y+ +W EL GDE  GSL HYL S  + T   A+ S FA+ + GL
Sbjct: 337  PVSDKNTRFTKEDIKVYSHLWRELFGDESPGSLSHYLVSKGWATSSFAFISEFAIGNIGL 396

Query: 381  ILQLHLTNHGWLNVQKIIPIVWKYLIPAILDAPLSSLAQYISELNSLDLLKFLYQELERS 440
            +L+L LT  GW +V+ I   ++  L+P+     +  L  ++ E N +D+ +FLYQ  E  
Sbjct: 397  VLELELTKTGWRSVESIATTIFSKLLPSFCTKNIDHLIGFLREQNLIDIARFLYQNSEDL 456

Query: 441  PMDRCADLCESLLQDLSAIDLSFLLKSTLTYFECNNLSVANLGTYRENQTSKDWWRGEAV 500
            PM+ C+ L   L ++L  +    + K   +  E N+    N+  Y  N+ +  WW G+A+
Sbjct: 457  PMEECSHLSGILQENLECLTPCNIFKGFKSLIEIND---PNIEKYENNKLNVQWWTGQAI 513

Query: 501  KFQAFVNEFMSQDTVRIILLGNL-SKCYFNCNPD--KITTDTYFEYEYV--KIFIDLEVL 555
            KFQ F+  FM+ +  RI+LLG++ S   F+   D  +I T+ ++E+EY   ++ +  +  
Sbjct: 514  KFQNFLKSFMNHENTRILLLGDIKSHNLFDKIEDESEIHTEFFYEFEYYMGRVHLSEDHK 573

Query: 556  GCDDIHYRFTIPGPNPFMVPVGHKLSFIKHALLASSVQSENSALSVVAQSDLVRASPRLA 615
                  Y F  P  NPF+    +    ++   L  S++S+ + L    QS+ +   P+L 
Sbjct: 574  YHSQSPYEFNFPTKNPFLPDFVNDPLKLQQLYLECSLKSKFATLRPQIQSEPIEILPQLV 633

Query: 616  GKNSYYELWLKEEDVDLSFRSKSIFSMELISTSLEPAPEYTMHLEILGQLLYSILGPILY 675
             KN  YE+W+ +ED + +  + S+ S E+I   ++P+PE T+HLE+L Q+L+      LY
Sbjct: 634  SKNLNYEMWVLKEDPNFTSDNVSVVSFEVIGLGIKPSPEATIHLEVLAQILFITTSSNLY 693

Query: 676  PAERAGYTYELSLSSKGDVRLGLTISGFTDGILNLLKIIVDAIVNLSQDLNSIPKDIFRK 735
            PA RAGYTYE++ SSKG+V L  TISGF++G+  + K  VD +  +  D     KD  RK
Sbjct: 694  PALRAGYTYEIASSSKGNVTLRFTISGFSEGVFKITKAFVDTLKLIGTDPTFPSKDALRK 753

Query: 736  ARILVRTKYKEASSESCVTLASLGLLILLENCMWPLEDRLEALEDIYVESFRIFLEKFIN 795
            ARILVR+KY+ ASS++ V LAS+GLLI+LE  MW L+DR++ALE   +ES + F   F  
Sbjct: 754  ARILVRSKYESASSDNGVKLASIGLLIVLEEYMWTLQDRIDALELTDMESLKNFCSLFWK 813

Query: 796  GDNYLNILIQGSDMTIADNINEYLSERLTHHISRADDN---VCRL-SEPATYVIPEGSNL 851
                L +LIQG ++  AD IN YL+   T H+   D+      RL   P T  I  G+N 
Sbjct: 814  NPKQLALLIQG-NLDYADEINHYLNNNFTQHLKVCDEGNRPTIRLYPSPNTKNIDPGTNA 872

Query: 852  FFKRVGFHDDPNNSIVYFIQTGERDNNYIYTLTVLTEFIMSQTLVPDLRQKKQIGYIVLG 911
            F    G  DDPNNS+ YFIQT +RDN    TLT LTE+I SQTLVPDLR KKQIGYIVL 
Sbjct: 873  FISCNGHQDDPNNSLAYFIQTAQRDNIENLTLTFLTEYIFSQTLVPDLRNKKQIGYIVLS 932

Query: 912  GLRVLSDTVGLHITTMAGSPPEFLEEKINEYLAYLEDMVLAKLTAPQFKHDYVDELLSLL 971
            GLR+L+DT+G+HIT M+GS    LE KINEYL+YLE  VL   T   F+   ++  L+LL
Sbjct: 933  GLRILTDTIGIHITVMSGSSAHSLETKINEYLSYLEFQVLNNFTESTFRTMLLEPFLALL 992

Query: 972  TSNSLGKLEKTSGPANLMSQIEANVHSGQRN--TSLAMKSHKRLRTQISYRRYNFDEDDE 1029
              N+  KL+  SGP+NL+++I ANV +G      +  MK H+R+R  IS +R +F E++E
Sbjct: 993  KKNNFNKLKTLSGPSNLLNEIVANVQNGDDYILNNRQMKHHRRIRNSISEKRLHFQEENE 1052

Query: 1030 PVDARTLQNLKLSEYMRFFRQRISIYSGKRAKLSIMVYSAMSKEEVQGKMLYLQIESFLK 1089
             VD   LQ L L +Y+ FF  RISIYS +R+KLSIM+ S M++EE+  + ++LQ+E+FLK
Sbjct: 1053 MVDILFLQKLTLKKYLEFFGSRISIYSRQRSKLSIMITSPMAEEEIASRKMFLQLEAFLK 1112

Query: 1090 MKGFNIPSKDLNAIVQKSKGKPTALLKGLLSYFRSQGESLKLLSTVLREVVK 1141
            +KGF I S+DL  IV+ SKG P  LLK L ++FR + E+ KL + VL+E+ K
Sbjct: 1113 IKGFAIKSRDLEKIVEDSKGSPVLLLKNLFTFFRKRSEAFKLGTVVLKEISK 1164

>ZYRO0C06336g Chr3 (479075..482644) [3570 bp, 1189 aa] {ON} similar to
            uniprot|P40851 Saccharomyces cerevisiae YPR122W AXL1
            Haploid specific endoprotease that performs one of two
            N-terminal cleavages during maturation of a- factor
            mating pheromone required for axial budding pattern of
            haploid cells
          Length = 1189

 Score =  875 bits (2260), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 486/1187 (40%), Positives = 723/1187 (60%), Gaps = 20/1187 (1%)

Query: 10   FDVKLYTPXXXXXXXXXXXXXXXXXXTFLISDPSETVASCAVSIATGSHNDPVEIPGLAH 69
            +D+   TP                  T LISDP+E  ++C++S+A+GSHNDP EIPGLAH
Sbjct: 9    YDIPFLTPFSFEGRTHKLCKLPNGLLTLLISDPTENSSACSLSVASGSHNDPSEIPGLAH 68

Query: 70   FCEHMVLSSGSKRHPEPNAFHETLSKNNGSQNAHTSGEQTSFYFELPSSQSSDSLVFDQV 129
             CEHMVL++GS+++P+P  +HE + KN GSQNA T+GEQTSFYFELP+   S    FD+ 
Sbjct: 69   LCEHMVLAAGSRKYPDPGYYHEMIMKNGGSQNAFTTGEQTSFYFELPNIYHSLQEGFDEA 128

Query: 130  VGILADALKEPIFHDVLINKEIYAINSEHVGNKSSLTKMMYHAVRLLASPEHPFHQFGTG 189
            + + A    EP+F+  LINKE YAI SEH  N SS  K+ Y A RLLA+  HPF +F TG
Sbjct: 129  LDVFASFFSEPLFNSTLINKETYAIESEHDVNLSSQGKIFYQATRLLANGNHPFSRFSTG 188

Query: 190  NIFTLTNMPKLHKLSLKNELVKYFREHFFAENMVLCLRGPQSLNQLSKIAQARFSDIPSI 249
            NI TL ++P L  L+LKN L +YF+E+F A  M LCLRGPQS++ L+K+A  +FS I + 
Sbjct: 189  NISTLNSIPHLKNLNLKNLLHEYFKENFCASKMTLCLRGPQSIHSLAKLALTKFSLIKNN 248

Query: 250  PTLQVPRLLRWRSSSSFDKNRNLSVRPLESFQILKDAWSARYAKKPVFDKTPMHNSIMVQ 309
            P    P      S S    N  + V P E   I K+ W  +Y  +  F        I ++
Sbjct: 249  PQRYRPSPPVSPSKSKRSSNEWVEVNPKE-MNISKNTWLPKYRGQLCFTSDEQEKFIFIK 307

Query: 310  SSKSPVIRFVFPINYFSTRFTDRELATYTQIWCELLGDECEGSLCHYLRSHSYITELIAY 369
            SSK+P +RF+FP    +TRFT +++   T +W EL GDE  GS  H+L+S  ++T   A+
Sbjct: 308  SSKNPAVRFIFPAMERNTRFTSKDIKILTHLWPELFGDESPGSFSHWLQSKGWVTYSYAF 367

Query: 370  SSNFAVNDTGLILQLHLTNHGWLNVQKIIPIVWKYLIPAILDAPLSSLAQYISELNSLDL 429
             S  A+ ++ LIL+L LT  G+ N+  I  ++++  IPA+       LAQ++S+ N +DL
Sbjct: 368  VSEVAIGNSNLILELDLTRTGFQNLSHIAKVLFEQAIPALSQKNTLELAQFMSKQNCIDL 427

Query: 430  LKFLYQELERSPMDRCADLCESLLQDLSAIDLSFLLKSTLTYFECNNLSVANLGTYRENQ 489
            ++FLYQ  E SPM+ C +L   +  DL A+D +++ K +    +  +    N+G Y EN+
Sbjct: 428  IRFLYQNAEISPMEECVNLSSLMQDDLEALDPAYIFKGSPMMIDEQH---HNIGNYGENK 484

Query: 490  TSKDWWRGEAVKFQAFVNEFMSQDTVRIILLGNLSKCYF-NCNPDKITTDTYFEYEYVKI 548
             S  WW G+A+KFQ+F+ +FM Q  +R+++ GN  +      +  +   D ++E+EY K 
Sbjct: 485  ESDRWWIGQAIKFQSFLKQFMVQSNMRVVVSGNSRESQLEELSSQEFQVDLFYEFEYFKR 544

Query: 549  ----FIDLEVLGCDDIHYRFTIPGPNPFMVPVGHKLSFIKHALLASSVQSENSALSVVAQ 604
                F D+     D   Y F IP  +  M  +    S +K  L  SS +S+++ LS    
Sbjct: 545  DGIPFKDILEWNND---YNFKIPQLDCPMPDIAKSYSQLKKILNDSSQKSQSAPLSFTIH 601

Query: 605  SDLVRASPRLAGKNSYYELWLKEEDVDLSFRSKSIFSMELISTSLEPAPEYTMHLEILGQ 664
            ++L++  P L  +N Y+E+W+  +D D S   KSI S E+    LE  P  TM+LEILGQ
Sbjct: 602  NNLLKPVPHLVSQNCYHEMWVMPDDEDPSLHLKSIVSFEIFGLDLEACPRNTMNLEILGQ 661

Query: 665  LLYSILGPILYPAERAGYTYELSLSSKGDVRLGLTISGFTDGILNLLKIIVDAIVNLSQD 724
            +++ +L P +YP+ + G+T E++ S+KGD+RLG TISGF+  + + +K I++ I  +SQD
Sbjct: 662  IIFILLSPEIYPSLKLGFTCEIT-SNKGDIRLGFTISGFSKQLTSFVKSIIETIKRISQD 720

Query: 725  LNSIPKDIFRKARILVRTKYKEASSESCVTLASLGLLILLENCMWPLEDRLEALEDIYVE 784
             + + K+  R+ARILVR KY+ A++E+C  + S+GL I+LE  MW LEDRLEALEDI ++
Sbjct: 721  PDFLSKETLRRARILVRNKYENAANENCANIGSIGLYIVLEKYMWTLEDRLEALEDIDMD 780

Query: 785  SFRIFLEKFINGDNYLNILIQGSDMTIADNINEYLSERLTHHISRA--DDNVCRLSEPAT 842
            +F+ F + F+    YL++ +QG D++ AD +NEYL    THH+     +      +   T
Sbjct: 781  NFKQFCQSFLGSKKYLSLFVQG-DLSCADELNEYLHRSFTHHLGGGIYETQGKTFTVETT 839

Query: 843  YVIPEGSNLFFKRVGFHDDPNNSIVYFIQTGERDNNYIYTLTVLTEFIMSQTLVPDLRQK 902
             ++  G+N   +  G  DDPNNSI+YFIQTG R++  I+TLT  T FIMS  L  +LR K
Sbjct: 840  KMLEPGTNACVQHGGQKDDPNNSIIYFIQTGRRNDRMIFTLTNFTVFIMSLNLALELRNK 899

Query: 903  KQIGYIVLGGLRVLSDTVGLHITTMAGSPPEFLEEKINEYLAYLEDMVLAKLTAPQFKHD 962
            +Q+GY+V+GGLR+LS++VGLHIT M+G  P  LE KI+EYL YLE   L KL    F  +
Sbjct: 900  RQVGYLVIGGLRLLSNSVGLHITIMSGGSPLDLETKIDEYLWYLESQ-LQKLDEQTFHQE 958

Query: 963  YVDELLSLLTSNSLGKLEKTSGPANLMSQIEANVHSGQRN--TSLAMKSHKRLRTQISYR 1020
            YV   L LL     G   ++SGPA+L+S++ ANV  G     +S  MK HK+L+TQI   
Sbjct: 959  YVRCYLQLLDGGCRGDANESSGPADLLSELVANVQIGDSEILSSQTMKRHKKLQTQIIQE 1018

Query: 1021 RYNFDEDDEPVDARTLQNLKLSEYMRFFRQRISIYSGKRAKLSIMVYSAMSKEEVQGKML 1080
            +Y+F  + E +D   +  + L +Y+ FF+  ISI+S  R+K+SIM+ S+++++++  K +
Sbjct: 1019 QYDFVTESEALDDDLISQMSLEQYLSFFKHYISIHSKLRSKISIMISSSIAEKDIINKKI 1078

Query: 1081 YLQIESFLKMKGFNIPSKDLNAIVQKSKGKPTALLKGLLSYFRSQGESLKLLSTVLREVV 1140
            +LQ+E+FLK+KGF IP+ +L  IV++S GKP  L   L S FR++ ++L+L S +L E+ 
Sbjct: 1079 FLQLETFLKIKGFAIPADELKDIVERSNGKPKILAMELYSCFRTRNDALRLCSVILAELF 1138

Query: 1141 KQLF-SKAXXXXXXXXXXXXXXXLQAMSQHVTPAITLEQVPEVNSYR 1186
            K L  S                 LQ  S  V PA+ L+ + ++N ++
Sbjct: 1139 KMLAKSLRHRYGNLAHDDTSKRDLQEWSTDVKPALDLKVIEDINFFK 1185

>TDEL0F03400 Chr6 (628126..631638) [3513 bp, 1170 aa] {ON} Anc_3.455
            YPR122W
          Length = 1170

 Score =  870 bits (2247), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 458/1159 (39%), Positives = 695/1159 (59%), Gaps = 33/1159 (2%)

Query: 38   LISDPSETVASCAVSIATGSHNDPVEIPGLAHFCEHMVLSSGSKRHPEPNAFHETLSKNN 97
            LISDP+E+V++C++++A GS+ND  ++PG+AH CEHM+L+ GSK++P P  +H+ ++KNN
Sbjct: 37   LISDPTESVSACSLTVAAGSYNDSDDVPGVAHLCEHMLLAGGSKKYPSPGCYHDMITKNN 96

Query: 98   GSQNAHTSGEQTSFYFELPSSQSSDSLVFDQVVGILADALKEPIFHDVLINKEIYAINSE 157
            GS NA T+GEQT+FYFELP    +    F++ + I A    EP+F   LINKEIYAI +E
Sbjct: 97   GSYNAFTTGEQTTFYFELPDFNQAPEAGFEKAIDIFASFFSEPLFDHTLINKEIYAIQNE 156

Query: 158  HVGNKSSLTKMMYHAVRLLASPEHPFHQFGTGNIFTLTNMPKLHKLSLKNELVKYFREHF 217
            H  N S++TK++YHA RLL    HPF +F TGN+ +L N  +L   +L+N L  +FRE++
Sbjct: 157  HDSNVSNVTKILYHATRLLGDKSHPFSRFATGNMSSLKNTLRLKGPTLRNLLSNHFRENY 216

Query: 218  FAENMVLCLRGPQSLNQLSKIAQARFSDIPSIPTLQVPRLLRWRSSSSFDKNRNLSVRPL 277
                M +CLRGP S+N L+K+A ++F ++              R   + +K +  ++ P 
Sbjct: 217  APSRMTICLRGPSSVNGLAKLAISKFGEL--------------RPHKANEKVQ-AALTPN 261

Query: 278  ESFQILKDAWSARYAKKPVFDKTPMHNSIMVQSSKSPVIRFVFPINYFSTRFTDRELATY 337
            + F IL+  W    A    F      N+I V S K P++RF+FP+    TRFT ++   +
Sbjct: 262  DGFNILQTRWGHTKAANNCFPSCLERNTICVDSGKLPIMRFLFPVWQKFTRFTKKDFLIF 321

Query: 338  TQIWCELLGDECEGSLCHYLRSHSYITELIAYSSNFAVNDTGLILQLHLTNHGWLNVQKI 397
             + W EL GDE  GS CH+L    +IT   AY S F+ ++TGLIL+L LTN GW N++ I
Sbjct: 322  ERFWFELFGDESAGSFCHFLVEKGWITNCYAYISRFSTDNTGLILELSLTNSGWHNIELI 381

Query: 398  IPIVWKYLIPAILDAPLSSLAQYISELNSLDLLKFLYQELERSPMDRCADLCESLLQDLS 457
               +  YL+P         LA+++SE  S+DL++FLY   E SPM  C++LCE L +D++
Sbjct: 382  AQTLIFYLVPKFSREHTVQLARFLSEQFSIDLIRFLYSNAENSPMTECSNLCEVLQEDIN 441

Query: 458  AIDLSFLLKSTLTYFECNNLSVANLGTYRENQTSKDWWRGEAVKFQAFVNEFMSQDTVRI 517
             +D S +   +           +  G + EN+ S+ WW G+A+KFQ+F+ EFM+   +R+
Sbjct: 442  GLDNSCIFMGSPMVLN----EQSTQGLFSENEESQKWWIGQAIKFQSFLKEFMNHSNMRL 497

Query: 518  ILLGNLSKCYFNCNPDK---ITTDTYFEYEYVKIFIDLEVLGCDDIH-YRFTIPGPNPFM 573
            ILLG L  C  +    +     TD ++++ Y    + L     + ++ Y+F+IP  N F 
Sbjct: 498  ILLGCLEDCSLSTTATQGKIAGTDPFYDFAYFTCKLSLRKPHANILNDYKFSIPPKNEFK 557

Query: 574  VPVGHKLSFIKHALLASSVQSENSALSVVAQSDLVRASPRLAGKNSYYELWLKEEDVDLS 633
                     +   L  SS +S+ ++L    +SD    +P+L  +N  Y++W+  +    S
Sbjct: 558  PSWAENFPSLMRKLYYSSTKSQQASLGFAIKSDEGTRTPQLVSQNENYDMWVLSDCPASS 617

Query: 634  FRSKSIFSMELISTSLEPAPEYTMHLEILGQLLYSILGPILYPAERAGYTYELSLSSKGD 693
             +SK+I S E+    ++P+PE TM+LEIL Q++   L   LYP+ + G+T+E+  SS+GD
Sbjct: 618  HQSKAIVSFEISCWEIQPSPENTMNLEILAQVINLTLASDLYPSLKLGFTFEIYPSSRGD 677

Query: 694  VRLGLTISGFTDGILNLLKIIVDAIVNLSQDLNSIPKDIFRKARILVRTKYKEASSESCV 753
            VRLGL ISG++  +  +++ +   I  L  + +   +++FRKARI VR+ Y +A   S +
Sbjct: 678  VRLGLVISGYSKRLGKVIESLSSIIRRLKSEKSFPSRELFRKARISVRSNYDKAEDNSSI 737

Query: 754  TLASLGLLILLENCMWPLEDRLEALEDIYVESFRIFLEKFINGDNYLNILIQGSDMTIAD 813
             +AS+GLL+++E  MW L+DR++A+E I +++F+ F   F +   +L + IQG D++ AD
Sbjct: 738  NVASIGLLVVMEKYMWSLQDRIDAIECIDLQTFKAFAASFADYRKFLRLFIQG-DLSHAD 796

Query: 814  NINEYLSERLTHHISRADDNVCRLSE-PATYVIPEGSNLFFKRVGFHDDPNNSIVYFIQT 872
            +IN  L   LT+H+     +  R  E  +T ++   +N + +  G  DDP NS VY+IQT
Sbjct: 797  DINACLDRNLTNHLHGTQTDFQREPEYCSTKLLDPATNFYVEYPGRKDDPTNSTVYYIQT 856

Query: 873  GERDNNYIYTLTVLTEFIMSQTLVPDLRQKKQIGYIVLGGLRVLSDTVGLHITTMAGSPP 932
            G RD+   YTLT L+ ++MS TL P+LR K+QIGY+V+GGLR+L + VGLHI+ M+   P
Sbjct: 857  GPRDDCTAYTLTALSAYMMSFTLKPELRNKRQIGYVVMGGLRLLRNAVGLHISIMSTLEP 916

Query: 933  EFLEEKINEYLAYLEDMVLAKLTAPQFKHDYVDELLSLLTSNSLGKLEKTSGPANLMSQI 992
              LEEKINEYL YLE  VL  +T   F++ Y+ + L+L +  +L KL K SGPA+LM QI
Sbjct: 917  LALEEKINEYLLYLEREVLTPMTEDTFRNKYLKDFLNLQSKGNLDKLRKDSGPADLMDQI 976

Query: 993  EANVHSGQRN--TSLAMKSHKRLRTQISYRRYNFDEDDEPVDARTLQNLKLSEYMRFFRQ 1050
             ANV SG  +   S  MK HKRLR QI+  RY F + D  ++   LQ L +  Y+ FFR+
Sbjct: 977  VANVQSGDSDILNSSFMKKHKRLRNQIADGRYTFADRDSAINTTLLQELTIDHYLCFFRE 1036

Query: 1051 RISIYSGKRAKLSIMVYSAMSKEEVQGKMLYLQIESFLKMKGFNIPSKDLNAIVQKSKGK 1110
            RISI+S  RAKLS+MV S M+ EE+  + +Y Q+++FLK+ G  I +  L  +VQ+SKGK
Sbjct: 1037 RISIHSKTRAKLSVMVKSPMTDEEIVNRQIYSQVDAFLKLHGLTIETAKLRELVQRSKGK 1096

Query: 1111 PTALLKGLLSYFRSQGESLKLLSTVLREVVKQLFSKAXXXXXXXXXXXXXXXLQAMSQHV 1170
            P  L K L   F S+ E+ KL + +LRE++K L                   + A     
Sbjct: 1097 PMLLAKELYQSFHSRHETWKLCTVMLRELLKML------TVNLKFRHQRQTNMAASEWGS 1150

Query: 1171 TPAITLEQVPEVNSYRSNI 1189
            TPA  L  + ++N YR  +
Sbjct: 1151 TPATGLTLIKDINIYRKEV 1169

>TBLA0C05450 Chr3 complement(1312984..1316592) [3609 bp, 1202 aa] {ON}
            Anc_3.455 YPR122W
          Length = 1202

 Score =  840 bits (2169), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 482/1216 (39%), Positives = 738/1216 (60%), Gaps = 54/1216 (4%)

Query: 3    LNTKPAVFDVKLYTPXXXXXXXXXXXXXXXXXXTFLISDPSETVASCAVSIATGSHNDPV 62
            +NTK   FD+  Y P                    LISD S T  +C++S+ATGSH+DP 
Sbjct: 4    INTK--TFDIDFYLPSSYSNRNQKLCRLPNGILALLISDNSVTTTACSISVATGSHSDPR 61

Query: 63   EIPGLAHFCEHMVLSSGSKRHPEPNAFHETLSKNNGSQNAHTSGEQTSFYFELPSSQSSD 122
            +IPG+AH CEHM+L++GSK++P+P  FHE L+ NNGSQNA T+GEQT+FYFELP+S + +
Sbjct: 62   DIPGIAHLCEHMILAAGSKKYPKPGLFHEVLAANNGSQNAFTTGEQTTFYFELPTSTAIE 121

Query: 123  SLVFDQVVGILADALKEPIFHDVLINKEIYAINSEHVGNKSSLTKMMYHAVRLLASPEHP 182
               F +++ I +   K+P+F++VL NKEIYAI SEH GN S+ +K++YHA RLL++  HP
Sbjct: 122  QNTFGEILDIFSSFFKKPLFNEVLTNKEIYAIESEHDGNMSNTSKILYHAERLLSNKSHP 181

Query: 183  FHQFGTGNIFTLTNMPKLHKLSLKNELVKYFREHFFAENMVLCLRGPQSLNQLSKIAQAR 242
            FH F TGNI TL+ +  L K +LK  L +YF+ ++F+ NM +C++GPQSLN L+K+A A 
Sbjct: 182  FHNFSTGNIHTLSKVVNLKKYNLKEMLFEYFKNNYFSRNMTICIKGPQSLNSLTKLALAN 241

Query: 243  FSDIPSIPTLQVPRLLRWRSSSS---------------FDKNRNLSVRPLESFQILKDAW 287
            F DI     L    +   +   S               F  N NL    LE+F++L +AW
Sbjct: 242  FGDIKDKDELTKFHINSIKPQKSLRISKSRSSISSCNSFKTNENLD---LENFKLLDNAW 298

Query: 288  SARYAKKPVFDKTPMHNSIMVQSSKSPVIRFVFPINYFSTRFTDRELATYTQIWCELLGD 347
              +Y     F  +  HN+I + SSK P++R +FPI+   TRFT R++  Y+ IWC + GD
Sbjct: 299  LDKYGDNVCFPTSLSHNTIFLSSSKQPILRLLFPISEKLTRFTKRDIKIYSNIWCHIFGD 358

Query: 348  ECEGSLCHYLRSHSYITELIAYSSNFAVNDTGLILQLHLTNHGWLNVQKIIPIVWKYLIP 407
            E +GS C YL  +++ITE  A+ S FA+ +T LIL+L LTN G   +Q II I+ + ++ 
Sbjct: 359  ETKGSFCDYLNKNNWITECYAFKSTFAIGNTSLILELKLTNTGVKKLQNIIDILLQQVVK 418

Query: 408  AILDAPLSSLAQYISELNSLDLLKFLYQELERSPMDRCADLCESLLQDLSAIDLSFLL-K 466
             ++D    +LA +++E N + +L+F+  ++E +PMD C++L   L ++    +  +L   
Sbjct: 419  LLVDNFTENLAYFLAENNIISILRFINSDVEINPMDECSELSGLLQENFKLFNPKYLFYG 478

Query: 467  STLTYFECNNLSVANLGTYRENQTSKDWWRGEAVKFQAFVNEFMSQDTVRIILLGNLSKC 526
            S     E  +L   N   +  N T+  +W G+A+KFQ F+ EFM+ + ++I+ +G++ + 
Sbjct: 479  SEFLLLENESLPQKN-NMFDGNSTT--FWIGQAIKFQTFLKEFMNWENIKIVGIGDIDEF 535

Query: 527  YFNCNPDK---ITTDTYFEYEYVKIFIDLEVLGCDDIHYRFTIPGPNPFMVPVGHKLSFI 583
                N  K     TD Y+E+EY K+ I  +   C    Y FT P  N ++   G+ L  +
Sbjct: 536  KNVLNIVKEMSKKTDLYYEFEYQKLKISKKSRICPR-DYPFTYPIKNEYLPKFGYNLG-L 593

Query: 584  KHALLASSVQSENSALSVVAQSDLVRASPRLAGKNSYYELWLKEEDV-DLSFRSKSIFSM 642
               +L ++++S  +    + Q        +L  +N  ++LW+  ++  D    S  I S 
Sbjct: 594  LRNILLNNLESSRTVSFYMPQVSEEEDQNKLVSQNDMHKLWVNPKNSKDQLSESPCIVSF 653

Query: 643  ELISTSLEPAPEYTMHLEILGQLLYSILGPILYPAERAGYTYELSLSSKGDVRLGLTISG 702
            +L++ S++ +PE TMHLE++GQLL+++L   LYPA   GYT+E+S S +GDV L  T+SG
Sbjct: 654  KLVNNSIQESPESTMHLELMGQLLHTLLINKLYPALNVGYTFEISPSVRGDVSLSFTLSG 713

Query: 703  FTDGILNLLKIIVDAIVNL-SQDLNSIPKDIFRKARILVRTKYKEASSESCVTLASLGLL 761
            F++GI  ++K  ++    L S DL  I K  FR+ARILVR KY++A+S+SCV LAS+GLL
Sbjct: 714  FSEGIFKIIKECINIFGELTSSDL--ITKKEFRRARILVRDKYEDAASDSCVKLASVGLL 771

Query: 762  ILLENCMWPLEDRLEALEDIYVESFRIFLEKFINGDNYLNILIQGSDMTIADNINEYLSE 821
            ILLE  MW LE+R++ALE I +E F  F +KF   + +L++ I+G ++  AD IN Y S+
Sbjct: 772  ILLERKMWTLEERIDALELIDLEMFLEFAQKFFQ-NLFLSLYIEG-NLEYADLINSYFSD 829

Query: 822  RLTHHISR-----ADDNVCRLSEPATYVIPEGSNLFFKRVGFHDDPNNSIVYFIQTGERD 876
            +L HH+++      +D +  L  P+T +I  G+N++++  G  DDPNNSIVYFIQTG+  
Sbjct: 830  KLVHHLTKRLDYPKEDTLQSL--PSTKLI-SGTNIYYELEGSVDDPNNSIVYFIQTGDLS 886

Query: 877  NNYIYTLTVLTEFIMSQTLVPDLRQKKQIGYIVLGGLRVLSDTVGLHITTMAGSPPEFLE 936
            N  I +LT LT FI+S +LVP+LR KKQIGY+V GGLR LSDTVGLHIT M+   P  +E
Sbjct: 887  NKKILSLTSLTAFIISFSLVPELRNKKQIGYVVFGGLRTLSDTVGLHITIMSDGKPLDIE 946

Query: 937  EKINEYLAYLEDMVLAKLTAPQFKHDYVDELLSLLTSNSLGKLEKTSGPANLMSQIEANV 996
             +I +Y++YLE  +L  L    F+++Y+ + + L+        E+TSGP N+M++I ANV
Sbjct: 947  IEIEKYISYLEFDLLGNLDDETFQNNYLIKYIDLINGIYKKSTEQTSGPINIMNEIIANV 1006

Query: 997  HSGQRNTSLAMKSHKRLRTQIS----YRRYNFDEDDEPVDARTLQNLKLSEYMRFFRQRI 1052
            H G    S  + S K    + +    +      E+ + VD   L+NL L +Y++FF+  I
Sbjct: 1007 HGGD---SAILNSEKIKNHKKNKNELFGDAQMTEELKYVDIEFLKNLNLIKYLQFFKGSI 1063

Query: 1053 SIYSGKRAKLSIMVYSAMSKEEVQGKMLYLQIESFLKMKGFNIPSKDLNAIVQKSKGKPT 1112
            S  S +R+KLSI + S M + E+  + L+LQ+++FLK+KGF I S +L  IV+++ G+PT
Sbjct: 1064 STNSKRRSKLSIHIKSPMEERELFNRKLFLQLQTFLKIKGFPIKSNELQQIVERTNGRPT 1123

Query: 1113 ALLKGLLSYFRSQGESLKLLSTVLREVVKQLFSKAXXXXXXXXXXXXXXXLQA---MSQH 1169
             L K L + F+++ ES K +S VL+E++K + S +               +Q     + H
Sbjct: 1124 LLFKELFACFKARDESWKFISIVLKEILK-VISMSIKQQCKTRGSETRSSIQHSEFHNDH 1182

Query: 1170 VTPAITLEQVPEVNSY 1185
            +     LE+V ++N Y
Sbjct: 1183 IITPTPLEKVEDINKY 1198

>KNAG0A07740 Chr1 complement(1226949..1230542) [3594 bp, 1197 aa] {ON}
            Anc_3.455 YPR122W
          Length = 1197

 Score =  832 bits (2149), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 460/1138 (40%), Positives = 690/1138 (60%), Gaps = 48/1138 (4%)

Query: 37   FLISDPSETVASCAVSIATGSHNDPVEIPGLAHFCEHMVLSSGSKRHPEPNAFHETLSKN 96
             LISDP +  + C+V++ATGSHNDP  +PGLAH CEHM+ ++GSK++P+ + +H+TLSK 
Sbjct: 36   LLISDPEDNASVCSVTVATGSHNDPKGVPGLAHLCEHMLFAAGSKKYPDVDKYHQTLSKT 95

Query: 97   NGSQNAHTSGEQTSFYFELPSSQSSDSLVFDQVVGILADALKEPIFHDVLINKEIYAINS 156
             G+ NA+T+GEQT+F+  +P+      L FD ++ + +  LKEP+F+   +NKEIYAI S
Sbjct: 96   GGTHNAYTTGEQTTFHISVPNMNREGELEFDCILDMFSSFLKEPLFNSTAMNKEIYAIQS 155

Query: 157  EHVGNKSSLTKMMYHAVRLLASPEHPFHQFGTGNIFTLTNMPKLHKLSLKNELVKYFREH 216
            EH  N SSL+K++Y A+RL+A+  HPF QF TGNI TL NMP +  ++L+  LV YF  +
Sbjct: 156  EHDSNVSSLSKILYQAIRLMANGNHPFSQFSTGNIHTLKNMPLVTGMNLRTLLVNYFETN 215

Query: 217  FFAENMVLCLRGPQSLNQLSKIAQARFSDIPSIPTLQVPRLLRWRSSSSFDKNRNLSVRP 276
            F   N+ +C++G QS+N L+K+A   F  I S    +   + R  S     ++    ++ 
Sbjct: 216  FQPRNITVCIKGSQSVNILTKLALTNFGYIQSSRAAKGNVIRRSISKRDSIRSNGKKLKK 275

Query: 277  LESFQILKDAWSARYAKKPVFDKTPMHNSIMVQSSKSPVIRFVFPINYFSTRFTDRELAT 336
            +ESF+IL+ AW A+Y     FD    +N ++++S+K   +RF+FP+N     FT +EL  
Sbjct: 276  IESFRILEKAWKAKYKDIKCFDDR--NNFMIIKSNKQSTMRFLFPVNESGANFTPKELKI 333

Query: 337  YTQIWCELLGDECEGSLCHYLRSHSYITELIAYSSNFAVNDTGLILQLHLTNHGWLNVQK 396
            ++ IW EL GDE +GSL  Y    S+ITE   Y S+F     GLILQ  LT  GW N+++
Sbjct: 334  FSGIWRELFGDESKGSLHSYFIEKSWITETTTYISDFTYGVYGLILQFSLTASGWENLRE 393

Query: 397  IIPIVWKYLIPAILDAPLSSLAQYISELNSLDLLKFLYQELERSPMDRCADLCESLLQDL 456
            II  V+K  +  +    L+SL++ + E  +++ + +LYQE E    D C++L E L   L
Sbjct: 394  IISKVFKGTLELVRWENLNSLSRILFEHTTIEYINYLYQEQEVLSSDFCSELTELLQHSL 453

Query: 457  SAIDLSFLLKSTLTYFECNNLSVANLGTYRENQTSKDWWRGEAVKFQAFVNEFMSQDTVR 516
               +L +L K +    E NN    NL       T   WW  +A+KFQ F+NEFM    V+
Sbjct: 454  RTPELEYLFKESPNLIELNNDHSENL------MTVTPWWFDQAMKFQNFINEFMKVTNVK 507

Query: 517  IILLGNLSK--CYFNC---NPDKITTDTYFEYEYVKIFIDLEVL---GCDDIH-YRFTIP 567
            + LLG+  K   +F     N D  +TD Y+ ++Y+K  ++ + +    C  ++ Y   +P
Sbjct: 508  LFLLGSELKHNAFFELGSQNKD-WSTDAYYGFDYIKSHLNFKQIIDEPCTTVNDYSLALP 566

Query: 568  GPNPFMVPVGHKLSFIKHALLASSVQSENSALS-VVAQSDLVRASPRLAGKNSYYELWLK 626
              N F+      L+ ++   +  S++S  + L   V  S L    PRL  ++S+YE+W+ 
Sbjct: 567  SKNLFIPQFFQNLANLQQIFMEYSLRSRFAVLQPQVPTSMLPNQKPRLVNRSSHYEMWIL 626

Query: 627  EEDVD---------LSFRSKSIFSMELISTSLEPAPEYTMHLEILGQLLYSILGPILYPA 677
              D +         +  +S   FS+E  S ++ P+   TMHLEILG++L  +L   LYP+
Sbjct: 627  PIDKEPESVASPDRIPKQSTVTFSIE--SLTMTPSSMNTMHLEILGEVLNFLLTSDLYPS 684

Query: 678  ERAGYTYELSLSSKGDVRLGLTISGFTDGILNLLKIIVDA--IVNLSQDLNSIPKDIFRK 735
             +  Y YE++ S KGDV+L  TI GF+DG++ +   I+    ++      N +   + RK
Sbjct: 685  LQLSYAYEIATSLKGDVQLCCTICGFSDGVVKITDYILSTLRLIGDPATANIVTNSLLRK 744

Query: 736  ARILVRTKYKEASSESCVTLASLGLLILLENCMWPLEDRLEALEDIYVESFRIFLEKFIN 795
            ARI VR+KY+ ASSE CV LAS+GLLI+LE  MW LEDRLEALED  + SF+ F  +F+ 
Sbjct: 745  ARIQVRSKYEAASSEICVKLASMGLLIVLERGMWTLEDRLEALEDSDMSSFQQFCHEFVM 804

Query: 796  GD--NYLNILIQGSDMTIADNINEYLSERLTHHISRADDNVCRLSEP------ATYVIPE 847
             D  NYLN+ +QG DM  AD +N  +  +LTHH+     N  R S P      +T V+  
Sbjct: 805  NDSGNYLNLFVQG-DMRYADEVNCLIHSKLTHHL-----NSSRCSTPTTDYRRSTTVLKP 858

Query: 848  GSNLFFKRVGFHDDPNNSIVYFIQTGERDNNYIYTLTVLTEFIMSQTLVPDLRQKKQIGY 907
            G N + +  G  DDPNNSIV+F+Q G R++   +TL   T ++M  TLVPDLR KKQIGY
Sbjct: 859  GVNYYVEYPGQGDDPNNSIVHFVQVGLRNDRAAFTLAHFTAYLMHLTLVPDLRYKKQIGY 918

Query: 908  IVLGGLRVLSDTVGLHITTMAGSPPEFLEEKINEYLAYLEDMVLAKLTAPQFKHDYVDEL 967
            +VLGGLR+++DTVGLHIT M+      LE+KI+EY+ YLED VL  LT  QF+  Y+   
Sbjct: 919  VVLGGLRIMTDTVGLHITVMSAGQCLDLEDKIDEYMMYLEDTVLNALTESQFEEIYLKPY 978

Query: 968  LSLLTSNSLGKLEKTSGPANLMSQIEANVHSGQRNT--SLAMKSHKRLRTQISYRRYNFD 1025
            + L+  +++G+++ + GP NL+S+I  NV +G  +    + MK HK+L   I  + Y+F 
Sbjct: 979  IRLIGEHTVGEMDTSGGPTNLLSEIYPNVQNGHSSVLEGIDMKRHKQLWNLIQAKEYDFL 1038

Query: 1026 EDDEPVDARTLQNLKLSEYMRFFRQRISIYSGKRAKLSIMVYSAMSKEEVQGKMLYLQIE 1085
            + ++ +D   +Q L L  YM FF++++S  S  R+K+SIM+ S M +EE+  + ++LQ+E
Sbjct: 1039 QGNDILDRTVVQGLTLHRYMTFFKEKLSARSTTRSKISIMIDSPMKREEIMNRQMFLQME 1098

Query: 1086 SFLKMKGFNIPSKDLNAIVQKSKGKPTALLKGLLSYFRSQGESLKLLSTVLREVVKQL 1143
            +FLKMKGF I   +L  IV KS+G PT LL+ LL++F+++GE+ KL   + +EV K L
Sbjct: 1099 TFLKMKGFAIKDTELRDIVNKSQGSPTQLLRHLLAHFKTRGENWKLCRVIAKEVGKLL 1156

>TPHA0D04060 Chr4 (867294..870899) [3606 bp, 1201 aa] {ON} Anc_3.455
            YPR122W
          Length = 1201

 Score =  787 bits (2032), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 438/1159 (37%), Positives = 680/1159 (58%), Gaps = 47/1159 (4%)

Query: 5    TKPAVFDVKLYTPXXXXXXXXXXXXXXXXXXTFLISDPSETVASCAVSIATGSHNDPVEI 64
            T+   +D+ +Y P                  T +ISDPS  +ASC++S+ATGSHNDP  I
Sbjct: 4    TQVKNYDIPIYIPASSRGMDYKLCRLPNGILTMVISDPSREMASCSLSVATGSHNDPSVI 63

Query: 65   PGLAHFCEHMVLSSGSKRHPEPNAFHETLSKNNGSQNAHTSGEQTSFYFELPSSQSSDSL 124
            PGLAH CEHM+LS+GSK++P+PN++H+ +S++NGS NA+T+GEQT+FYFE+P   +S   
Sbjct: 64   PGLAHLCEHMILSAGSKKYPDPNSYHKLISESNGSHNAYTTGEQTTFYFEIPCLFTSSES 123

Query: 125  VFDQVVGILADALKEPIFHDVLINKEIYAINSEHVGNKSSLTKMMYHAVRLLASPEHPFH 184
             F++++ I + + K+P+F +  +NKEIYAI SEH GN  +LTK++YHA RLLA+ +HPF 
Sbjct: 124  NFERLLDIFSSSFKDPLFKETSVNKEIYAIESEHDGNTCNLTKILYHATRLLANSKHPFS 183

Query: 185  QFGTGNIFTLTNMPKLHKLSLKNELVKYFREHFFAENMVLCLRGPQSLNQLSKIAQARFS 244
            +F TGNI TL    KL K + K  L  YF+ ++ A NM LC++GPQS+N L+K A   F+
Sbjct: 184  RFSTGNITTLGKGAKLLKTTSKKLLESYFKTNYNASNMTLCIKGPQSVNVLTKYALTYFN 243

Query: 245  DIPS--------IPTLQVPRLLRWRSS-------SSFDKNRNLSVRPLESFQILKDAWSA 289
             I          I +L+ P  +  R S       S+  K      R LE F IL +A++ 
Sbjct: 244  GIDDSIRNDNTFIKSLKSPVYMHQRFSFSSLSQESAMSKGNEEDCR-LEDFHILSNAYNP 302

Query: 290  RYAKKPVFDKTPMHNSIMVQSSKSPVIRFVFPINYFSTRFTDRELATYTQIWCELLGDEC 349
            +Y     F + P HN+I ++S+K P++R +FPI+     F   +L  +  +WCEL GDE 
Sbjct: 303  KYKDIKCFKRNPNHNAIFIKSTKQPILRLLFPIDMDDDYFNKDDLLRFIMVWCELFGDEN 362

Query: 350  EGSLCHYLRSHSYITELIAYSSNFAVNDTGLILQLHLTNHGWLNVQKIIPIVWKYLIPAI 409
            + SLC++L+  + IT+  A+ SNFA+N  GL+++L LT  G  N + II  +    I  +
Sbjct: 363  DNSLCYFLKKDNLITDCFAFHSNFALNSVGLVVELSLTGTGVKNQELIINSICNSAIEKL 422

Query: 410  LDAPLSSLAQYISELNSLDLLKFLYQELERSPMDRCADLCESLLQDLSAIDLSFLLKSTL 469
             +A  + LA+++SE N++D+++F+ +  E + MD  +++   L ++L+    SFLLK   
Sbjct: 423  SEANDTELARFLSECNTIDIIRFINKGKEDTSMDEISEISSRLQENLALNRPSFLLKE-- 480

Query: 470  TYFECNNLSVANLGTYRENQTSKDWWRGEAVKFQAFVNEFMSQDTVRIILLGNLSKCYFN 529
             +   N+ S   +  + EN+ SK+WW  +A  FQ F+  ++++  +RI+ LG++    F 
Sbjct: 481  -FPFINDYSETGISNFEENEWSKNWWLSKAYNFQQFLKRYVNRKNLRILFLGDIETPKFT 539

Query: 530  CNPDKI---TTDTYFEYEYVKI---FIDLEVLGCDDIHYRFTIPGPNPFMVPVGHKLSFI 583
               + +   +TD ++++EY+     F   ++   DDI     IP  N FM  +G  L+ +
Sbjct: 540  TLTEDLKVYSTDPFYDFEYITFKYKFKANQLRQEDDIFRNIGIPKRNTFMPEIGKSLAIL 599

Query: 584  KHALLASSVQSENSALSVVAQSDLVRASPRLAGKNSYYELWLKEEDVDLSFRSKSIFSME 643
               L A   ++E+    ++  +  + + P L  KNS  E W+    +  S    SIFS E
Sbjct: 600  SANLEAILKRNESIGYPIIYNNS-IESKPGLVLKNSNQETWVLNSPLQHSSTESSIFSFE 658

Query: 644  LISTSLEPAPEYTMHLEILGQLLYSILGPILYPAERAGYTYELSLSSKGDVRLGLTISGF 703
            + + S++P+P  TMHLE+LGQLL  ++   LYPA R GYTYE+  S  GDV+L +TISGF
Sbjct: 659  ITNWSIKPSPASTMHLEVLGQLLGILMTRELYPALRLGYTYEIGASVNGDVKLMITISGF 718

Query: 704  TDGILNLLKIIVDAIVNLSQDLNSIPKDIFRKARILVRTKYKEASSESCVTLASLGLLIL 763
              GI++LL+ I+    ++S    ++      +AR++ R KY++A+S + V LAS+GLLI+
Sbjct: 719  QSGIMSLLQNIIKICNSISIKNPTVTHSALHRARVMTRRKYEDAASGNSVKLASVGLLIM 778

Query: 764  LENCMWPLEDRLEALEDIYVESFRIFLEKFINGDNYLNILIQGSDMTIADNINEYLSERL 823
            LE  MW LEDR +ALE+  + SF  F  +F     Y+   I G+        NE L+ +L
Sbjct: 779  LEKHMWTLEDRFDALEESDINSFYNFCSQFFKSAKYIKSFISGT--------NE-LAMKL 829

Query: 824  TH----HISRADDNVCRLSEP----ATYVIPEGSNLFFKRVGFHDDPNNSIVYFIQTGER 875
            +H    H   +D       E     +T  +  G N++F+  G   D NN I YFIQTGER
Sbjct: 830  SHLIYDHWILSDTISLNYFEKNNILSTCFLKPGENVYFQHPGDEGDINNCINYFIQTGER 889

Query: 876  DNNYIYTLTVLTEFIMSQTLVPDLRQKKQIGYIVLGGLRVLSDTVGLHITTMAGSPPEFL 935
            +N YI TLT LT++IM   LV +LR +KQ+GY+V GG+R L++T+GLHIT M+ + PE L
Sbjct: 890  NNEYIATLTSLTDYIMQSNLVSELRNRKQVGYVVFGGMRSLTNTIGLHITIMSLADPEDL 949

Query: 936  EEKINEYLAYLEDMVLAKLTAPQFKHDYVDELLSLLTSNSLGKLEKTSGPANLMSQIEAN 995
            E  I+EY+  LE+  +  L    FK  ++   ++ +  ++       +   NL+  + AN
Sbjct: 950  ERSIDEYMWRLENDTIGSLNESTFKLTFLLPFINTMQKDTNNPFNNVTN-VNLVDDVVAN 1008

Query: 996  VHSGQRNT--SLAMKSHKRLRTQISYRRYNFD-EDDEPVDARTLQNLKLSEYMRFFRQRI 1052
            V +G      +  MK H  L+ +I   R   + + +E +D   ++ L L EY+ FFR  I
Sbjct: 1009 VQAGDSVNFETQQMKLHNNLKKRIFNNRIQLNLKYNEAIDLNIIKKLTLKEYLEFFRATI 1068

Query: 1053 SIYSGKRAKLSIMVYSAMSKEEVQGKMLYLQIESFLKMKGFNIPSKDLNAIVQKSKGKPT 1112
            SI S  R+K+SI + S M+KEE+  + L+LQ+ +FLK+KG  I   +L  IV+ S+GKP+
Sbjct: 1069 SINSKNRSKISIHIISLMAKEEIANRKLFLQLVTFLKVKGLTIKRDELKEIVEISEGKPS 1128

Query: 1113 ALLKGLLSYFRSQGESLKL 1131
             LLK ++ YF+ + E+ KL
Sbjct: 1129 KLLKEIVKYFKKKDEAKKL 1147

>CAGL0D04686g Chr4 (457938..461483) [3546 bp, 1181 aa] {ON} similar to
            uniprot|P40851 Saccharomyces cerevisiae YPR122w AXL1
            protease
          Length = 1181

 Score =  556 bits (1432), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 350/1148 (30%), Positives = 590/1148 (51%), Gaps = 80/1148 (6%)

Query: 38   LISDPSETVASCAVSIATGSHNDPVEIPGLAHFCEHMVLSSGSKRHPEPNAFHETLSKNN 97
            +ISD  E   SC++++A GSHNDP  +PGLAH CEHM+L++GS  HP P  FH  ++K N
Sbjct: 36   IISDAEENYNSCSLTVAAGSHNDPATVPGLAHLCEHMILAAGSSNHPTPGLFHSLIAKYN 95

Query: 98   GSQNAHTSGEQTSFYFELPS-SQSSDSLVFDQVVGILADALKEPIFHDVLINKEIYAINS 156
            G  NA+T+GEQTSFYF++P  + S  +L F++++ + + A K P+F   ++NKEIYAI S
Sbjct: 96   GDMNAYTTGEQTSFYFQVPQVANSEGTLAFEELLSVFSSAFKFPLFTSSVLNKEIYAIQS 155

Query: 157  EHVGNKSSLTKMMYHAVRLLASPEHPFHQFGTGNIFTLTNMPKLHKLSLKNELVKYFREH 216
            EH  NK++  K++Y A RLLA+  HPF +F TG++ TL   P    ++++ EL+ YF ++
Sbjct: 156  EHENNKTNPGKVLYQATRLLANKNHPFSRFCTGDMNTLKTFPSTENINIRKELISYFNDN 215

Query: 217  FFAENMVLCLRGPQSLNQLSKIAQARFSDIPSIPTLQVPRLLRWRSSSSFDKNRNLSVRP 276
            F+ EN+ LC+RGPQSLN L K+    F+DI  +P L  P  +     ++ D +  L    
Sbjct: 216  FYGENITLCVRGPQSLNHLVKLCMQNFNDIKPLPVL--PTAI----GNNRDSDTELFEET 269

Query: 277  LESFQILKDAWSARYAKKPVFDKTPMHNSIMVQSSKSPVIRFVFPINYFSTRFTDRELAT 336
            L+   IL D W+ RY   P F     +N I+V S      R V P+    TR        
Sbjct: 270  LKRLNILYDVWAPRYTSLPCFHIGYKNNVILVNSDMEQSFRIVIPLITNDTREDAIFTEV 329

Query: 337  YTQIWCELLGDECEGSLCHYLRSHSYITELIAYSSNFAVNDTGLILQLHLTNHGWLNVQK 396
            +T I  ELLG+E  GS CH+L+  S++ E   Y S FAV   G++L+    + G+  ++ 
Sbjct: 330  FTNICVELLGNEEVGSFCHFLKEISWVRECYVYRSEFAVGAAGIVLEFKCFDTGFSQIEN 389

Query: 397  IIPIVWKYLIPAILDAPLSSLAQYISELNSLDLLKFLYQELERSPMDRCADLCESLLQDL 456
            I+ ++++ LIP  L+ P   LA++I E   ++ + F+Y     SPM+  +DL   L +DL
Sbjct: 390  IVNVLFQTLIPMYLNMPSDDLARFIKEQTIIETIDFMYTWKHLSPMEESSDLSMQLQKDL 449

Query: 457  SAIDLSFLLKSTLTYFECNNLSVANLGTYRE-NQTSK-DWWRGEAVKFQAFVNEFMSQDT 514
                + +LL  + ++          L  Y E ++T K  +W     KF+ F+   M    
Sbjct: 450  HNRGIKYLLMKSPSF----------LHNYEEMSKTEKLHYWPLIVEKFKVFLRRHMILPN 499

Query: 515  VRIIL------LGNLSKCYFNCNPDKIT--TDTYFEYEYVKI---FIDLEVLGCDDIHYR 563
             ++I+         +   + N    ++T  TD Y+E+ Y      F +  V+      Y+
Sbjct: 500  AKVIIPTSEPFTKTVRNLFKNAQQMEVTSETDPYYEFNYSVYSVSFPESRVI----FPYQ 555

Query: 564  FTIPGPNPFMVPVGHKLSFIKHALLASSVQSENSALSVVA--QSDLVRASPRLAGKNSYY 621
            F+ PGPN F+ P    L  +   L   S ++  S L  +   ++   R++P+L  +    
Sbjct: 556  FSFPGPNEFIPPKYRNLDTLLEMLFGISERANFSPLRPIVRLKNSRARSAPKLVHQTEDV 615

Query: 622  ELWLKEEDVDLSFRS------KSIFSMELISTSLEPAPEYTMHLEILGQLLYSILGPILY 675
            E+W     VD  F        KS  ++++++  + P P  ++HL ++ +++   L P LY
Sbjct: 616  EIW-TANIVDGIFSKVVNADIKSYVTIKIVNQCIRPTPISSLHLGMMVEIMNMFLLPRLY 674

Query: 676  PAERAGYTYELSLSSKGDVRLGLTISGFTDGILNLLKIIVDAIVNLSQDLNSIPKDIF-R 734
               + G+++ L  +  G +   + ++G   GI+ +L+ + D I  +      I  + F R
Sbjct: 675  SCTKLGFSFHLQAALDGSMSFDIVVTGIMAGIIKILEKVTDLIEIIVTKPGYILTNAFIR 734

Query: 735  KARILVRTKYKEASSESCVTLASLGLLILLENCMWPLEDRLEALEDIYVESFRIFLEKFI 794
            KAR+ +R++Y+ A+  S V + + GLL+ LE  +W  E+R++ALE+  +E F  F+  F 
Sbjct: 735  KARVAIRSRYEAATKGSSVKIGTTGLLVDLEPHVWSFEERVDALEESDIEVFFQFINTFF 794

Query: 795  NGDNYLNILIQGSDMTIADNINEYLSERL-THHISRADDNV--CRLSEPATYVIPEGSNL 851
                +  +  Q S  +  D I  Y+ +R+ T  I   +D +  C   +  T ++  G   
Sbjct: 795  RTHKHTKVFAQSSSTSNIDKIARYVVQRIVTPGIPEGNDALVECVRDDGHTRMLKPGEER 854

Query: 852  FFKRVGFHDDPNNSIVYFIQTGERDNNYI--YTLTVLTEFIMSQTLVPDLRQKKQIGYIV 909
              K +G  +DPNN +  +++    +   +  Y +   T+++   TLVP+LR K+Q+GY V
Sbjct: 855  HIKLIGRDNDPNNCVFSYLEMAPLEGISLKQYRMIEFTDYLFQLTLVPELRNKRQVGYAV 914

Query: 910  LGGLRVLSDTVGLHITTMAGSPPEFLEEKINEYLAYLEDMVLAKLTAPQFKHDYVDELLS 969
             GGL +L++ VG+++  ++ + PE +E++I  Y A++           Q+  D VD++  
Sbjct: 915  DGGLVILNNVVGVNVVVVSSTSPEHIEQEIESYYAHVR----------QYLSDNVDQIW- 963

Query: 970  LLTSNSLGKLEKTSGPANLMSQIEANVHSGQRNTSLAMKSHKRLRTQISYRRYNFDE--- 1026
                    K+     P  LM  ++ +V       +  +  + R       R + + +   
Sbjct: 964  ----RDYSKIINDRDP--LMYLLDHDVWYNIERENSDIPEYSRDHVANCQRVFKYKDLIE 1017

Query: 1027 ---DDEPVDART---LQNLKLSEYMRFFRQRISIYSGKR-----AKLSIMVYSAMSKEEV 1075
                D P+  R         + EY++F    I  Y  KR       +S+ VYS M K +V
Sbjct: 1018 LLVVDTPISGRHPDYTPPFSMQEYLQFLDSSIGTYKHKRHHNGTRSVSVWVYSPMDKRDV 1077

Query: 1076 QGKMLYLQIESFLKMKGFNIPSKDLNAIVQKSKGKPTALLKGLLSYFRSQGESLKLLSTV 1135
              + +  Q+ESFLK+KG  IP +DL  I++++ GK T + K L   F+ Q E+ K +++V
Sbjct: 1078 FQRQVKYQLESFLKLKGLVIPERDLADIIREAGGKQTTMFKLLYRRFKRQNEAGKFVNSV 1137

Query: 1136 LREVVKQL 1143
              E  K +
Sbjct: 1138 ATETFKSI 1145

>NCAS0J01470 Chr10 complement(261880..264867) [2988 bp, 995 aa] {ON}
           Anc_4.246
          Length = 995

 Score =  168 bits (425), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 211/919 (22%), Positives = 383/919 (41%), Gaps = 140/919 (15%)

Query: 37  FLISDPSETVASCAVSIATGSHNDPVEIPGLAHFCEHMVLSSGSKRHPEPNAFHETLSKN 96
            LI+DP    A+ ++ +  GS NDP  +PGLAHFCEH++   GS++ P+ N +   LSK+
Sbjct: 59  LLITDPKTDKAAASLDVNIGSFNDPEPLPGLAHFCEHLLFM-GSRKFPDENDYSSFLSKH 117

Query: 97  NGSQNAHTSGEQTSFYFELPSSQSSDSLVFDQVVGILADALKEPIFHDVLINKEIYAINS 156
            G  NA+T    T+++FE+ +     +L  D+  G        P+F+    +KEI A++S
Sbjct: 118 GGHSNAYTGSSNTNYFFEINAEHLFGAL--DRFSGFFTG----PLFNKNATDKEINAVDS 171

Query: 157 EHVGNKSSLTKMMYHAVRLLASPEHPFHQFGTGNIFTLTNMPKLHKLSLKNELVKYFREH 216
           E+  N  +    +Y   + L++ +HP+H+F TGNI TL  +P+   L++++EL+K++ + 
Sbjct: 172 ENKKNLQNDLWRIYQLDKSLSNLKHPYHKFSTGNIQTLKQLPESQGLNIRDELLKFYDDS 231

Query: 217 FFAENMVLCLRGPQSLNQLSKIAQARFSDIPS----IPTLQVPRLLRWRSSSSFDKNRNL 272
           + A  M LC+ G + L+ L++     F+D+ +    +P  Q P LL+ +        R +
Sbjct: 232 YSANLMKLCIIGREDLDTLAQWTADLFNDVKNKDKPLPVFQDPILLKEQHLQ-----RII 286

Query: 273 SVRPLESFQILKDAWSARYAKKPVFDKTPMHNSIMVQSSKSPVIRFVFPINYFSTRFTDR 332
            V P++  + L                                I F  P       +   
Sbjct: 287 QVEPVKELRKLD-------------------------------IEFCVP------DYEKH 309

Query: 333 ELATYTQIWCELLGDECEGSLCHYLRSHSYITELIAYSSNFAVNDTGLILQLHLTNHGWL 392
             +    I   L+G E  GSL  +L++  +  EL A     + N+    + + LT  G  
Sbjct: 310 WQSKIPHILSHLIGHEGNGSLLSHLKTLGWANELSAGGHTVSENNAFFSIAIELTQKGLA 369

Query: 393 NVQKIIPIVWKYLIPAILDAPLSSLAQYISELNSLDLLKFLYQELERSPMDRCADLCESL 452
           + + +  ++++Y+   +L   L     Y+ EL +++   F +++   +P +  + L + L
Sbjct: 370 HYKDVTHLIFQYI--EMLRHSLPQEWIYL-ELQNINKANFKFKQ-NGNPSNTVSSLSKML 425

Query: 453 LQDLSAIDLSFLLKSTLTYFECNNLSVANLGTYRENQTSKDWWRGEAVKFQAFVNEFMSQ 512
            ++               Y    ++   NL T  E +    +             E M+ 
Sbjct: 426 EKE---------------YIPVGDILATNLFTKYEPELITKYL------------EMMTF 458

Query: 513 DTVRIILLGNLSKCYFNCNPDKITTDTYFEYEYVKIFIDLEVLGCDDIHYRFTIPGPNP- 571
           D  RI L+              + TD+ FE  Y   +  +E     D+  + T PG NP 
Sbjct: 459 DNSRITLISK-----------DLETDS-FEKWYGTKYKVIEYPA--DLIAKITSPGLNPN 504

Query: 572 FMVPVGHKLSFIKHALLASSVQSENSALSVVAQSDLVRASPRLAGKNSYYELWLKEEDVD 631
           F +P  ++  FI +    + +++                 P L  +    +LW K++D  
Sbjct: 505 FHLPRPNE--FIANNFQVTKLENVTPL-----------EEPHLLKETELGKLWYKKDDRF 551

Query: 632 LSFRSKSIFSMELISTSLEPAPEYTMHLEILGQLLYSILGPILYPAERAGYTYELSLSSK 691
              R     S +L  T L      +M   +  QL+   L  + Y A  A     L+ +++
Sbjct: 552 WQPRGHIYISFKLPHTHLSLLN--SMLTTLYVQLINDSLKDLQYDASCANLHASLTKTNQ 609

Query: 692 GDVRLGLTISGFTDGILNLLKIIVDAIVNLSQDLNSIPKDIFRKARI--LVRTKYKEASS 749
           G   L +T+SGF D ++ LL   +  I +     NS    IF+   I  L  + Y+   S
Sbjct: 610 G---LDITVSGFNDKLIILLTRFLQGIKSFKP--NSDRFQIFKDKTIQHLQNSLYEVPYS 664

Query: 750 ESCVTLASLGLLILLENCMWPLEDRLEALEDIYVESFRIFLEKFINGDNYLNILIQGS-- 807
           +      S     L+    W   ++L AL+ I  +    F+   I  + Y   LI G+  
Sbjct: 665 QMSTLYNS-----LINERTWTTTEKLSALDKISYDQLLTFIPT-IFEELYFESLIHGNLK 718

Query: 808 ---DMTIADNINEYLSERLTHHISRADDNVCRLSEPATYVIPEGSNLFFKRVGFHDDPN- 863
               M I   +   L+E    ++   +D +       +Y++P+G   F       D  N 
Sbjct: 719 YDEAMEIDSLVKLLLTENNILNLQIQNDKL------RSYILPKGKT-FRYETDLKDPKNV 771

Query: 864 NSIVYFIQTGERDNNYIYTLTVLTEFIMSQTLVPDLRQKKQIGYIVLGGLRVLSDTVGLH 923
           NS +  +   +  +  +     L   ++ +     LR K+Q+GY+V         T  + 
Sbjct: 772 NSCIQHVTQIDIYSEELSAKCALFAQMIHEPCFDTLRTKEQLGYVVFSSTLNNHGTANIR 831

Query: 924 ITTMAGSPPEFLEEKINEY 942
           I   +     +LE +I+ +
Sbjct: 832 ILVQSEKSTPYLEWRIDNF 850

>SAKL0H03124g Chr8 (291984..295004) [3021 bp, 1006 aa] {ON} similar
           to uniprot|Q06010 Saccharomyces cerevisiae YLR389C STE23
           Metalloprotease involved with homolog Axl1p in
           N-terminal processing of pro-a-factor to the mature form
           member of the insulin-degrading enzyme family
          Length = 1006

 Score =  167 bits (423), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 214/923 (23%), Positives = 371/923 (40%), Gaps = 146/923 (15%)

Query: 36  TFLISDPSETVASCAVSIATGSHNDPVEIPGLAHFCEHMVLSSGSKRHPEPNAFHETLSK 95
             LI DP+   A+ A+ I  G+  DP  IPGLAHFCEH++   GS + P+ N +   LSK
Sbjct: 73  ALLIQDPATDKAAAALDINVGAFEDPENIPGLAHFCEHLLFM-GSSKFPDENEYSSFLSK 131

Query: 96  NNGSQNAHTSGEQTSFYFELPSSQSSDSLVFDQVVGILADALKEPIFHDVLINKEIYAIN 155
           + G+ NA+T  + T++YF++       +L  D+  G        P+F+    +KEI A++
Sbjct: 132 HGGASNAYTGSQNTNYYFQVNHEDLRGAL--DRFSGFFT----SPLFNKNSTDKEINAVD 185

Query: 156 SEHVGNKSSLTKMMYHAVRLLASPEHPFHQFGTGNIFTLTNMPKLHKLSLKNELVKYFRE 215
           SE+  N  +    MY   +   SP HP+H+F TGN+ TL   PK   L +++EL+K++ +
Sbjct: 186 SENKKNLQNDLWRMYQLDKSFTSPMHPYHKFSTGNLKTLGETPKNQGLDIRDELLKFYNK 245

Query: 216 HFFAENMVLCLRGPQSLNQLSKIAQARFSDIPSIPTLQVPRLLRWRSSSSFDKNRNLSVR 275
            + A  M LC+ G + L+ +S+     F D+                     +N N SV 
Sbjct: 246 FYSANIMKLCVLGREDLDTMSEWVYELFKDV---------------------RNNNCSV- 283

Query: 276 PLESFQILKDAWSARYAK-KPVFDKTPMHNSIMVQSSKSPVIRFVF---PINYFSTRFTD 331
           P  S  +L   +  +  + KPV D   +  +  V     P +   +   P +Y S     
Sbjct: 284 PEYSIPLLPAEYKTKIIRAKPVKDLKKVEITFAV-----PDVDVHWESKPHHYLS----- 333

Query: 332 RELATYTQIWCELLGDECEGSLCHYLRSHSYITELIAYSSNFAVNDTGLILQLHLTNHGW 391
                       L+G E  GSL  YL+   +  EL A +   +VN+    + + LTN+G 
Sbjct: 334 -----------HLIGHEGSGSLLAYLKGQGWANELSAGAHTVSVNNAFFSVDIELTNNGL 382

Query: 392 LNVQKIIPIVWKYLIPAILDAPLSSLAQYISELNSLDLLKFLYQELERSPMDRCADLCES 451
            + Q ++                SS+ QYI  L       ++Y EL+        D+ ++
Sbjct: 383 DHYQDVV----------------SSVFQYIEMLKCSLPQSWIYTELK--------DVAQA 418

Query: 452 LLQDLSAIDLSFLLKSTLTYFECNNLSVANLGTYRENQTSKDWWRGEAVKFQAFVNEFMS 511
             +       S  + S     E   + V ++        S    R    +        ++
Sbjct: 419 SFKFKQKGHASSTVSSLAKALEKEYIPVGDI-------LSTSLLRKYDPELIMQYTNILT 471

Query: 512 QDTVRIILLGNLSKCYFNCNPDKITTDTYFEYEYVKIFIDLEVLGCDDIHYRFTIPGPNP 571
            +  RI ++   SK     + +K     Y   +Y K F+D   L    ++    +P PN 
Sbjct: 472 PENSRITVI---SKDVETDSKEKWYGTEYSVIDYPKEFLD--KLKESGLNPHLHLPRPNE 526

Query: 572 FMVPVGHKLSFIKHALLASSVQSENSALSVVAQSDLVRASPRLAGKNSY-YELWLKEEDV 630
           F+                      ++   V  Q         L  K+ Y  +LW K++D 
Sbjct: 527 FI----------------------STNFQVKKQESAEPLLEPLLLKDDYCSKLWYKKDDT 564

Query: 631 DLSFRSKSIFSMELISTSLEPAPEYTMHLEILGQLLYSI--------LGPILYPAERAGY 682
             + R     SM+L  T          H  I+  +L S+        L  + Y AE A  
Sbjct: 565 FWAPRGYIYVSMKLAHT----------HSSIVNSMLTSLYVELINDHLKDLQYDAEVANL 614

Query: 683 TYELSLSSKGDVRLGLTISGFTDGILNLLKIIVDAIVNLSQDLNSIPKDIFRKARILVRT 742
               S +++G   L +++ G+ + +  LL   ++ I   +  L+       +  R L   
Sbjct: 615 HVSFSKTNQG---LDISLCGYNEKLTILLTRFLEGIKEFTPKLDRFKIFQDKLVRKLNNH 671

Query: 743 KYKEASSESCVTLASLGLLILLENCMWPLEDRLEALEDIYVESFRIFLEKFINGDNYLNI 802
            Y+   S+      SL     +    W  +++L+  + +  E  + F+   I    Y  I
Sbjct: 672 LYEVPYSQLSGIFNSL-----INERSWSTKEKLDLTKQLTFEHLKNFIPT-IYEQLYYEI 725

Query: 803 LIQGS-DMTIADNINEYLSERLTHHISRADDNVCRLSEPATYVIPEGSNLFFKRVGFHDD 861
           L+ G+     A  IN+ +   + + I        +L    +Y+IP+    F   +   D+
Sbjct: 726 LVHGNFSQEAATEINDLVKMMVPNDIKNLQVKNGKLR---SYIIPQ-EKTFRMELPLADE 781

Query: 862 PN-NSIVYFIQTGERDNNYIYTLTVLTEFIMSQTLVPDLRQKKQIGYIVLGGLRVLSDTV 920
            N NS +  +      +  +   T L   ++ +     LR K+Q+GY+V         TV
Sbjct: 782 KNVNSCIQHVTQFGIYSEDLSAKTALLAQLIDEPCFDTLRTKEQLGYVVFSSALSTHGTV 841

Query: 921 GLHITTMAGSPPEFLEEKINEYL 943
            L +   +     +LE +I+ +L
Sbjct: 842 NLRLLIQSERDSSYLESRIDSFL 864

>TPHA0B02260 Chr2 (517138..520263) [3126 bp, 1041 aa] {ON} Anc_4.246
           YLR389C
          Length = 1041

 Score =  167 bits (423), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 220/921 (23%), Positives = 388/921 (42%), Gaps = 147/921 (15%)

Query: 38  LISDPSETVASCAVSIATGSHNDPVEIPGLAHFCEHMVLSSGSKRHPEPNAFHETLSKNN 97
           LISDP    A+ ++ +  G+  DP  +PGLAHFCEH++   GS++ P+ N +   LSK+ 
Sbjct: 106 LISDPQTDKAAASIDVNVGAFEDPENLPGLAHFCEHLLFM-GSEKFPDQNEYSSYLSKHG 164

Query: 98  GSQNAHTSGEQTSFYFELPSSQSSDSLVFDQVVGILADALKEPIFHDVLINKEIYAINSE 157
           G  NA+T+   T+++FE+       +L  D+  G        P+ +     KEI A++SE
Sbjct: 165 GHSNAYTAALNTNYFFEVNHEHLHGAL--DRFSGFFTG----PLMNADSTEKEINAVDSE 218

Query: 158 HVGNKSSLTKMMYHAVRLLASPEHPFHQFGTGNIFTLTNMPKLHKLSLKNELVKYFREHF 217
           +  N  +     Y   + +++  HP+H+F TGNI TL   P    L+ +NEL+K++   +
Sbjct: 219 NKKNLQNDDWRRYQMDKTISNYNHPYHKFSTGNIKTLMEEPTKLGLNTRNELLKFYNSSY 278

Query: 218 FAENMVLCLRGPQSLNQLSKIAQARFSDIPSIPTLQVPRLLRWRSSSSFDKNRNLSVRPL 277
            A  M LC+ G Q L+ LS  A   F D+                     KN N ++   
Sbjct: 279 SANIMKLCILGRQDLDTLSNWATEFFKDV---------------------KNLNKALPQY 317

Query: 278 ESFQILKDAWSARYAKKPVFDKTPMHNSIMVQSSKSPVIRFVFPINYFSTRFTDRELATY 337
               + ++         PV D   +             I FV P         D +L   
Sbjct: 318 NENILEEEHLKKIIKIIPVKDLKKLE------------INFVVP---------DMDLHWE 356

Query: 338 TQ---IWCELLGDECEGSLCHYLRSHSYITELIAYSSNFAVNDTGLILQLHLTNHGWLNV 394
           ++   +   L+G E  GS+  YL+   +  +L A +   + ++    + + LT+ G  N 
Sbjct: 357 SRPHHVLSHLIGHEGSGSILSYLKKLGWANDLSAGAHTVSKDNAFFGINVDLTDKGLENY 416

Query: 395 QKIIPIVWKYLIPAILDAPLSSLAQYISELNSLDLLKFLYQELERSPMDRCADLCESLLQ 454
           Q+I  ++++Y+       P   +    SEL  +    F +++ + SP    ++L + L +
Sbjct: 417 QEIALLIFQYIEMLKHSLPQEWI---FSELQDVSKSSFKFKQ-KSSPSGTVSELSKLLEK 472

Query: 455 DLSAIDLSFLLKSTLTYFECNNLSVANLGTYRENQTSKDWWRGEAVKFQAFVNEFMSQDT 514
           +    DL  +L +TL            L  Y            E    + +V+  ++ D 
Sbjct: 473 EYINPDL--ILSTTL------------LRKY------------EPEMIKQYVDS-LTVDN 505

Query: 515 VRIILLGNLSKCYFNCNPDKITTDTYFEYEYVKIFIDLEVLGCDDIHYRFTIPGPNPFMV 574
            RI L   +SK     + +K     Y   +Y K FID   L    ++  F +P  N F  
Sbjct: 506 SRITL---ISKTVETDSKEKWYGTEYQVVDYPKSFID--QLNQPGLNSEFKLPRRNEF-- 558

Query: 575 PVGHKLSFIKHALLASSVQSENSALSVVAQSDLVRASPRLAGKNSYYELWLKEEDVDLSF 634
                        +A++ + +     +V   +     P L   N   ++W K++D     
Sbjct: 559 -------------VATNFEVKKPTDELVPLDE-----PHLILDNDISKVWYKKDDRFWQP 600

Query: 635 RSKSIFSMELISTSLEPAPEYTMHLEILGQL----LYSILGPILYPAERAGYTYELSLSS 690
           R     SM+L      P+ +  +   +L  L    +   +  + Y A  A      S ++
Sbjct: 601 RGYIYVSMKL------PSCQSGIVNSLLNGLYVDQINDYMKDLQYDASCANLNLSFSSTN 654

Query: 691 KGDVRLGLTISGFTDGILNLLKIIVDAIVNLSQDLNSIPKDIFRKARILVRTKYKEASSE 750
           +G   L +TISGF D +L LL   ++  V L Q  +    +IF+   I      K +  E
Sbjct: 655 QG---LDITISGFNDKLLVLLSRFIEG-VKLYQP-SEERFNIFKNKAI---QNLKNSLFE 706

Query: 751 SCVTLASLGLL--ILLENCMWPLEDRLEALEDIYVESFRIFLEKFINGDNYLNILIQGS- 807
             V  + +G L   ++    WP++++L+ LE +  + F  F+    N + Y + L+ G+ 
Sbjct: 707 --VPYSQMGTLYNTIMNESTWPIKEKLDVLEALTFDQFVSFVPSIYN-EFYFDALVHGNI 763

Query: 808 DMTIADNINEYLSERLTHHISRADDNVCRLSEPATYVIPEGSNLFFK-RVGFHDDPNNSI 866
               A   N+ L    +  I        R S   +Y++PEG +  ++  +   D+ N+ I
Sbjct: 764 RYEEAMEANDLLKSLASFKILNLH---VRNSRLRSYILPEGESYRYEIDMEDKDNLNSCI 820

Query: 867 VYFIQTGERDNNYIYT-----LTVLTEFIMSQTLVPDLRQKKQIGYIVLGGLRVLSDTVG 921
            + +Q G      +YT     L+ L   ++ +     LR K+Q+GY+V         T  
Sbjct: 821 QHVVQLG------LYTEELSALSGLFAQMIREPCFDTLRTKEQLGYVVFSSNLNNHGTAN 874

Query: 922 LHITTMAGSPPEFLEEKINEY 942
           + I   +     +LE +I+E+
Sbjct: 875 MRILVQSEHSTSYLEWRIDEF 895

>Kpol_1055.83 s1055 (216511..219573) [3063 bp, 1020 aa] {ON}
           (216511..219573) [3063 nt, 1021 aa]
          Length = 1020

 Score =  166 bits (421), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 215/916 (23%), Positives = 391/916 (42%), Gaps = 134/916 (14%)

Query: 36  TFLISDPSETVASCAVSIATGSHNDPVEIPGLAHFCEHMVLSSGSKRHPEPNAFHETLSK 95
             LI D S   ++ ++ +  G+  DP  + GLAHFCEH++   GSK+ P  N +   L+K
Sbjct: 86  ALLIHDASTDKSAASLDVNIGAFQDPKNLQGLAHFCEHLLFM-GSKKFPNENEYSSYLNK 144

Query: 96  NNGSQNAHTSGEQTSFYFELPSSQSSDSLVFDQVVGILADALKEPIFHDVLINKEIYAIN 155
           + GS NA+T  + T+++FE+       +L  D+  G        P+F+    +KEI A++
Sbjct: 145 HGGSSNAYTGAQNTNYFFEINHEHLHGAL--DRFSGFFTC----PLFNPNSTSKEINAVD 198

Query: 156 SEHVGNKSSLTKMMYHAVRLLASPEHPFHQFGTGNIFTLTNMPKLHKLSLKNELVKYFRE 215
           SE+  N  +    MY   + L++ +HP+H+F TGN+ TL  MPK   L ++NEL+K++ +
Sbjct: 199 SENKKNLQNDVWRMYQLDKSLSNEKHPYHKFSTGNLKTLDEMPKKEGLDIRNELLKFYSD 258

Query: 216 HFFAENMVLCLRGPQSLNQLSKIAQARFSDIPS----IPTLQVPRLLRWRSSSSFDKNRN 271
            + A  M LC+ G + L+ +S      F  +P+    +P    P LL        +  + 
Sbjct: 259 SYSANLMKLCVLGREDLDTMSDWVYNLFEAVPNNNRPLPEYNEPILLEE------NLKKI 312

Query: 272 LSVRPLESFQILKDAWSARYAKKPVFDKTPMHNSIMVQSSKSPVIRFVFPINYFSTRFTD 331
           + V+P++  + L+  + A+      ++  P H                            
Sbjct: 313 IHVKPVKDLKKLEITFLAQ-DMDLFWESKPQH---------------------------- 343

Query: 332 RELATYTQIWCELLGDECEGSLCHYLRSHSYITELIAYSSNFAVNDTGLILQLHLTNHGW 391
                   I   L+G E  GS+  +L++ S+  EL A     + ++    + + LT +G+
Sbjct: 344 --------ILSHLIGHEGSGSILSHLKTLSWANELSAGGHTVSKDNAFFSIDIDLTENGF 395

Query: 392 LNVQKIIPIVWKYLIPAILDAPLSSLAQYISELNSLDLLKFLYQELERSPMDRCADLCES 451
            + ++I+ IV++Y+    +  P   +     EL  +    F +++ + +P    ++L ++
Sbjct: 396 QHYKEIVHIVFQYIEMLKISLPQERI---FLELQDIANASFKFKQ-KVNPSSTVSNLSKA 451

Query: 452 LLQDLSAIDLSFLLKSTLTYFECNNLSVANLGTYRENQTSKDWWRGEAVKFQAFVNEFMS 511
           L ++   ++                 ++ + G +R+       +  E +K   +VN  +S
Sbjct: 452 LEKEYIPVE-----------------NILSTGLFRK-------YDPEIMK--NYVNS-LS 484

Query: 512 QDTVRIILLGNLSKCYFNCNPDKITTDTYFEYEYVKIFIDLEVLGCDDIHYRFTIPGPNP 571
            D  RI L G   +   +       TD   E +Y K   D   +    ++   +IP PN 
Sbjct: 485 PDNSRITLAGKAVET--DSKETWYGTDYRVE-DYPKDLYD--TIKSPGLNPNLSIPRPNE 539

Query: 572 FMVPVGHKLSFIKHALLASSVQSENSALSVVAQSDLVRASPRLAGKNSYYELWLKEEDVD 631
           F+        F  +  L   +  ++S +S                     +LW K++D  
Sbjct: 540 FIATNFDVEKFDVNEPLVEPLLLKDSPVS---------------------KLWYKKDDRF 578

Query: 632 LSFRSKSIFSMELISTSLEPAPEYTMHLEILGQLLYSILGPILYPAERAGYTYELSLSSK 691
              R     +M+L  T           L +  QL+   L  + Y A  A      S +++
Sbjct: 579 WQPRGFIYITMKLPHTQASVINNLLTSLYV--QLVNDSLKDLQYDAACANLHLSFSKTNQ 636

Query: 692 GDVRLGLTISGFTDGILNLLKIIVDAIVNLSQDLNSIPKDIFRKARI--LVRTKYKEASS 749
           G   L +TISGF D ++ LL+  +   V++ Q  + +   IF++  I  L    Y+   S
Sbjct: 637 G---LDITISGFNDKLIVLLQRFIYG-VSVYQP-SKLRFKIFKEKTIQNLKNCLYEVPYS 691

Query: 750 ESCVTLASLGLLILLENCMWPLEDRLEALEDIYVESFRIFLEKFINGDNYLNILIQGS-D 808
           +     +S     L+    W ++ +L  +E I  E F  FL   I  + Y + L+ G+  
Sbjct: 692 QISTLYSS-----LINERTWSVKQKLSIIEKITYEQFLAFLPT-IYEECYFDGLVHGNFR 745

Query: 809 MTIADNINEYLSERLTHHISRADDNVCRLSEPATYVIPEGSNLFFKRVGFHDDPN-NSIV 867
              A  I+  +   +T  I        RL    +YVIP G    F+ +   D  N NS V
Sbjct: 746 NEEAVEIDSLVQSLITTDIVNLHVKNTRLR---SYVIPNGETYRFE-IDLEDAENVNSCV 801

Query: 868 -YFIQTGERDNNYIYTLTVLTEFIMSQTLVPDLRQKKQIGYIVLGGLRVLSDTVGLHITT 926
            + +Q G      +  ++ L   I+++     LR K+Q+GY+V         T  + I  
Sbjct: 802 QHVVQLGGYSEE-LSAMSGLFAQILNEPCFDTLRTKEQLGYVVFSSSLNNHGTANIRILV 860

Query: 927 MAGSPPEFLEEKINEY 942
            +     +LE +I+E+
Sbjct: 861 QSEHSTPYLEWRIDEF 876

>TDEL0E01250 Chr5 (243919..246906) [2988 bp, 995 aa] {ON} Anc_4.246
           YLR389C
          Length = 995

 Score =  164 bits (415), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 106/373 (28%), Positives = 183/373 (49%), Gaps = 52/373 (13%)

Query: 36  TFLISDPSETVASCAVSIATGSHNDPVEIPGLAHFCEHMVLSSGSKRHPEPNAFHETLSK 95
             +I DP+   ++ A+ +  G+ +DP E+PGLAHFCEH++   GS++ P+ N +   LSK
Sbjct: 61  ALIIQDPTTDKSAAALDVNIGAFSDPEELPGLAHFCEHLLFM-GSRKFPDENEYSSFLSK 119

Query: 96  NNGSQNAHTSGEQTSFYFELPSSQSSDSLVFDQVVGILADALKEPIFHDVLINKEIYAIN 155
           + GS NA+T  + T++YF++       +L  D+  G        P+F     +KEI A++
Sbjct: 120 HGGSSNAYTGAQNTNYYFQVNHEHLKGAL--DRFSGFFTG----PLFSKDSTDKEINAVD 173

Query: 156 SEHVGNKSSLTKMMYHAVRLLASPEHPFHQFGTGNIFTLTNMPKLHKLSLKNELVKYFRE 215
           SE+  N  +    +Y   + L++P HP+H+F TGN+ TL  +PK   + ++NEL+ ++ +
Sbjct: 174 SENKKNLQNDIWRLYQLDKSLSNPSHPYHKFSTGNLKTLNEIPKSKGVDVRNELLNFYSK 233

Query: 216 HFFAENMVLCLRGPQSLNQLSKIAQARFSDIPSIPTLQVPRLLRWRSSSSFDKNRNLSVR 275
           ++ A  M LC+ G + L+ LS  A   FSD+P++P                        R
Sbjct: 234 YYSANLMKLCVLGREDLDTLSDWAYELFSDVPNLP------------------------R 269

Query: 276 PLESFQ--ILKDAWSARYAK-KPVFDKTPMHNSIMVQSSKSPVIRFVFPINYFSTRFTDR 332
           P   F+  IL  A+  ++   KPV D T +             + FV P         D 
Sbjct: 270 PAPEFEASILDGAYLKKFIHVKPVKDLTKLE------------VTFVVP------DVEDH 311

Query: 333 ELATYTQIWCELLGDECEGSLCHYLRSHSYITELIAYSSNFAVNDTGLILQLHLTNHGWL 392
             +    I   L+G E  GSL  +L+S  +  EL A     + ++    + + LT+ G  
Sbjct: 312 WESKPNHILSHLIGHEGSGSLLAHLKSLGWANELSAGGHTVSKSNAFFCIDIDLTDEGLK 371

Query: 393 NVQKIIPIVWKYL 405
           + + +   +++Y+
Sbjct: 372 HHEDVTHTIFQYI 384

 Score = 47.4 bits (111), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 62/283 (21%), Positives = 121/283 (42%), Gaps = 17/283 (6%)

Query: 664 QLLYSILGPILYPAERAGYTYELSLSSKGDVRLGLTISGFTDGILNLLKIIVDAIVNLSQ 723
           QL+   L  + Y A  A        +++G   L +TI+GF D ++ LL   ++ +     
Sbjct: 584 QLINDYLKDLQYDASCADLHLSFIKTNEG---LDITITGFNDKLIILLTRFLEGLKAFKP 640

Query: 724 DLNSIPKDIFR-KARILVRTKYKEASSESCVTLASLGLLILLENCMWPLEDRLEALEDIY 782
           D      +IF+ K++  +  +  E       +L +     L+    W  E++LE +E + 
Sbjct: 641 DRKRF--EIFKEKSKQHLNNQLYEIPYSQVSSLYN----SLVNERSWTAEEKLEVVEQLT 694

Query: 783 VESFRIFLEKFINGDNYLNILIQGS-DMTIADNINEYLSERLTHHISRADDNVCRLSEPA 841
            E    F+   I  + +   L+ G+     AD I+  +    ++ +S +     R+    
Sbjct: 695 FEQLEAFIPT-IFEEMFFETLVHGNIKYEEADQIDSLIQMLRSNSVSNSQIKNARIR--- 750

Query: 842 TYVIPEG-SNLFFKRVGFHDDPNNSIVYFIQTGERDNNYIYTLTVLTEFIMSQTLVPDLR 900
           +YV+P G ++ +  ++    + N+ I Y IQ G  D   +  +  L   ++ +     LR
Sbjct: 751 SYVLPLGKTHRYEAKLADTQNVNSCIQYVIQLGVYDEA-LSAIGRLFAQMLHEPCFDTLR 809

Query: 901 QKKQIGYIVLGGLRVLSDTVGLHITTMAGSPPEFLEEKINEYL 943
            K+Q+GY+V         T  + I   +     +LE +I  +L
Sbjct: 810 TKEQLGYVVFSSSLNNHGTANIRILIQSEHTTPYLEWRIESFL 852

>CAGL0H06457g Chr8 (633721..636747) [3027 bp, 1008 aa] {ON} highly
           similar to uniprot|Q06010 Saccharomyces cerevisiae
           YLR389c STE23
          Length = 1008

 Score =  159 bits (402), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 207/902 (22%), Positives = 373/902 (41%), Gaps = 134/902 (14%)

Query: 51  VSIATGSHNDPVEIPGLAHFCEHMVLSSGSKRHPEPNAFHETLSKNNGSQNAHTSGEQTS 110
           + +  G+  DP  +PGLAHFCEH++   GS++ P+ N +   LSK+ GS NA+T  + T+
Sbjct: 89  LDVNIGAFQDPENLPGLAHFCEHLLFM-GSEKFPDENEYSSYLSKHGGSSNAYTGSQNTN 147

Query: 111 FYFELPSSQSSDSLVFDQVVGILADALKEPIFHDVLINKEIYAINSEHVGNKSSLTKMMY 170
           ++FE+ +     +L  D+  G  +     P+F+    +KEI A++SE+  N  +    MY
Sbjct: 148 YFFEVNADHLHGAL--DRFSGFFSC----PLFNQNSTDKEINAVDSENKKNLQNDIWRMY 201

Query: 171 HAVRLLASPEHPFHQFGTGNIFTLTNMPKLHKLSLKNELVKYFREHFFAENMVLCLRGPQ 230
              + L++ +HP+H+F TGN+ TL + PK   L ++ EL+K++ E++ A  M LC+ G +
Sbjct: 202 QLDKSLSNQDHPYHKFSTGNLETLGDKPKAAGLDIREELLKFYNENYSANLMKLCILGKE 261

Query: 231 SLNQLSKIAQARFSDIPSIPTLQVPRLLRWRSSSSFDKNRNLSVRPLESFQILKDAWSAR 290
            L+ LS+ A   F D+                     KN + ++ P+    ILK+     
Sbjct: 262 DLDTLSEWAWELFKDV---------------------KNSDRAL-PVYDAPILKEN---- 295

Query: 291 YAKKPVFDKTPMHNSIMVQSSKSPVIRFVFPINYFSTRFTDRELATYTQIWCELLGDECE 350
                  D   +     V+  +   I FV P       +  +  A  + I+  L+G E  
Sbjct: 296 -------DLKKIIKVKPVKDLRKLDISFVVP------DYEKKWEAKISHIFSHLIGHEGS 342

Query: 351 GSLCHYLRSHSYITELIAYSSNFAVNDTGLILQLHLTNHGWLNVQKIIPIVWKYLIPAIL 410
           GSL  +L+S  +  EL A     +  +    + + LTN G  + + I+      LI   L
Sbjct: 343 GSLLAHLKSLGWANELGAGGHTVSDGNAFFNVDIELTNEGLKHYKDIV-----VLIFQYL 397

Query: 411 DAPLSSLAQ--YISELNSLDLLKFLYQELERSPMDRCADLCESLLQDLSAIDLSFLLKST 468
           +   +SL Q     EL  +    F +++ + S     + L + L +D             
Sbjct: 398 EMLKTSLPQEWIFKELQDISNATFKFKQ-KGSASQTVSGLAKQLEKDY------------ 444

Query: 469 LTYFECNNLSVANLGTYRENQTSKDWWRGEAVKFQ-AFVNEFMSQDTVRIILLGNLSKCY 527
             YF   N+   NL                 VK++   +  FM   T     +  +S+  
Sbjct: 445 --YFPVENILATNL----------------LVKYEPELIKHFMKSFTPENSRITFISRSI 486

Query: 528 FNCNPDKITTDTYFEYEYVKIFIDLEVLGCDDIHYRFTIPGPNPFMVPVGHKLSF-IKHA 586
              + ++     Y   +Y   F  L+ +    ++   ++P PN F+        F +K  
Sbjct: 487 VADSKEQWYGTEYSVEDYSPEF--LKSIENPGLNPNLSVPRPNEFIATNFDVEKFDVKEP 544

Query: 587 LLASSVQSENSALSVVAQSDLVRASPRLAGKNSYYELWLKEEDVDLSFRSKSIFSMELIS 646
           L                        P L   +   +LW K++D     R     +++L +
Sbjct: 545 L----------------------NEPLLLKDDDVSKLWYKKDDRFWQPRGYIYVTLKLPN 582

Query: 647 TSLEPAPEYTMHLEILGQLLYSILGPILYPAERAGYTYELSLSSKGDVRLGLTISGFTDG 706
           T        +M   +  Q++   L  + Y A  A        +++G   L +TISGF + 
Sbjct: 583 THSSIIS--SMLTTLYVQMVNDALKDLQYDAACANINLSFVKTNQG---LDITISGFNEK 637

Query: 707 ILNLLKIIVDAIVNLSQDLNSIPKDIFRKARILV---RTKYKEASSESCVTLASLGLLI- 762
           +L LLK  V+ +          PK    K R  V   +T +   +    V  + +  L  
Sbjct: 638 LLILLKRFVEGVQGFE------PK----KERFEVFKDKTVHHLKNQMMEVPYSQISGLYN 687

Query: 763 -LLENCMWPLEDRLEALEDIYVESFRIFLEKFINGDNYLNILIQGSDMTIADNINEYLSE 821
            ++    WP +++LE  E +  E    F+    +G  Y + +    +   A  ++  +S 
Sbjct: 688 SVVNERTWPTKEKLEVAEKLKFEQLDNFVRAIYDGMYYESFVHGNLESKEAREVDSLVST 747

Query: 822 RLTHH-ISRADDNVCRLSEPATYVIPEGSNLFFKRVGFHDDPNNSIVYFIQTGERDNNYI 880
            L    I   D    RL    +Y+IP+G +  ++   + ++  NS +  +   +  N  +
Sbjct: 748 FLKKDDIKNIDVQSNRLR---SYIIPKGKSYAYETDLYDENNVNSCIQHVVQLDVYNEKL 804

Query: 881 YTLTVLTEFIMSQTLVPDLRQKKQIGYIVLGGLRVLSDTVGLHITTMAGSPPEFLEEKIN 940
             L+ L   ++ +     LR K+Q+GY+V         T  + I   +     +LE +I+
Sbjct: 805 SALSGLFAQMLHEPCFDILRTKEQLGYVVFSSSLNNHGTANIRILVQSEHTTPYLEWRID 864

Query: 941 EY 942
           E+
Sbjct: 865 EF 866

>TBLA0A08050 Chr1 (1988388..1991375) [2988 bp, 995 aa] {ON}
           Anc_4.246 YLR389C
          Length = 995

 Score =  157 bits (397), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 209/932 (22%), Positives = 392/932 (42%), Gaps = 146/932 (15%)

Query: 36  TFLISDPSETVASCAVSIATGSHNDPVEIPGLAHFCEHMVLSSGSKRHPEPNAFHETLSK 95
             +I D +   A+ A+ +  G+  DP  +PGLAHFCEH++   GSK  P  N +   L++
Sbjct: 53  ALIIQDKTTDKAAAALDVNAGAFMDPSNLPGLAHFCEHLLFM-GSKNFPNENDYSSYLNQ 111

Query: 96  NNGSQNAHTSGEQTSFYFELPSSQSSDSLVFDQVVGILADALKEPIFHDVLINKEIYAIN 155
           N G  NA+T    T+++FE+  +   ++L         +   K P+F++    KEI+AI+
Sbjct: 112 NGGFSNAYTGSMNTNYHFEINHANLFEAL------RRFSCFFKTPLFNNDSTIKEIHAID 165

Query: 156 SEHVGNKSSLTKMMYHAVRLLASPEHPFHQFGTGNIFTLTNMPKLHKLSLKNELVKYFRE 215
           SE+  N  +    +Y   + L++ EHP+H+F TG+  TL    +   L+++ EL+K++ +
Sbjct: 166 SENKKNLQNDYWRLYQLGKSLSNHEHPYHKFSTGSKLTLLENTETLNLNIREELIKFYNK 225

Query: 216 HFFAENMVLCLRGPQSLNQLSKIAQARFSDIPS----IPTLQVPRLLRWRSSSSFDKNRN 271
            + +  M LC+ G + L  LS+ A+  F ++P+    +PT   P    W  +   DK + 
Sbjct: 226 WYSSNIMNLCIIGREDLGTLSRWAKILFENVPNKNVILPTFSQP---VWTIA---DKKKV 279

Query: 272 LSVRPLESFQILKDAWSARYAKKPVFDKTPMHNSIMVQSSKSPVIRFVFPINYFSTRFTD 331
           +SV+P++  + L+  +  +  +   +   P +                            
Sbjct: 280 ISVKPVKDLKQLELTFHIKEDELTTWKSKPSY---------------------------- 311

Query: 332 RELATYTQIWCELLGDECEGSLCHYLRSHSYITELIAYSSNFAVNDTGLILQLHLTNHGW 391
                   I   L G +  GS+   L++   IT + + S N +  ++   L   LT  G 
Sbjct: 312 --------ILSHLFGHKGNGSISSLLKNQQLITGISSGSENISKENSLFSLNFDLTEDGI 363

Query: 392 LNVQKIIPIVWKYLIPAILDAPLSSLAQYISELNSLDLLKFLYQELERSPMDRCADLCES 451
              +KII IV++Y+   +L++ L     Y +EL  +    F Y++ + +P    + L + 
Sbjct: 364 NQYEKIIKIVFQYI--KMLNSNLPQEWIY-NELKGISDNSFKYKQ-KINPASTVSQLSKR 419

Query: 452 LLQDLSAIDLSFLLKSTLTYFECNNLSVANLGTYRENQTSKDWWRGEAVKFQAFVNEFMS 511
           + +               T+   NN+    L           ++  +  +   ++ +F++
Sbjct: 420 MEK---------------TFIPINNILSHEL-----------FYEYDPQQLNKYL-KFLT 452

Query: 512 QDTVRIILLG-NLSKCYFNCNPDKITTDTYFEYEY-VKIFIDLEVLGCDDIHYRFTIPGP 569
            D  RI+L+  NL+  +         ++ ++  +Y VK + D  +    +I     +  P
Sbjct: 453 PDNSRIMLVSKNLNGLH--------KSEKWYGTKYGVKDYPDGLLKDLSNIKENSELYLP 504

Query: 570 NPFMVPVGHKLSFIKHALLASSVQSENSALSVVAQSDLVRASPRLAGKNSYYELWLKEED 629
                   HK  FI        V++       VAQ +     P L   ++  +LW K++D
Sbjct: 505 --------HKNEFISTTCSVKKVENH------VAQIE-----PYLLKDDNISKLWYKKDD 545

Query: 630 VDLSFRSKSIFSMELISTSLEPAPEYTMHLEILGQLLYSILGPILYPAERAGYTYELSLS 689
                R+    S++L      P    ++   +L     +++   L          +L +S
Sbjct: 546 TFWLPRATIFVSIKL------PHTHSSLVANVLTSFYINLVNDALQDLRCYAACADLYVS 599

Query: 690 -SKGDVRLGLTISGFTDGILNLLKIIVDAIVNLSQDLNSIPKDIFRKARI--LVRTKYKE 746
            +K +  L LT++G  D +L LLK  ++ I +   +      ++ +K  I  L    Y  
Sbjct: 600 LNKTNQGLDLTLTGLNDKLLILLKRYLEGIKSFVPNEERF--EVIKKQTIQSLTNRLYD- 656

Query: 747 ASSESCVTLASLGLLI--LLENCMWPLEDRLEALEDIYVESFRIFLEKFINGDNYLNILI 804
                 V    +G +   L+    W +E+ L+ ++DI     + F+        +  +  
Sbjct: 657 ------VPYIQMGDIYSSLINERSWSVEENLKVVQDIDFPQLQDFIPTIYQELFFETLAF 710

Query: 805 QGSDMTIADNINEYLSERLTHHISRADDNVCRLSEPATYVIPEGSNLFFKRVGFHDDPNN 864
                  A  ++  +   + + I  +     RL    +Y+IP G    FK   F  D NN
Sbjct: 711 GNIQYEQAQEVDSLVRTLIPNTIKNSQVKNDRLR---SYIIPSGKT--FKYEVFQKDKNN 765

Query: 865 ---SIVYFIQTGERDNNYIYTLTVLTEFIMSQTLVPDLRQKKQIGYIVLGGLRVLSDTVG 921
               I Y  Q G   + Y+  +  L   IM +     LR K+Q+GYIV         T  
Sbjct: 766 LNTCIQYICQFGIY-SEYLAAVVSLLAQIMHEPCFNTLRTKEQLGYIVFSSSLSNHGTCN 824

Query: 922 LHITTMAGSPPEFLEEKI----NEYLAYLEDM 949
           L I   +    ++L+ +I     ++L+YL++M
Sbjct: 825 LSIMVQSEYSTDYLQFRIENFLKDFLSYLKEM 856

>Kwal_23.4237 s23 (630432..633437) [3006 bp, 1001 aa] {ON} YLR389C
           (STE23) - involved in a-factor processing [contig 1]
           FULL
          Length = 1001

 Score =  156 bits (394), Expect = 8e-38,   Method: Compositional matrix adjust.
 Identities = 108/372 (29%), Positives = 183/372 (49%), Gaps = 52/372 (13%)

Query: 37  FLISDPSETVASCAVSIATGSHNDPVEIPGLAHFCEHMVLSSGSKRHPEPNAFHETLSKN 96
            LI D +   A+ A+ +  GS  DP  +PGLAHFCEH++   GS ++P  N +   LSK+
Sbjct: 70  LLIQDVNTDKAAAALDVNVGSFEDPENLPGLAHFCEHLLFM-GSSKYPNENEYSSYLSKH 128

Query: 97  NGSQNAHTSGEQTSFYFELPSSQSSDSLVFDQVVGILADALKEPIFHDVLINKEIYAINS 156
            G  NA+TS + T+++F++  +Q +     D+  G  +     P+F+    +KEI A++S
Sbjct: 129 GGGSNAYTSSQNTNYFFQV--NQGNLHGALDRFSGFFSC----PLFNKDSTDKEINAVDS 182

Query: 157 EHVGNKSSLTKMMYHAVRLLASPEHPFHQFGTGNIFTLTNMPKLHKLSLKNELVKYFREH 216
           E+  N  S    +Y   +  +SPEHP+H+F TGN+ TL  +PK   L +++EL+K++   
Sbjct: 183 ENKKNLQSDLWRLYQLDKSQSSPEHPYHKFSTGNLKTLGELPKSQNLDVRDELLKFYNRS 242

Query: 217 FFAENMVLCLRGPQSLNQLSKIAQARFSDIPS--IPTLQVP-RLLRWRSSSSFDKNRNLS 273
           + A  M LC+ G + L+ LS+     F D+P+  +P    P RLL  ++         +S
Sbjct: 243 YSANLMKLCVLGREDLDVLSQWVYDLFKDVPNRDVPVPSYPTRLLLPQNLEQI-----IS 297

Query: 274 VRPLESFQILKDAWSARYAKKPVFDKTPMHNSIMVQSSKSPVIRFVFPINYFSTRFTDRE 333
            +P++  + ++  + A     P +D  P H                    Y S       
Sbjct: 298 AKPVKDIKRVEVNFVAP-DMDPYWDSKPGH--------------------YLS------- 329

Query: 334 LATYTQIWCELLGDECEGSLCHYLRSHSYITELIAYSSNFAVNDTGLILQLHLTNHGWLN 393
                     L+G E  GSL  YL+S  +  EL A S   + ++    + + LT+ G  N
Sbjct: 330 ---------HLIGHEGSGSLLAYLKSKGWANELSAGSHTVSKDNGFFSISIDLTDEGIAN 380

Query: 394 VQKIIPIVWKYL 405
            + ++  V++Y+
Sbjct: 381 YEDVVISVFQYI 392

 Score = 51.2 bits (121), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 79/360 (21%), Positives = 148/360 (41%), Gaps = 30/360 (8%)

Query: 609 RASPRLAGKNSYYELWLKEEDVDLSFRSKSIFSMELISTSLEPAPEYTMHLEILGQLLYS 668
           R  P L  ++    LW K++D     +     SM+L+ T    +   +M   +   L+  
Sbjct: 539 RQEPLLLLQDGQSRLWYKKDDRFWVPKGHIYVSMKLVHTY--SSIVNSMLTSLYVDLVND 596

Query: 669 ILGPILYPAERAGYTYELSLSSKGDVRLGLTISGFTDGILNLLKIIVDAIVNLSQDLNSI 728
            L  I Y ++ A  T     +++G   L L +SG+ + +  LL   ++ I     +    
Sbjct: 597 FLKDIQYDSQVASLTVSFRKTNQG---LDLALSGYNEKMPILLTSYLEGISRFKPN---- 649

Query: 729 PKDIFRKARILVRTKYKEASSESCVTLASLGLLILLENCMWPLEDRLEALEDIYVESFRI 788
            ++ F+  +  +  K      E   + AS     L+    W ++D+LE +E +  +    
Sbjct: 650 -QERFKIFQAKLIQKLNNHLYEIPYSQASDVYNSLINERSWTIKDKLEVVEQLTFQHLEN 708

Query: 789 FL----EKFINGDNYLNILIQGS-DMTIADNINEYLSERLTHHISRADDNVCRL--SEPA 841
           FL    E+F     +   L+ G+     A  I+     +L   ++  D   C L  S+P 
Sbjct: 709 FLPTIFEQF-----FFEALVHGNFSYETAVEIH-----KLVKALAPNDIKNCLLKSSKPR 758

Query: 842 TYVIPEGSNLFF-KRVGFHDDPNNSIVYFIQTGERDNNYIYTLTVLTEFIMSQTLVPDLR 900
           +  IP G   ++ +R+    + N+ I +  Q G           +  + I  +     LR
Sbjct: 759 SLHIPPGRAYYYEQRLADEKNINSCIQHVNQFGTYSEELAAKAALFAQLI-DEPAFDTLR 817

Query: 901 QKKQIGYIVLGGLRVLSDTVGLHITTMAGSPPEFLEEKINEYLAYLEDMVLAKLTAPQFK 960
            K+Q+GY+V         TV L I   +     FLE +I+ +LA +   +L  ++  +F+
Sbjct: 818 TKEQLGYVVFSSALNTHGTVNLRILIQSERDTAFLESRIDAFLAKM-GQILQDMSEEEFE 876

>KLTH0D14278g Chr4 complement(1172523..1175528) [3006 bp, 1001 aa]
           {ON} similar to uniprot|Q06010 Saccharomyces cerevisiae
           YLR389C STE23 Metalloprotease involved with homolog
           Axl1p in N-terminal processing of pro-a-factor to the
           mature form member of the insulin-degrading enzyme
           family
          Length = 1001

 Score =  152 bits (383), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 106/371 (28%), Positives = 180/371 (48%), Gaps = 48/371 (12%)

Query: 36  TFLISDPSETVASCAVSIATGSHNDPVEIPGLAHFCEHMVLSSGSKRHPEPNAFHETLSK 95
             LI DP+   A+ A+ +  GS  DP ++PGLAHFCEH++   GS + P  N +   LSK
Sbjct: 69  ALLIQDPTTDKAAAALDVNVGSFEDPEDLPGLAHFCEHLLFM-GSSKFPNENEYSSYLSK 127

Query: 96  NNGSQNAHTSGEQTSFYFELPSSQSSDSLVFDQVVGILADALKEPIFHDVLINKEIYAIN 155
           + G  NA+TS   T+++F++       +L+  +  G  +     P+F+    +KEI A++
Sbjct: 128 HGGGSNAYTSARNTNYFFQVNQESLHGALL--RFSGFFSC----PLFNKESTDKEINAVD 181

Query: 156 SEHVGNKSSLTKMMYHAVRLLASPEHPFHQFGTGNIFTLTNMPKLHKLSLKNELVKYFRE 215
           SE+  N  S    +Y   +  ++PEHPFH+F TGN+ TL ++PK   + +++EL+K++  
Sbjct: 182 SENKKNLQSDLWRLYQLDKSQSNPEHPFHKFSTGNLKTLGDIPKSKDVDIRDELLKFYDS 241

Query: 216 HFFAENMVLCLRGPQSLNQLSKIAQARFSDIPSIPTLQVPRLLRWRSSSSFDKNRNLSVR 275
            + A  M LC+ G + L+ +S+     F D+P+                        S R
Sbjct: 242 SYSANLMKLCVLGREDLDTMSQWVYDLFKDVPN------------------------SDR 277

Query: 276 PLESFQILKDAWSARYAKK-PVFDKTPMHNSIMVQSSKSPVIRFVFPINYFSTRFTDREL 334
           P+ +++          AK  P    T + N+  V+  K   I FV P         ++  
Sbjct: 278 PVPTYE----------AKMLPPQYLTQIINAKPVKDLKKVEITFVAP------DVDEQWD 321

Query: 335 ATYTQIWCELLGDECEGSLCHYLRSHSYITELIAYSSNFAVNDTGLILQLHLTNHGWLNV 394
           +        L+G E  GSL  YL+   +  EL A S   + ++    + + LT+ G  N 
Sbjct: 322 SKPGHYLSHLIGHEGSGSLLAYLKLKGWANELSAGSHTVSEDNAFFSVDIDLTDEGVKNY 381

Query: 395 QKIIPIVWKYL 405
           + +I  V++Y+
Sbjct: 382 ESVIQSVFQYI 392

 Score = 51.2 bits (121), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 72/360 (20%), Positives = 154/360 (42%), Gaps = 28/360 (7%)

Query: 612 PRLAGKNSYYELWLKEEDVDLSFRSKSIFSMELIST--SLEPAPEYTMHLEILGQLLYSI 669
           P L  ++   ++W K++D     +     SM+L  T  S+  +   T+++E++       
Sbjct: 542 PLLLKQDRQSKVWYKKDDRFWVPKGHIYVSMKLAHTYSSVVNSMLTTLYVELIN----DY 597

Query: 670 LGPILYPAERAGYTYELSLSSKGDVRLGLTISGFTDGILNLLKIIVDAIVNLSQDLNSIP 729
           L  + Y A+ A        +++G   L L++SG+ + +  LLK  ++ I N         
Sbjct: 598 LKDLEYDAQVASLHISFRKTNQG---LDLSLSGYNEKMAILLKRYLEGIANFQP-----A 649

Query: 730 KDIFRKARILVRTKYKEASSESCVTLASLGLLILLENCMWPLEDRLEALEDIYVESFRIF 789
           +D F+  +  +  K      E   +  S     ++    W + ++LE ++ +  E  ++F
Sbjct: 650 EDRFKIYQDKLLQKLNNHLYEVPYSQVSDVFNSVINERAWTIANKLEVVKQLKFEHLKLF 709

Query: 790 LEKFINGDNYLNILIQGS----DMTIADNINEYLSERLTHHISRADDNVCRLSEPATYVI 845
           +       ++  IL+ G+        ADN+   L+ R   +         + S+P + ++
Sbjct: 710 IPAIFEQFSF-EILVHGNFSCEAALEADNLVRALAPRDVQNFQ------LKSSKPRSVLL 762

Query: 846 PEGSNLFFKRVGFHD-DPNNSIVYFIQTGERDNNYIYTLTVLTEFIMSQTLVPDLRQKKQ 904
           P+G    ++++   D + N+ I +  Q G          ++  + I  +     LR K+Q
Sbjct: 763 PQGKTFCYQQMLADDKNINSCIQHVTQFGSYSEELSAKASLFAQLI-DEPAFDTLRTKEQ 821

Query: 905 IGYIVLGGLRVLSDTVGLHITTMAGSPPEFLEEKINEYLAYLEDMVLAKLTAPQFKHDYV 964
           +GY+V         TV L +   +     +LE +I+ +L  +   VL +++  +F+   V
Sbjct: 822 LGYVVFSSALNTHGTVNLRLLIQSERDTAYLESRIDAFLVKM-GQVLQEMSDEEFERHKV 880

>Ecym_3273 Chr3 (515048..518119) [3072 bp, 1023 aa] {ON} similar to
           Ashbya gossypii AER053C
          Length = 1023

 Score =  150 bits (378), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 117/421 (27%), Positives = 197/421 (46%), Gaps = 52/421 (12%)

Query: 37  FLISDPSETVASCAVSIATGSHNDPVEIPGLAHFCEHMVLSSGSKRHPEPNAFHETLSKN 96
           FLI D S   A+ A+ +  G   DP ++PGLAHFCEH++   GS++ P  N +   LS +
Sbjct: 92  FLIQDKSTDKAAAALDVNVGFFQDPEDLPGLAHFCEHLLFM-GSEKFPNENEYSSYLSHH 150

Query: 97  NGSQNAHTSGEQTSFYFELPSSQSSDSLVFDQVVGILADALKEPIFHDVLINKEIYAINS 156
            G+ NA+TS + T++YF +      D+L  D+  G        P+F     NKE+ A++S
Sbjct: 151 GGASNAYTSTQNTNYYFMVNHGNLYDAL--DRFSGFFTS----PLFSVSSTNKEVNAVDS 204

Query: 157 EHVGNKSSLTKMMYHAVRLLASPEHPFHQFGTGNIFTLTNMPKLHKLSLKNELVKYFREH 216
           E+  N  S    M    R L +P HPFH+F TGN  TL   PK   + ++ EL+K++ + 
Sbjct: 205 ENKKNLQSDLWRMQQLDRSLTNPGHPFHKFSTGNYQTLYKEPKSRGIEIREELLKFYDKT 264

Query: 217 FFAENMVLCLRGPQSLNQLSKIAQARFSDIPSIPTLQVPRLLRWRSSSSFDKNRNLSVRP 276
           + A  M L + G + L+ LS  A   F D+P                     ++ + V  
Sbjct: 265 YSANLMRLVILGMEDLDTLSAWAYELFKDVP---------------------DKGIDVHE 303

Query: 277 LESFQILKDAWSARYAK-KPVFDKTPMHNSIMVQSSKSPVIRFVFPINYFSTRFTDRELA 335
             + ++    +  +  K KP+ D   +  S  V  +++               F D   A
Sbjct: 304 YNA-KVFTPTYLTKIIKAKPIKDLKRVEVSFDVPDTET---------------FWDSRPA 347

Query: 336 TYTQIWCELLGDECEGSLCHYLRSHSYITELIAYSSNFAVNDTGLILQLHLTNHGWLNVQ 395
            Y      L+G E   SL  YL S S+ TEL   +   +  +    + + LT+ G  + +
Sbjct: 348 DYI---SHLIGHESSNSLLSYLISQSWATELYCGAQTVSKGNAYFCIHIELTDKGVQDYE 404

Query: 396 KIIPIVWKYLIPAILDAPLSSLAQYISELNSLDLLKFLYQELERSPMDRCADLCESLLQD 455
           +++  V++Y+   +L   L     ++ ELN +   KF +++ + SP +  + L ++L +D
Sbjct: 405 EVVYTVFQYI--EMLKKSLPQERIFV-ELNKIGESKFRFKQ-KGSPSNTVSSLAKNLQKD 460

Query: 456 L 456
            
Sbjct: 461 F 461

 Score = 59.7 bits (143), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 73/332 (21%), Positives = 151/332 (45%), Gaps = 29/332 (8%)

Query: 623 LWLKEEDVDLSFRSKSIFSMELISTSLEPAPEYTMHLEILGQLLYSILGPILYPAERAGY 682
            W+ E  V +SF+    +S  ++++ L      T+++E++       L  +LY AE A +
Sbjct: 583 FWVPEGHVYVSFKLPHSYS-SVVNSMLS-----TLYVEMVK----DSLKDLLYNAECANF 632

Query: 683 TYELSLSSKGDVRLGLTISGFTDGILNLLKIIVDAIVNLSQDLNSIPKDIFRKARILVRT 742
                 +++G   L L+++G+ D +  LL  I++ I N   D      D+ +K  +L + 
Sbjct: 633 EVSFVKTNQG---LDLSLTGYNDKMTLLLTSILEGIRNF--DPKKERFDVLQK--LLCQK 685

Query: 743 KYKEASSESCVTLASLGLLI--LLENCMWPLEDRLEALEDIYVESFRIFLEKFINGDNYL 800
            Y    +   V  + +G+L   L+ +  W   ++L+  + +  E F+ F+   I    Y 
Sbjct: 686 LYNRLYN---VPYSQIGVLYNSLINDRSWTPSEKLKVTKQLTFEHFKAFVPS-IYEQMYF 741

Query: 801 NILIQGS-DMTIADNINEYLSERLTHHISRADDNVCRLSEPATYVIPEGSNLFFKRVGFH 859
             L+ G+     A  +N Y+   + + I  +     R + P +Y++PEG    ++   F 
Sbjct: 742 ETLVHGNFPENQAIELNSYICSLIPNQIKHSG---ARNNRPRSYMLPEGKTYRYETTLFD 798

Query: 860 DDPNNSIV-YFIQTGERDNNYIYTLTVLTEFIMSQTLVPDLRQKKQIGYIVLGGLRVLSD 918
           ++  NS     IQ G    +     ++L + I ++     LR ++Q+GY+V    +    
Sbjct: 799 EENVNSCFEMVIQLGMYSEDMNAKGSLLAQLI-NEPCFNTLRTEEQLGYVVWSSKQNTHA 857

Query: 919 TVGLHITTMAGSPPEFLEEKINEYLAYLEDMV 950
           +  L I   + S   ++E +++++L    D +
Sbjct: 858 STNLRILVQSESDTVYIESRVDKFLNNFADTL 889

>Smik_12.476 Chr12 complement(838321..841398) [3078 bp, 1025 aa]
           {ON} YLR389C (REAL)
          Length = 1025

 Score =  149 bits (375), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 117/446 (26%), Positives = 211/446 (47%), Gaps = 57/446 (12%)

Query: 36  TFLISDPSETVASCAVSIATGSHNDPVEIPGLAHFCEHMVLSSGSKRHPEPNAFHETLSK 95
             LI DP    A+ ++ +  G+  DP ++PGLAHFCEH++   GS++ P+ N +   LSK
Sbjct: 85  ALLIQDPKADKAAASLDVNIGAFEDPEKLPGLAHFCEHLLFM-GSEKFPDENEYSSFLSK 143

Query: 96  NNGSQNAHTSGEQTSFYFELPSSQSSDSLVFDQVVGILADALKEPIFHDVLINKEIYAIN 155
           + GS NA+T+ + T+++FE+      D+L  D+  G  +     P+F+    +KEI A+N
Sbjct: 144 HGGSSNAYTASQNTNYFFEVNHQHLFDAL--DRFSGFFSC----PLFNKDSTDKEINAVN 197

Query: 156 SEHVGNKSSLTKMMYHAVRLLASPEHPFHQFGTGNIFTLTNMPKLHKLSLKNELVKYFRE 215
           SE+  N  +    +Y   + L + +HP+H+F TGNI TL   PK + L++++EL+K+ ++
Sbjct: 198 SENKKNLQNDIWRIYQLDKSLTNTKHPYHKFSTGNIETLGTSPKENGLNIRDELLKFHKD 257

Query: 216 HFFAENMVLCLRGPQSLNQLSKIAQARFSDIPSIPTLQVPRLLRWRSSSSFDKNRNLSVR 275
            + A  M LC+ G + L+ LS      F ++ S    +VP                    
Sbjct: 258 FYSANLMKLCILGREDLDTLSDWVYDLFKNV-SNNGREVP-------------------- 296

Query: 276 PLESFQILKDAWSARYAKKPVFDKTPMHNSIMVQSSKS-PVIRFVFPINYFSTRFTDREL 334
                          Y  +P+     +   I V+  K    +   F +      +  R  
Sbjct: 297 ---------------YYAEPIMQPEHLQKIIQVRPVKDLKKLEISFAVPDMEEHWESRP- 340

Query: 335 ATYTQIWCELLGDECEGSLCHYLRSHSYITELIAYSSNFAVNDTGLILQLHLTNHGWLNV 394
               +I   L+G E  GSL  +L+   +  EL A     +  +    + + LT++G ++ 
Sbjct: 341 ---PRILSHLIGHEGSGSLLAHLKKLGWANELSAGGHTVSKGNAFFAVDIDLTDNGLIHY 397

Query: 395 QKIIPIVWKYLIPAILDAPLSSLAQ--YISELNSLDLLKFLYQELERSPMDRCADLCESL 452
           + +I ++++Y     ++   +SL Q    +EL  +    F ++++ R P    + L + L
Sbjct: 398 RDVIILIFQY-----IEMLKNSLPQKWIFNELQDISNATFKFKQVGR-PSSTVSSLAKCL 451

Query: 453 LQDLSAIDLSFLLKSTLTYFECNNLS 478
            +D   +D   L  S LT +E + L+
Sbjct: 452 EKDYIPVD-RILAMSLLTKYEPDLLT 476

 Score = 38.1 bits (87), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 70/326 (21%), Positives = 128/326 (39%), Gaps = 25/326 (7%)

Query: 623 LWLKEEDVDLSFRSKSIFSMELISTSLEPAPEYTMHLEILGQLLYSILGPILYPAERAGY 682
           LW K++D     R     S +L  T           L I  QL+   L  + Y A  A  
Sbjct: 569 LWYKKDDRFWQPRGYIYLSFKLPHTHASIVNSMLSTLYI--QLVNDALKDLQYDAACADL 626

Query: 683 TYELSLSSKGDVRLGLTISGFTDGILNLLKIIVDAIVNL--SQDLNSIPKD--IFRKARI 738
               S +++G   L +T SGF + ++ LL   +  + +    +D   I KD  I     +
Sbjct: 627 RISFSKTNQG---LDITASGFNEKLIILLTRFLQGVTSFEPKKDRFEILKDKTIRHLKNL 683

Query: 739 LVRTKYKEASSESCVTLASLGLLILLENCMWPLEDRLEALEDIYVESFRIFLEKFINGDN 798
           L    Y + S+             L+    W   ++L+  E +  E    F+     G  
Sbjct: 684 LYEVPYSQMSNYYNA---------LINERSWSTVEKLQVFEKLTFEQLINFIPTIYEG-V 733

Query: 799 YLNILIQGS-DMTIADNINEYLSERLTHHISRADDNVCRLSEPATYVIPEGSNLFFKRVG 857
           +   LI G+     A  ++  +   +T++I+       RL    +Y++P+G +  ++   
Sbjct: 734 FFETLIHGNIKHEEAVEVDSLIKSLITNNINNLQVANNRLR---SYLLPKGKSFRYE-TA 789

Query: 858 FHDDPN-NSIVYFIQTGERDNNYIYTLTVLTEFIMSQTLVPDLRQKKQIGYIVLGGLRVL 916
             D  N NS +  +   +  +  +  L+ L   ++ +     LR K+Q+GY+V       
Sbjct: 790 LKDSQNVNSCIQHVTQLDVYSEELSALSGLFAQLIHEPCFDTLRTKEQLGYVVFSSSLNN 849

Query: 917 SDTVGLHITTMAGSPPEFLEEKINEY 942
             T  + I   +     +LE +IN +
Sbjct: 850 HGTANIRILIQSEHTTPYLEWRINNF 875

>KNAG0B06080 Chr2 complement(1197765..1200755) [2991 bp, 996 aa]
           {ON} Anc_4.246 YLR389C
          Length = 996

 Score =  148 bits (374), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 208/911 (22%), Positives = 370/911 (40%), Gaps = 121/911 (13%)

Query: 37  FLISDPSETVASCAVSIATGSHNDPVEIPGLAHFCEHMVLSSGSKRHPEPNAFHETLSKN 96
            LISDP+   A+ A+ +  G+  DP E+PGLAHFCEH++   GS + P  N +   LSK+
Sbjct: 59  LLISDPTTDKAAAALDVNIGAFEDPEELPGLAHFCEHLLFM-GSSKFPNENEYSSYLSKH 117

Query: 97  NGSQNAHTSGEQTSFYFELPSSQSSDSLVFDQVVGILADALKEPIFHDVLINKEIYAINS 156
            GS NA+T  + T++YF++       +L  D+  G        P+F+    +KEI A++S
Sbjct: 118 GGSSNAYTGAQNTNYYFQVNYEHLYGAL--DRFSGFFTG----PLFNKESTDKEINAVDS 171

Query: 157 EHVGNKSSLTKMMYHAVRLLASPEHPFHQFGTGNIFTLTNMPKLHKLSLKNELVKYFREH 216
           E+  N  +    +Y   + L +  HP+H+F TGN+ TL   PK   L +++EL+K++ + 
Sbjct: 172 ENKKNLQNDLWRLYQLDKSLTNGGHPYHKFSTGNLETLGTTPKELGLDIRDELLKFYNKS 231

Query: 217 FFAENMVLCLRGPQSLNQLSKIAQARFSDIPSIPTLQVPRLLRWRSSSSFDKNRNLSVRP 276
           + A  M LC+ G + L+ ++K  +  F D+ ++           R+   ++  R L    
Sbjct: 232 YSANLMKLCILGREDLDTMTKWVEELFQDVKTLD----------RALPEYN-TRILDADH 280

Query: 277 LESFQILKDAWSARYAKKPVFDKTPMHNSIMVQSSKSPVIRFVFPINYFSTRFTDRELAT 336
           L+  +I+K                 +H    V+  K   + FV P         +   + 
Sbjct: 281 LQ--EIIK-----------------VH---PVKELKKVEVSFVVP------DVDEHWESK 312

Query: 337 YTQIWCELLGDECEGSLCHYLRSHSYITELIAYSSNFAVNDTGLILQLHLTNHGWLNVQK 396
              I   L+G E  GSL  YL++  +  EL A     +  +    + + LT+ G  + ++
Sbjct: 313 PPHILSHLIGHEGTGSLLAYLKTKGWANELSAGGHTVSKGNAFFSVDIDLTDDGLAHYEE 372

Query: 397 IIPIVWKYLIPAILDAPLSSLAQYISELNSLDLLKFLYQELERSPMDRCADLCESLLQDL 456
           ++  V++Y+       P + +   + E+   +  KF   E + SP +  + L ++L ++ 
Sbjct: 373 VVHNVFQYIKMLQNCLPQNWVFHELQEIAQAN-FKF---EQKGSPSNTVSTLAKALEKE- 427

Query: 457 SAIDLSFLLKSTLTYFECNNLSVANLGTYRENQTSKDWWRGEAVKFQAFVNEFMSQDTVR 516
                         Y   N +    L T  E +    + R             +  +  R
Sbjct: 428 --------------YIPVNRILSNGLLTKYEPELVAQYCRD------------LKPENSR 461

Query: 517 IILLGNLSKCYFNCNPDKITTDTYFEYEYVKIFID-LEVLGCDDIHYRFTIPGPNPFMVP 575
           I L+G       +    K       EYE  K   D L  +    ++    +P PN     
Sbjct: 462 ITLIGK------DLKTSKREKWYGTEYEVEKYSPDLLAKISTPLLNSHLHLPHPN----- 510

Query: 576 VGHKLSFIKHALLASSVQSENSALSVVAQSDLVRASPRLAGKNSYYELWLKEEDVDLSFR 635
                 FI +       +  +SA  +V   + +  S    GK     +W K++D     R
Sbjct: 511 -----EFIANNFKVDKPEG-SSADEIVPLEEPLLISENETGK-----VWFKKDDRFWQPR 559

Query: 636 SKSIFSMELISTSLEPAPEYTMHLEILGQLLYSILGPILYPAERAGYTYELSLSSKGDVR 695
                + +L  T    +   +M   +  QL+   L  + Y A  A        +++G   
Sbjct: 560 GYIYLTFKLPHT--HASALNSMLSTLYVQLINDSLKDLQYNANCANLRASFVKTNQG--- 614

Query: 696 LGLTISGFTDGILNLLKIIVDAI--VNLSQDLNSIPKDIFRKARILVRTKYKEASSESCV 753
           L LT+ GF D ++ LL  +++ I    L Q    I KD  +  + L    Y+   S+   
Sbjct: 615 LDLTLYGFNDKLIILLTRLLEGIKSFKLEQPQFKIFKD--KSVQHLKNLMYEVPYSQIST 672

Query: 754 TLASLGLLILLENCMWPLEDRLEALEDIYVESFRIFLEKFINGDNYLNILIQGS-DMTIA 812
                    L+    W +E++L+ +E I  E    F+      + Y   LI G+     A
Sbjct: 673 VYN-----YLINERSWSVEEKLDVMEKITYEELINFIPTIFE-ELYFEALIHGNLKYEEA 726

Query: 813 DNINEYLSERLTHHISRADDNVCRLSEPATYVIPEGSNLFFK-RVGFHDDPNNSIVYFIQ 871
             I   +       ++R      R+    +Y+IP G    ++ ++    + N+ I Y  Q
Sbjct: 727 MEIASLVKILQPSDVTRLQTKNSRMR---SYLIPRGETYRYETKLKDAKNVNSCIQYVTQ 783

Query: 872 TGERDNNYIYTLTVLTEFIMSQTLVPDLRQKKQIGYIVLGGLRVLSDTVGLHITTMAGSP 931
               D        +  + I  +     LR K+Q+GY+V         T  + I   +   
Sbjct: 784 LDVYDEKLSAKSGLFAQMI-HEPCFDTLRTKEQLGYVVFSSSLNNHGTANMRILIQSEHT 842

Query: 932 PEFLEEKINEY 942
             +LE +I+ +
Sbjct: 843 TPYLEFRIDTF 853

>KLLA0E05105g Chr5 (447645..450659) [3015 bp, 1004 aa] {ON} similar
           to uniprot|Q06010 Saccharomyces cerevisiae YLR389C STE23
           Metalloprotease involved with homolog Axl1p in
           N-terminal processing of pro-a-factor to the mature form
           member of the insulin-degrading enzyme family
          Length = 1004

 Score =  145 bits (365), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 109/370 (29%), Positives = 176/370 (47%), Gaps = 46/370 (12%)

Query: 36  TFLISDPSETVASCAVSIATGSHNDPVEIPGLAHFCEHMVLSSGSKRHPEPNAFHETLSK 95
             LISD     A+ A+ +  GS  DP  +PGLAHFCEH++   G++++P+ N +   LSK
Sbjct: 73  ALLISDAEADKAAAALDVNIGSFQDPEHLPGLAHFCEHLLFM-GNEKYPDENDYSSFLSK 131

Query: 96  NNGSQNAHTSGEQTSFYFELPSSQSSDSLVFDQVVGILADALKEPIFHDVLINKEIYAIN 155
           + GS NA+T  + T++YF L       +L  D+  G  +     P+F+    +KEI A++
Sbjct: 132 HGGSSNAYTGSQNTNYYFHLNHENLYPAL--DRFSGFFSC----PLFNKASTDKEINAVD 185

Query: 156 SEHVGNKSSLTKMMYHAVRLLASPEHPFHQFGTGNIFTLTNMPKLHKLSLKNELVKYFRE 215
           SE+  N  +    MY   + L + EHP+H+F TGNI TL ++PKL  + ++NEL+ + + 
Sbjct: 186 SENKKNLQNDIWRMYQLDKSLTNWEHPYHKFSTGNIKTLGDIPKLKGIDIRNELLDFHKN 245

Query: 216 HFFAENMVLCLRGPQSLNQLSKIAQARFSDIPSIPTLQVPRLLRWRSSSSFDKNRNLSVR 275
           ++ A  M LC+ G + L+ L+      F D+P++   QVP                   R
Sbjct: 246 NYSANLMKLCVLGREDLDTLADWVYELFKDVPNL-NKQVPY---------------YPAR 289

Query: 276 PLESFQILKDAWSARYAKKPVFDKTPMHNSIMVQSSKSPVIRFVFPINYFSTRFTDRELA 335
                Q+ K  +      KPV D                 I F FP       +  +   
Sbjct: 290 LYTESQLKKMVYC-----KPVKDLKK--------------IEFTFPTPDMDPYWESKP-- 328

Query: 336 TYTQIWCELLGDECEGSLCHYLRSHSYITELIAYSSNFAVNDTGLILQLHLTNHGWLNVQ 395
                   L+G E  GSL  +L+   +  EL A S   + ++    +++ LT+ G  +V 
Sbjct: 329 --NHYLSHLIGHEGNGSLLAFLKEKGWAVELSAGSHTISKDNAVFGIEIDLTDDGMNHVN 386

Query: 396 KIIPIVWKYL 405
           +II   ++YL
Sbjct: 387 EIIISTFQYL 396

 Score = 37.0 bits (84), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 65/337 (19%), Positives = 137/337 (40%), Gaps = 23/337 (6%)

Query: 612 PRLAGKNSYYELWLKEEDVDLSFRSKSIFSMELISTSLEPAPEYTMHLEILGQLLYSILG 671
           P L   + Y +LW K++D     +     SM+L  T    +   +M   +   ++   L 
Sbjct: 546 PFLLKDDHYSKLWYKKDDRFWVPKGHIYVSMKLPHTF--SSVVNSMLTSLYVDMIKDALV 603

Query: 672 PILYPAERAGYTYELSLSSKGDVRLGLTISGFTDGILNLLKIIVDAIVNLS---QDLNSI 728
            + Y A  A     L  +++G   + +  SG+ + +  LL   ++ I +        N I
Sbjct: 604 DLQYDASCADLRITLGKTNQG---IDIQASGYNEKLTILLTRFLEGIKSFQPKESRFNVI 660

Query: 729 PKDIFRKARILVRTKYKEASSESCVTLASLGLLILLENCMWPLEDRLEALEDIYVESFRI 788
              + +K   L   +Y    ++      SL     +    W  + +L+  +D+  E  + 
Sbjct: 661 KNRLLQK---LSNQQYDVPYNQISNVFNSL-----VNERSWTTKAKLDVTKDLTFEHLKS 712

Query: 789 FLEKFINGDNYLNILIQGSDMTIADNINEYLSERLTHHISRADDNVCRLSEPATYVIPEG 848
           F+        + ++++    + +A  IN+ +   +   I   +    +L    +Y++PE 
Sbjct: 713 FVPTIYEQLFHESLVLGNFSVEMAYEINQLVDILVVDRIPNLEVKNNKLR---SYILPEE 769

Query: 849 SNLFFKRVGFHD--DPNNSIVYFIQTGERDNNYIYTLTVLTEFIMSQTLVPDLRQKKQIG 906
           S   ++ +   D  + N+ I Y IQ G          +++++ I  +     LR K+Q+G
Sbjct: 770 SAFRYEYM-LEDKANVNSCIQYLIQLGAYSEELAAKASLVSQLI-HEPCFDTLRTKEQLG 827

Query: 907 YIVLGGLRVLSDTVGLHITTMAGSPPEFLEEKINEYL 943
           YIV   +     T  L +   +     ++E +I ++L
Sbjct: 828 YIVFSAVANTHGTTNLRVLVQSERDSAYVESRIVKFL 864

>Skud_12.474 Chr12 complement(839782..842850) [3069 bp, 1022 aa]
           {ON} YLR389C (REAL)
          Length = 1022

 Score =  144 bits (363), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 102/370 (27%), Positives = 181/370 (48%), Gaps = 46/370 (12%)

Query: 36  TFLISDPSETVASCAVSIATGSHNDPVEIPGLAHFCEHMVLSSGSKRHPEPNAFHETLSK 95
             LI DP    A+ ++ +  G+  DP  +PGLAHFCEH++   GS++ P+ N +   LSK
Sbjct: 85  ALLIQDPKADKAAASLDVNIGAFEDPESLPGLAHFCEHLLFM-GSEKFPDENEYSSYLSK 143

Query: 96  NNGSQNAHTSGEQTSFYFELPSSQSSDSLVFDQVVGILADALKEPIFHDVLINKEIYAIN 155
           + GS NA+T+ + T+++FE+       +L  D+  G  +     P+F+    +KEI A+N
Sbjct: 144 HGGSSNAYTASQNTNYFFEINHQHLFGAL--DRFAGFFSC----PLFNKDSTDKEINAVN 197

Query: 156 SEHVGNKSSLTKMMYHAVRLLASPEHPFHQFGTGNIFTLTNMPKLHKLSLKNELVKYFRE 215
           SE+  N  +    +Y   + L +P HP+H+F TGNI TL  +PK +  ++++EL+++   
Sbjct: 198 SENKKNLQNDIWRIYQLDKSLTNPNHPYHKFSTGNIETLGTLPKENGQNVRDELLQFHNN 257

Query: 216 HFFAENMVLCLRGPQSLNQLSKIAQARFSDIPSIPTLQVPRLLRWRSSSSFDKNRNLSVR 275
            + A  M LC+ G + L+ LS      F DI S    +VP        S + + + + V 
Sbjct: 258 FYSANLMKLCILGREDLDTLSDWTYNLFKDI-SNNDREVPHYAEPIMQSEYLQ-KIIQVH 315

Query: 276 PLESFQILKDAWSARYAKKPVFDKTPMHNSIMVQSSKSPVIRFVFPINYFSTRFTDRELA 335
           P++  + L+ +++      P  D+           SK P                     
Sbjct: 316 PVKDLKKLEISFTV-----PDMDEK--------WESKPP--------------------- 341

Query: 336 TYTQIWCELLGDECEGSLCHYLRSHSYITELIAYSSNFAVNDTGLILQLHLTNHGWLNVQ 395
              +I   L+G E  GSL  +L++  +  EL A     +  +    + + LT++G  + +
Sbjct: 342 ---RILSHLIGHEGSGSLLAHLKNVGWANELSAGGHTVSKGNAFFAVDIDLTDNGLTHYR 398

Query: 396 KIIPIVWKYL 405
            +I +V++Y+
Sbjct: 399 DVIVLVFQYI 408

 Score = 37.0 bits (84), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 71/335 (21%), Positives = 132/335 (39%), Gaps = 21/335 (6%)

Query: 612 PRLAGKNSYYELWLKEEDVDLSFRSKSIFSMELISTSLEPAPEYTMHLEILGQLLYSILG 671
           P L   +    LW K++D     R     S +L  T           L I  Q++   L 
Sbjct: 558 PMLLLSDGVSRLWYKKDDRFWQPRGYIYLSFKLPHTHASIINSMLSTLYI--QMVNDALK 615

Query: 672 PILYPAERAGYTYELSLSSKGDVRLGLTISGFTDGILNLLKIIVDAIVNLSQDLN--SIP 729
            + Y A+ AG     + +++G   L +T SG+ + ++ LL   +  +++     N   I 
Sbjct: 616 DLQYDADCAGLRISFNKTNQG---LDITASGYNEKLIILLTRFLQGVISFEPKKNRFEIL 672

Query: 730 KDIFRKARILVRTKYKEASSESCVTLASLGLLILLENCMWPLEDRLEALEDIYVESFRIF 789
           KD  +  R L    Y+   S+      SL     +    W   ++L+  E +  E    F
Sbjct: 673 KD--KTIRHLKNLLYEVPYSQMSNYYNSL-----INERSWSTAEKLQVFEKLSYEQLINF 725

Query: 790 LEKFINGDNYLNILIQGS-DMTIADNINEYLSERLTHHISRADDNVCRLSEPATYVIPEG 848
           +     G  +   LI G+     A  ++  +   +T +I+    +  RL    +Y++P+G
Sbjct: 726 IPTIYEG-AFFETLIHGNIKREEAMEVDSLIKSMITVNINNLQVSNNRLR---SYLLPKG 781

Query: 849 SNLFFKRVGFHDDPN-NSIVYFIQTGERDNNYIYTLTVLTEFIMSQTLVPDLRQKKQIGY 907
            + F       D  N NS +  +   +  +  +  L+ L   ++ +     LR K+Q+GY
Sbjct: 782 KS-FRYETALKDSLNVNSCIQHVTQLDVYSEELSALSGLFTQLIHEPCFDTLRTKEQLGY 840

Query: 908 IVLGGLRVLSDTVGLHITTMAGSPPEFLEEKINEY 942
           +V         T  + I   +     +LE +I  +
Sbjct: 841 VVFSSSLNNHGTANIRILIQSEHTTPYLEWRITNF 875

>KAFR0A05970 Chr1 (1206007..1209042) [3036 bp, 1011 aa] {ON}
           Anc_4.246 YLR389C
          Length = 1011

 Score =  144 bits (362), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 103/372 (27%), Positives = 180/372 (48%), Gaps = 50/372 (13%)

Query: 36  TFLISDPSETVASCAVSIATGSHNDPVEIPGLAHFCEHMVLSSGSKRHPEPNAFHETLSK 95
             +I DP+   A+ A+ +  G+  DP  +PGLAHFCEH++   GS++ P+ N +   LSK
Sbjct: 75  ALVIQDPTADKAAAALDVNIGAFEDPEHLPGLAHFCEHLLFM-GSEKFPDENEYSSFLSK 133

Query: 96  NNGSQNAHTSGEQTSFYFELPSSQSSDSLVFDQVVGILADALKEPIFHDVLINKEIYAIN 155
           + GS NA+TS   T++YFE+      ++L  D+  G        P+F+    +KEI A++
Sbjct: 134 HGGSSNAYTSSLNTNYYFEVNHEHLYNAL--DRFSGFFTC----PLFNKGSTDKEISAVD 187

Query: 156 SEHVGNKSSLTKMMYHAVRLLASPEHPFHQFGTGNIFTLTNMPKLHKLSLKNELVKYFRE 215
           SE+  N  +    +Y   + L++ +HP+H+F TGN+ TL   PK   L++++EL+K++  
Sbjct: 188 SENKKNLQNDVWRIYQLDKSLSNLQHPYHKFSTGNLITLGENPKSLNLNIRDELLKFYYH 247

Query: 216 HFFAENMVLCLRGPQSLNQLSKIAQARFSDIPSIPTLQVPRLLRWRSSSSFDKNRNLSVR 275
            + A  M LC+ G + L+ LS  A   F D+                     +N N ++ 
Sbjct: 248 SYSANLMKLCIIGREDLDTLSNWAYKLFKDV---------------------RNTNRAL- 285

Query: 276 PLESFQILKDAWSARYAK-KPVFDKTPMHNSIMVQSSKSPVIRFVFPINYFSTRFTDREL 334
           P  S +IL +    +  + KPV +   +  S MV                      DR  
Sbjct: 286 PEYSSKILNETHLQKIIQVKPVKELRKLEISFMVPD-------------------MDRHW 326

Query: 335 ATY-TQIWCELLGDECEGSLCHYLRSHSYITELIAYSSNFAVNDTGLILQLHLTNHGWLN 393
            +    +   L+G E  GSL  YL++  +  EL A     + ++    + + LT  G  +
Sbjct: 327 QSKPPHLLSHLIGHEGSGSLLAYLKAKGWANELSAGGHTVSKDNAFFSIDVELTKDGLES 386

Query: 394 VQKIIPIVWKYL 405
            ++++  +++Y+
Sbjct: 387 YKEVVHSIFQYI 398

 Score = 49.7 bits (117), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 80/350 (22%), Positives = 141/350 (40%), Gaps = 31/350 (8%)

Query: 612 PRLAGKNSYYELWLKEEDVDLSFRSKSIFSMELISTSLEPAPEYTMHLEILGQLLYSILG 671
           P L       +LW K++D     R     S++L  T    +   +M   I  QL    L 
Sbjct: 548 PLLLKDTKLSKLWFKKDDRFWQPRGYIYVSLKLPHT--HASVLNSMLSTIYVQLANDFLK 605

Query: 672 PILYPAERAGYTYELSLSSKGDVRLGLTISGFTDGILNLLKIIVDAIVNL--SQDLNSIP 729
            + Y A  A        +++G   L +T+SGF D ++ L+   +  + +   +++   I 
Sbjct: 606 DLQYDASCANLNLSFVKTNQG---LDITLSGFNDKLVTLMTRFLQGVKDFKPTEERFKIF 662

Query: 730 KDIFRKARILVRTKYKEASSESCVTLASLGLLILLENCMWPLEDRLEALEDIYVESFRIF 789
           KD  +  + L    Y+   S+      SL     +    W +E++L  +E I  E    F
Sbjct: 663 KD--KTTQHLKNLLYEVPYSQISGVYNSL-----INERSWSVEEKLNVVEHITFEQLLAF 715

Query: 790 LEKFINGDNYLNILIQGS-----DMTIADNINEYLSERLTHHISRADDNVCRLSEPATYV 844
           +      + Y   L+ G+      + I   IN+ L     H+  +  +N  R     +Y 
Sbjct: 716 IPTVFE-ELYYETLVHGNLKFEEAIEIESLINDILITNENHNNLQVKNNRLR-----SYF 769

Query: 845 IPEGSNLFFKRVGFHDDPN-NSIVYFIQTGERDNNYIYTLTVLTEFIMSQTLVPDLRQKK 903
           IP+G    F++    D  N NS +  +   +  N  +  L+ L   ++ +     LR K+
Sbjct: 770 IPKGKTYRFEK-ELKDSKNVNSCIQHVTQLDVYNEELSALSGLFAQMIHEPCFDTLRTKE 828

Query: 904 QIGYIVLGGLRVLSDTVGLHITTMAGSPPEFLEEKINEYL----AYLEDM 949
           Q+GY+V         T  + I   +     +LE +I E+     A L+DM
Sbjct: 829 QLGYVVFSSSLNNHGTANIRILVQSEHTTPYLEWRIEEFYSKFGAILKDM 878

>NDAI0J02240 Chr10 complement(547488..550487) [3000 bp, 999 aa] {ON}
           Anc_4.246
          Length = 999

 Score =  142 bits (358), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 101/370 (27%), Positives = 181/370 (48%), Gaps = 46/370 (12%)

Query: 36  TFLISDPSETVASCAVSIATGSHNDPVEIPGLAHFCEHMVLSSGSKRHPEPNAFHETLSK 95
             LISDP+   A+ ++ +  G+  DP  +PGLAHFCEH++   GS++ P+ N +   LSK
Sbjct: 63  ALLISDPTTDKAAASLDVNIGAFEDPESLPGLAHFCEHLLFM-GSEKFPDENDYSSFLSK 121

Query: 96  NNGSQNAHTSGEQTSFYFELPSSQSSDSLVFDQVVGILADALKEPIFHDVLINKEIYAIN 155
           + G  NA+T  + T+++FE+       +L  D+  G  +     P+F+    +KEI A++
Sbjct: 122 HGGHSNAYTGSQNTNYFFEINYEHLKGAL--DRFSGFFSC----PLFNIGSTDKEINAVD 175

Query: 156 SEHVGNKSSLTKMMYHAVRLLASPEHPFHQFGTGNIFTLTNMPKLHKLSLKNELVKYFRE 215
           SE+  N  S    +Y   + L+  +HP+H+F TGN+ TL  +P+   +++++EL+K++  
Sbjct: 176 SENKKNLQSDMWRIYQLDKSLSLLDHPYHKFSTGNLETLKIIPESKNVNVRDELLKFYNA 235

Query: 216 HFFAENMVLCLRGPQSLNQLSKIAQARFSDIPSIPTLQVPRLLRWRSSSSFDKNRNLSVR 275
           ++ A  M LC+ G + L+ LS   Q+ F D+ +I                 DK       
Sbjct: 236 NYSANLMKLCIIGREDLDTLSDYVQSFFKDVKNI-----------------DKE-----L 273

Query: 276 PLESFQILKDAWSARYAKKPVFDKTPMHNSIMVQSSKSPVIRFVFPINYFSTRFTDRELA 335
           P    +IL D    +     +    P      V+  +   + FV P   + T +  +   
Sbjct: 274 PFYDSKILNDDQLTK-----IVSVEP------VKELRKLEVSFVVPD--YETHWESK--- 317

Query: 336 TYTQIWCELLGDECEGSLCHYLRSHSYITELIAYSSNFAVNDTGLILQLHLTNHGWLNVQ 395
               I   L+G E  GSL  +L++  +  EL A     +  +    + + LT +G  N +
Sbjct: 318 -IPHILSHLIGHEGNGSLLSHLKTLGWANELSAGGHTVSRGNAFFSIDIDLTENGLKNYE 376

Query: 396 KIIPIVWKYL 405
           ++I + ++Y+
Sbjct: 377 QVILLAFQYI 386

>TBLA0I02940 Chr9 complement(699857..702754) [2898 bp, 965 aa] {ON}
           Anc_4.246 YLR389C
          Length = 965

 Score =  142 bits (358), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 103/371 (27%), Positives = 176/371 (47%), Gaps = 52/371 (14%)

Query: 38  LISDPSETVASCAVSIATGSHNDPVEIPGLAHFCEHMVLSSGSKRHPEPNAFHETLSKNN 97
           LI D +   A+ ++ +  G+  DP  +PGLAHFCEH++   GS+++P+ N +   LS N 
Sbjct: 35  LIQDATTDKAAASLDVNIGAFEDPEGLPGLAHFCEHLLFM-GSEKYPDENEYSSFLSTNG 93

Query: 98  GSQNAHTSGEQTSFYFELPSSQSSDSLVFDQVVGILADALKEPIFHDVLINKEIYAINSE 157
           GS NA+T    T+++FE+       +L  D+  G  +     P+F     +KEI A++SE
Sbjct: 94  GSYNAYTGALNTNYFFEINYEHLEGAL--DRFSGFFS----RPLFSKDSTDKEINAVDSE 147

Query: 158 HVGNKSSLTKMMYHAVRLLASPEHPFHQFGTGNIFTLTNMPKLHKLSLKNELVKYFREHF 217
           +  N  S    MY   + L++ +HP+H+F TGNI TL  +P    L +++EL+K++   +
Sbjct: 148 NKKNLQSDVWRMYQLDKSLSNRKHPYHKFSTGNIQTLGTIPNEQGLDIRDELLKFYNNSY 207

Query: 218 FAENMVLCLRGPQSLNQLSKIAQARFSDIPSIPTLQVPRLLRWRSSSSFDKNRNLSVRPL 277
            A  M L + G + L+ L   A + F D+ ++                   NR L V   
Sbjct: 208 SANLMKLTILGREDLDILGDWAYSMFKDVKNL-------------------NRELPV--- 245

Query: 278 ESFQILKDAWSARYAKKPVFDKTPMH--NSIMVQSSKSPVIRFVFPINYFSTRFTDRELA 335
                        Y +K + ++  M   N   VQ  +   + F  P         D+E  
Sbjct: 246 -------------YEEKMLTEEYLMQIINIKPVQDMRKLELSFTVPD-------LDKEWE 285

Query: 336 TYT-QIWCELLGDECEGSLCHYLRSHSYITELIAYSSNFAVNDTGLILQLHLTNHGWLNV 394
           + T +I   LLG E  GSL  +L+   + TEL A     + ++    + + LT  G+ + 
Sbjct: 286 SKTPRILSHLLGHEGSGSLLAHLKCLGWATELAAGGHTISDDNAVFSVDIDLTEEGFNHY 345

Query: 395 QKIIPIVWKYL 405
           + +   +++Y+
Sbjct: 346 EDVTVAIFQYI 356

 Score = 51.2 bits (121), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 75/333 (22%), Positives = 144/333 (43%), Gaps = 31/333 (9%)

Query: 664 QLLYSILGPILYPAERAGYTYELSLSSKGDVRLGLTISGFTDGILNLLKIIVDAIVNLSQ 723
           QL+   L  + Y A  A      S + +G   L +T+SGF   IL LL+  +  I N   
Sbjct: 556 QLVNDQLKDLQYDASCASLDISFSKTGQG---LDITVSGFNHKILILLESFLKGIKNFK- 611

Query: 724 DLNSIPKDIFRKARILV-RTKYKEASSESCVTL----ASLGLLILLENCMWPLEDRLEAL 778
                      K+R L+ + KY +        +     S     ++++  W ++++L  +
Sbjct: 612 ---------LEKSRFLIFQEKYIQQLKNMLFQVPYGQVSHYYNYVIDDRAWSIKEKLSTM 662

Query: 779 EDIYVESFRIFLEKFINGDNYLNILIQGS-DMTIADNINEYLSERLTHHISRADDNVCRL 837
           + +  E    FL    N + Y   L+ G+ + + A  +N+ + + ++  I        RL
Sbjct: 663 QKLTFEDLENFLPTIFN-EVYFESLVHGNFEKSDAAEVNQLVEKYISGSIHNPQIRNDRL 721

Query: 838 SEPATYVIPEGSNLFFKRVGFHDDP---NNSIVYFIQTGERDNNYIYTLTVLTEFIMSQT 894
               +YV+ +G    ++     +DP   N+ I +  Q G   N+ +  L+ L   I+++ 
Sbjct: 722 R---SYVLQKGET--YRYETLLEDPENVNSCIQHVTQIGLY-NDRLAALSSLFAQIINEP 775

Query: 895 LVPDLRQKKQIGYIVLGGLRVLSDTVGLHITTMAGSPPEFLEEKINEYLAYLEDMVLAKL 954
               LR K+Q+GY+V         T  + I   +    E+LE +I+E+   ++  +L ++
Sbjct: 776 CFNILRTKEQLGYVVFSSSLNNYGTTNIRILVQSEHTTEYLEWRIDEFYKSVK-TILTQM 834

Query: 955 TAPQFKHDYVDELLSLLTSNSLGKLEKTSGPAN 987
            AP+   ++ D L   L        E++S  +N
Sbjct: 835 -APETFENHKDALCKTLLQKYKNMKEESSRYSN 866

>Suva_10.506 Chr10 complement(865239..868310) [3072 bp, 1023 aa]
           {ON} YLR389C (REAL)
          Length = 1023

 Score =  141 bits (356), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 99/371 (26%), Positives = 178/371 (47%), Gaps = 48/371 (12%)

Query: 36  TFLISDPSETVASCAVSIATGSHNDPVEIPGLAHFCEHMVLSSGSKRHPEPNAFHETLSK 95
             LI DP    A+ ++ +  G+  DP  +PGLAHFCEH++   GS++ P+ N +   LSK
Sbjct: 86  ALLIQDPKADKAAASLDVNVGAFEDPENLPGLAHFCEHLLFM-GSEKFPDENEYSSYLSK 144

Query: 96  NNGSQNAHTSGEQTSFYFELPSSQSSDSLVFDQVVGILADALKEPIFHDVLINKEIYAIN 155
           + GS NA+T+ + T+++FE+       +L  D+  G  +     P+F     +KEI A+N
Sbjct: 145 HGGSSNAYTASQNTNYFFEVNHQHLLGAL--DRFSGFFSC----PLFQKDSTDKEINAVN 198

Query: 156 SEHVGNKSSLTKMMYHAVRLLASPEHPFHQFGTGNIFTLTNMPKLHKLSLKNELVKYFRE 215
           SE+  N  +    +Y   + L + +HP+H+F TGNI TL   PK + L++++EL+K F +
Sbjct: 199 SENKKNLQNDIWRIYQLDKSLTNSKHPYHKFSTGNIETLGESPKENGLNIRDELLK-FHK 257

Query: 216 HFFAEN-MVLCLRGPQSLNQLSKIAQARFSDIPSIPTLQVPRLLRWRSSSSFDKNRNLSV 274
           HF++ N M LC+ G + L+ LS+     F D+                    + +R +  
Sbjct: 258 HFYSANIMKLCILGREDLDTLSEWTYDLFKDVS-------------------NNDREVPY 298

Query: 275 RPLESFQILKDAWSARYAKKPVFDKTPMHNSIMVQSSKSPVIRFVFPINYFSTRFTDREL 334
            P    Q                   P H   ++Q +    ++    I++      +   
Sbjct: 299 YPESIMQ-------------------PEHLQKIIQVNPVKDLK-KLEISFTVPDMEEHWK 338

Query: 335 ATYTQIWCELLGDECEGSLCHYLRSHSYITELIAYSSNFAVNDTGLILQLHLTNHGWLNV 394
           +   +I   L+G E  GSL  +L+   +  EL A     +  +    + + LT++G  + 
Sbjct: 339 SKPPRILSHLIGHEGSGSLLAHLKELGWANELSAGGHTVSKGNAFFAVDIDLTDNGLTHY 398

Query: 395 QKIIPIVWKYL 405
           + +I ++++Y+
Sbjct: 399 RDVIVLIFQYI 409

 Score = 37.0 bits (84), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 71/336 (21%), Positives = 133/336 (39%), Gaps = 25/336 (7%)

Query: 623 LWLKEEDVDLSFRSKSIFSMELISTSLEPAPEYTMHLEILGQLLYSILGPILYPAERAGY 682
           LW K++D     R     S +L  T           L I  Q++   L  + Y A  A  
Sbjct: 570 LWYKKDDRFWQPRGYIYLSFKLPHTHASVINSMLSTLYI--QMINDALKDLQYDAACADL 627

Query: 683 TYELSLSSKGDVRLGLTISGFTDGILNLLKIIVDAIVNL--SQDLNSIPKDIFRKARILV 740
                 +++G   L +T SGF + ++ LL   +  +V+    +D   I KD  +  R L 
Sbjct: 628 RISFVKTNQG---LDITASGFNEKLIVLLTRFLQGVVSFEPKKDRFEILKD--KTIRHLK 682

Query: 741 RTKYKEASSESCVTLASLGLLILLENCMWPLEDRLEALEDIYVESFRIFLEKFINGDNYL 800
              Y+   S+      SL     +    W   ++L+  E +  E    F+     G  + 
Sbjct: 683 NLLYEVPYSQMSNYYNSL-----INERSWSTAEKLQVFEKLTFEQLNSFIPTIYEG-VFF 736

Query: 801 NILIQGS-DMTIADNINEYLSERLTHHISRADDNVCRLSEPATYVIPEGSNLFFKRVGFH 859
             L+ G+     A  ++  +   + ++I     +  RL    +Y++P+G +  ++     
Sbjct: 737 ETLVHGNIKHEEAIEVDSLIKSLIANNIDNLQVSNNRLR---SYLLPKGKSFRYE-TDLK 792

Query: 860 DDPN-NSIVYFIQTGERDNNYIYTLTVLTEFIMSQTLVPDLRQKKQIGYIVLGGLRVLSD 918
           D  N NS +  +   +  +  +  L+ L   ++ +     LR K+Q+GY+V         
Sbjct: 793 DPKNVNSCIQHVTQLDVYSEELSALSGLFAQLIHEPCFDTLRTKEQLGYVVFSSSLNNHG 852

Query: 919 TVGLHITTMAGSPPEFLEEKINEYL----AYLEDMV 950
           T  + I   +     +LE +IN +      +L+DM 
Sbjct: 853 TANIRILIQSEHTTPYLEWRINNFYETFGQHLKDMT 888

>YLR389C Chr12 complement(899577..902660) [3084 bp, 1027 aa] {ON}
           STE23Metalloprotease involved, with homolog Axl1p, in
           N-terminal processing of pro-a-factor to the mature
           form; expressed in both haploids and diploids; member of
           the insulin-degrading enzyme family
          Length = 1027

 Score =  141 bits (355), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 100/374 (26%), Positives = 179/374 (47%), Gaps = 56/374 (14%)

Query: 37  FLISDPSETVASCAVSIATGSHNDPVEIPGLAHFCEHMVLSSGSKRHPEPNAFHETLSKN 96
            LI DP    A+ ++ +  G+  DP  +PGLAHFCEH++   GS++ P+ N +   LSK+
Sbjct: 86  LLIQDPKADKAAASLDVNIGAFEDPKNLPGLAHFCEHLLFM-GSEKFPDENEYSSYLSKH 144

Query: 97  NGSQNAHTSGEQTSFYFELPSSQSSDSLVFDQVVGILADALKEPIFHDVLINKEIYAINS 156
            GS NA+T+ + T+++FE+       +L  D+  G  +     P+F+    +KEI A+NS
Sbjct: 145 GGSSNAYTASQNTNYFFEVNHQHLFGAL--DRFSGFFSC----PLFNKDSTDKEINAVNS 198

Query: 157 EHVGNKSSLTKMMYHAVRLLASPEHPFHQFGTGNIFTLTNMPKLHKLSLKNELVKYFREH 216
           E+  N  +    +Y   + L + +HP+H+F TGNI TL  +PK + L++++EL+K+ +  
Sbjct: 199 ENKKNLQNDIWRIYQLDKSLTNTKHPYHKFSTGNIETLGTLPKENGLNVRDELLKFHKNF 258

Query: 217 FFAENMVLCLRGPQSLNQLSKIAQARFSDIPSIPTLQVPRLLRWRSSSSFDKNRNLSVRP 276
           + A  M LC+ G + L+ LS      F D+ +                      N    P
Sbjct: 259 YSANLMKLCILGREDLDTLSDWTYDLFKDVAN----------------------NGREVP 296

Query: 277 LESFQILKDAWSARYAKKPVFDKTPMHNSIMVQSSKSPVIRFVFPINYFSTRFTDRELAT 336
           L +  I++                P H   ++Q      +R V  +      FT  ++  
Sbjct: 297 LYAEPIMQ----------------PEHLQKIIQ------VRPVKDLKKLEISFTVPDMEE 334

Query: 337 Y-----TQIWCELLGDECEGSLCHYLRSHSYITELIAYSSNFAVNDTGLILQLHLTNHGW 391
           +      +I   L+G E  GSL  +L+   +  EL A     +  +    + + LT++G 
Sbjct: 335 HWESKPPRILSHLIGHEGSGSLLAHLKKLGWANELSAGGHTVSKGNAFFAVDIDLTDNGL 394

Query: 392 LNVQKIIPIVWKYL 405
            + + +I ++++Y+
Sbjct: 395 THYRDVIVLIFQYI 408

 Score = 34.7 bits (78), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 69/330 (20%), Positives = 129/330 (39%), Gaps = 31/330 (9%)

Query: 622 ELWLKEEDVDLSFRSKSIFSMELISTSLEPAPEYTMHLEILGQLLYSILGPILYPAERAG 681
           +LW K++D     R     S +L  T    +   +M   +  QL    L  + Y A  A 
Sbjct: 568 KLWYKKDDRFWQPRGYIYLSFKLPHT--HASIINSMLSTLYTQLANDALKDVQYDAACAD 625

Query: 682 YTYELSLSSKGDVRLGLTISGFTDGILNLLKIIVDAIVNL--SQDLNSIPKD--IFRKAR 737
                + +++G   L +T SGF + ++ LL   +  + +    +D   I KD  I     
Sbjct: 626 LRISFNKTNQG---LAITASGFNEKLIILLTRFLQGVNSFEPKKDRFEILKDKTIRHLKN 682

Query: 738 ILVRTKYKEASSESCVTLASLGLLILLENCMWPLEDRLEALEDIYVESFRIFLEKFINGD 797
           +L    Y + S+             ++    W   ++L+  E +  E    F+     G 
Sbjct: 683 LLYEVPYSQMSNYYNA---------IINERSWSTAEKLQVFEKLTFEQLINFIPTIYEGV 733

Query: 798 NYLNILIQGS----DMTIADNINEYLSERLTHHISRADDNVCRLSEPATYVIPEGSNLFF 853
            Y   LI G+    +    D++ + L     H++ +  +N  R     +Y++P+G   F 
Sbjct: 734 -YFETLIHGNIKHEEALEVDSLIKSLIPNNIHNL-QVSNNRLR-----SYLLPKGKT-FR 785

Query: 854 KRVGFHDDPN-NSIVYFIQTGERDNNYIYTLTVLTEFIMSQTLVPDLRQKKQIGYIVLGG 912
                 D  N NS +  +   +  +  +  L+ L   ++ +     LR K+Q+GY+V   
Sbjct: 786 YETALKDSQNVNSCIQHVTQLDVYSEDLSALSGLFAQLIHEPCFDTLRTKEQLGYVVFSS 845

Query: 913 LRVLSDTVGLHITTMAGSPPEFLEEKINEY 942
                 T  + I   +     +LE +IN +
Sbjct: 846 SLNNHGTANIRILIQSEHTTPYLEWRINNF 875

>ZYRO0B12320g Chr2 complement(996046..999030) [2985 bp, 994 aa] {ON}
           similar to uniprot|Q06010 Saccharomyces cerevisiae
           YLR389C STE23 Metalloprotease involved with homolog
           Axl1p in N-terminal processing of pro-a-factor to the
           mature form member of the insulin-degrading enzyme
           family
          Length = 994

 Score =  140 bits (353), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 102/364 (28%), Positives = 173/364 (47%), Gaps = 48/364 (13%)

Query: 51  VSIATGSHNDPVEIPGLAHFCEHMVLSSGSKRHPEPNAFHETLSKNNGSQNAHTSGEQTS 110
           + +  G+  DP  +PGLAHFCEH++   GS+++P+ N +   LSK+ G+ NA+T  + T+
Sbjct: 75  LDVNVGAFEDPEGLPGLAHFCEHLLFM-GSEKYPDENEYSSYLSKHGGASNAYTGSQNTN 133

Query: 111 FYFELPSSQSSDSLVFDQVVGILADALKEPIFHDVLINKEIYAINSEHVGNKSSLTKMMY 170
           +YFE+       +L  D+  G        P+F+    +KEI A++SE+  N  S    +Y
Sbjct: 134 YYFEVNHEHLFGAL--DRFAGFFTC----PLFNRDSTDKEIKAVDSENKKNLQSDLWRLY 187

Query: 171 HAVRLLASPEHPFHQFGTGNIFTLTNMPKLHKLSLKNELVKYFREHFFAENMVLCLRGPQ 230
              + L + EHP+H+F TGN  TL  +P  + + ++ EL+K++++ + A  M LC+ G +
Sbjct: 188 QLDKSLTNEEHPYHKFSTGNFITLHEIPTSNGIDVREELLKFYKKSYSANLMKLCVLGRE 247

Query: 231 SLNQLSKIAQARFSDIPSIPTLQVPRLLRWRSSSSFDKNRNLSVRPLESFQILKDAWSAR 290
            L+ LS  A + F D+P+I                         RP+             
Sbjct: 248 DLDTLSNWACSLFQDVPNI------------------------ARPV-----------PE 272

Query: 291 YAKKPVFDKTPMHNSIMVQSSKSPVIRFVFPINYFSTRFTDRELATYTQ-IWCELLGDEC 349
           Y  K + D+  +   I  +S K      V     FS    D E  +  Q I   L+G E 
Sbjct: 273 YGSK-MLDERSLQKVIHAKSVKDLKKLEV----TFSAPDMDLEWESKPQHILSHLVGHEG 327

Query: 350 EGSLCHYLRSHSYITELIAYSSNFAVNDTGLILQLHLTNHGWLNVQKIIPIVWKYLIPAI 409
            GSL  +L+   +  EL A   + +  +    + + LT+ G  + + +  I+++YL    
Sbjct: 328 SGSLLAHLKDKGWANELSAGGHSVSKENAFFSIDIDLTDLGLKHYEDVTHIIFQYLEMLK 387

Query: 410 LDAP 413
           L+ P
Sbjct: 388 LNLP 391

 Score = 35.4 bits (80), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 70/357 (19%), Positives = 138/357 (38%), Gaps = 47/357 (13%)

Query: 612 PRLAGKNSYYELWLKEEDVDLSFRSKSIFSMELISTSLEPAPEYTMHLEILGQLLYSILG 671
           P L   +   +LW K++D     R     S +L  T  + +   +M   +  QL+   + 
Sbjct: 533 PLLLKDDKISKLWYKKDDRFWQPRGYIYISFKLPHT--QASIVNSMLSTLYVQLINDYIK 590

Query: 672 PILYPAERAGYTYELSLSSKGDVRLGLTISGFTDGILNLLKIIVDAIVNLSQDLNSIPKD 731
            + Y A  A      S +++G   L +T+ GF D +  LL   ++ + +   + N     
Sbjct: 591 DLQYDAACADLHLSFSKTNQG---LDITVVGFNDKLTILLTRFLEGLKSFKPEKNRF--Q 645

Query: 732 IFRK--ARILVRTKYKEASSESCVTLASLGLLILLENCMWPLEDRLEALEDIYVESF--- 786
           IF+    R L    Y+    +     +SL     +    W ++++LE L+ +  E     
Sbjct: 646 IFKDKCTRQLTNQLYEVPYLQVFPVYSSL-----INERTWSVKEKLEVLKRLTFEQLVTY 700

Query: 787 ------RIFLEKFINGDNYLNILIQGS---DMTIADNINEYLSERLTHHISRADDNVCRL 837
                  +F E F++G+      I+      M + ++I  + ++                
Sbjct: 701 LPTIYEEMFFEAFVHGNMKYEEAIEVDSLVQMLVPNDIRNFQTKN--------------- 745

Query: 838 SEPATYVIPEGSNLFFK-RVGFHDDPNNSIVYFIQTGERDNNYIYTLTVLTEFIMSQTLV 896
            +  +Y +P+G    ++ ++    + N+ I +  Q G          ++  + I  +   
Sbjct: 746 GKLRSYFLPQGETYRYETKLQDSQNLNSCIQHVTQLGVYSEEISAKASLFAQMI-HEPCF 804

Query: 897 PDLRQKKQIGYIVLGGLRVLSDTVGLHITTMAGSPPEFLEEKINEYL----AYLEDM 949
             LR K+Q+GY+V         T  + I   +     FLE +I  +L      L+DM
Sbjct: 805 DTLRTKEQLGYVVFSSSLNNHGTANIRILVQSEHTTPFLEWRIESFLQGFGKILQDM 861

>AER053C Chr5 complement(735402..738443) [3042 bp, 1013 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR389C
           (STE23)
          Length = 1013

 Score =  139 bits (350), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 100/374 (26%), Positives = 187/374 (50%), Gaps = 56/374 (14%)

Query: 37  FLISDPSETVASCAVSIATGSHNDPVEIPGLAHFCEHMVLSSGSKRHPEPNAFHETLSKN 96
            L+ D +   ++ ++ +  G+  DP ++PGLAHFCEH++   GSK+ P  N +   LSK+
Sbjct: 81  LLVHDKNTDKSAASLDVNVGAFEDPEDLPGLAHFCEHLLFM-GSKKFPNENEYASFLSKH 139

Query: 97  NGSQNAHTSGEQTSFYFELPSSQSSDSLVFDQVVGILADALKEPIFHDVLINKEIYAINS 156
            G+ NA+T+ + T++YF +      D+L  D+  G  +     P+F++    KEI A++S
Sbjct: 140 GGASNAYTASQNTNYYFHVNHENLYDAL--DRFSGFFSC----PLFNESSTEKEIKAVDS 193

Query: 157 EHVGNKSSLTKMMYHAVRLLASPEHPFHQFGTGNIFTLTNMPKLHKLSLKNELVKYFREH 216
           E+  N  +    +Y   + L +P HP+H+F TGN  TL ++P+   +++++EL+K++   
Sbjct: 194 ENKKNLQNDMWRLYQLGKSLTNPIHPYHKFSTGNFETLWSIPRSKGVNVRDELLKFYNRS 253

Query: 217 FFAENMVLCLRGPQSLNQLSKIAQARFSDIPSIPTLQVPRLLRWRSSSSFDKNRNLSVRP 276
           + A  M L + G + L+ L++ A   F D+P+  T +VP       + +F         P
Sbjct: 254 YSANLMKLVILGREDLDTLAQWAYELFKDVPNHGT-KVPEY----HAQAFT--------P 300

Query: 277 LESFQILKDAWSARYAKKPVFDKTPMHNSIMVQSSKSPVIRFVFPINYFSTRFTDRELAT 336
               +++K         KP            V++ KS  I FV P           ++  
Sbjct: 301 EHLMKVIK--------VKP------------VKNLKSVEISFVVP-----------DMDK 329

Query: 337 YTQI-----WCELLGDECEGSLCHYLRSHSYITELIAYSSNFAVNDTGLILQLHLTNHGW 391
           + Q+        L+G E   SL  YL+++S+  +L A ++  +  +    + + LT+ G 
Sbjct: 330 HWQVKPARYLSHLIGHEGTDSLLAYLKNNSWAIDLSAGATTVSEGNAYFSVNVDLTDEGV 389

Query: 392 LNVQKIIPIVWKYL 405
           +  + +I  V++Y+
Sbjct: 390 VQYEAVICAVFQYI 403

 Score = 42.7 bits (99), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 73/334 (21%), Positives = 136/334 (40%), Gaps = 43/334 (12%)

Query: 622 ELWLKEEDVDLSFRSKSIFSMELISTSLEPAPEYTMHLEILGQLLYSI--------LGPI 673
           +LW K++D+    +     SM+L  T          H  I+  +L ++        L  +
Sbjct: 564 KLWYKKDDMFWVPKGYIYISMKLPHT----------HSSIVNSMLCTLYVDHINDSLKDL 613

Query: 674 LYPAERAGYTYELSLSSKGDVRLGLTISGFTDGILNLLKIIVDAIVNLSQDLNSIPKDIF 733
            Y AE AG    L  +++G   L L++SG+ D +L LL    + I  L            
Sbjct: 614 AYNAECAGLEISLRKTNQG---LDLSLSGYNDKLLVLLARFFEGIQKL----------FL 660

Query: 734 RKARILV---RTKYKEASSESCVTLASLGLLI--LLENCMWPLEDRLEALEDIYVESFRI 788
           R+ R +V   R   K  +         +G L   L+    W  +++L+  E +  +    
Sbjct: 661 REERFMVLKQRLIQKLHNHLYDTPYTQIGRLYSSLINERSWTTQEKLDITEQLTFDHLAN 720

Query: 789 FLEKFINGDNYLNILIQGS-DMTIADNINEYLSERLTHHISRADDNVCRLSEPATYVIPE 847
           F+   I    Y  +L+ G+     A  + + +S  + + I  ++    R S+  +Y IP 
Sbjct: 721 FVPT-IYEQMYFELLVHGNFSHEEALEVYDLVSSLVPNEIRNSEG---RNSKLRSYFIPA 776

Query: 848 GSNLFFKR-VGFHDDPNNSIVYFIQTGERDNNYIYTLTVLTEFIMSQTLVPDLRQKKQIG 906
           G    ++  +   ++ N+ I   IQ G          ++L + + ++     LR ++Q+G
Sbjct: 777 GGAYHYETALADKENVNSCIQKVIQLGAYSELLSAKGSLLAQMV-NEPCFNTLRTEEQLG 835

Query: 907 YIVLGGLRVLSDTVGLHITTMAGSPPEFLEEKIN 940
           Y+V         TV L I   +     +LE +I+
Sbjct: 836 YVVFSSKLNTHGTVNLRILVQSERSSSYLESRID 869

>Skud_12.230 Chr12 complement(438565..439953) [1389 bp, 462 aa] {ON}
           YLR163C (REAL)
          Length = 462

 Score = 50.8 bits (120), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 53/209 (25%), Positives = 89/209 (42%), Gaps = 21/209 (10%)

Query: 42  PSETVASCAVSIATGSHNDPVEIPGLAHFCEHMVLSSGSKRHPEPNAFHETLSKNNGSQ- 100
           P+ + A+  + +  GS  + V+  G AHF EH+       R  +     E   +N GS  
Sbjct: 43  PNTSSATVGIFVDAGSRAENVKNNGTAHFLEHLAFKGTQNRSQQ---GIELEIENIGSHL 99

Query: 101 NAHTSGEQTSFYFELPSSQSSDSLVFD--QVVGILADALKEPIFHDVLINKEIYAINSEH 158
           NA+TS E T +Y        + SL  D  + VGIL+D L + +  +  I +E   I  E 
Sbjct: 100 NAYTSRENTVYY--------AKSLQEDIPKAVGILSDILTKSVLDNNAIERERDVIIRES 151

Query: 159 VGNKSSLTKMMYHAVRLLASPEHPFHQFGTGNIFTLTNMPKLHKLSLKNELVKYFREHFF 218
                   ++++  +  +   + P  +   G I    N+  + +  LKN    Y   ++ 
Sbjct: 152 EEVDKMYDEVVFDHLHEITYKDQPLGRTILGPI---KNIKSITRSDLKN----YITRNYK 204

Query: 219 AENMVLCLRGPQSLNQLSKIAQARFSDIP 247
            + MVL   G     +L + AQ  F  +P
Sbjct: 205 GDRMVLAGAGAVDHEELVEYAQKYFGHVP 233

>TPHA0C02450 Chr3 (545815..547224) [1410 bp, 469 aa] {ON} Anc_8.376
           YLR163C
          Length = 469

 Score = 49.3 bits (116), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 50/207 (24%), Positives = 86/207 (41%), Gaps = 17/207 (8%)

Query: 42  PSETVASCAVSIATGSHNDPVEIPGLAHFCEHMVLSSGSKRHPEPNAFHETLSKNNGSQ- 100
           P+ + A+  + +  GS  + V+  G AHF EH+     SKR  +     E   +N GS  
Sbjct: 44  PNTSTATVGIYVNAGSRAENVKNNGTAHFLEHLAFKGTSKRSQKQ---IELDIENIGSHL 100

Query: 101 NAHTSGEQTSFYFELPSSQSSDSLVFDQVVGILADALKEPIFHDVLINKEIYAINSEHVG 160
           NA+TS E T +Y +               V IL+D L         I +E   I  E   
Sbjct: 101 NAYTSRENTVYYAKTLKEN------LPLAVDILSDILTNSKLEKNAIERERDVIVRESEE 154

Query: 161 NKSSLTKMMYHAVRLLASPEHPFHQFGTGNIFTLTNMPKLHKLSLKNELVKYFREHFFAE 220
                 ++++  +  +A  + P  +   G I  + ++        +++LV Y   ++  +
Sbjct: 155 VDKMYDEVVFDHLHEIAYKDQPLGRTILGPIKNIKSIN-------RSDLVHYITSNYKGD 207

Query: 221 NMVLCLRGPQSLNQLSKIAQARFSDIP 247
            MVL   G  +   L K+A+  F  +P
Sbjct: 208 RMVLAGAGDINHQDLIKLAEKYFGHLP 234

>Kpol_1024.23 s1024 (68467..69831) [1365 bp, 454 aa] {OFF}
           (68467..69831) [1365 nt, 455 aa]
          Length = 454

 Score = 48.9 bits (115), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 57/228 (25%), Positives = 91/228 (39%), Gaps = 22/228 (9%)

Query: 42  PSETVASCAVSIATGSHNDPVEIPGLAHFCEHMVLSSGSKRHPEPNAFHETLSKNNGSQ- 100
           P+   A+  + +  GS  +  +  G AHF EH+      KR  +     E   +N GS  
Sbjct: 28  PNTPTATVGIYVDAGSRAENTKNNGTAHFLEHLAFKGTEKRSQKK---IELDIENIGSHL 84

Query: 101 NAHTSGEQTSFYFELPSSQSSDSLVFDQVVGILADALKEPIFHDVLINKEIYAINSEHVG 160
           NA+TS E T +Y +             Q + IL+D L +       I +E   I  E   
Sbjct: 85  NAYTSRENTVYYAKTLKEN------VPQAIDILSDILTKSTLDKSAIERERDVIIRE--- 135

Query: 161 NKSSLTKMMYHAVRL--LASPEHPFHQFGTGNIFTLTNMPKLHKLSLKNELVKYFREHFF 218
             S     MY  V    L    +     G   +  + N+  + +  LKN    Y  +++ 
Sbjct: 136 --SEEVDKMYDEVVFDHLHEIAYSDQSLGRTILGPIKNIKSITRDDLKN----YITQNYK 189

Query: 219 AENMVLCLRGPQSLNQLSKIAQARFSDIPSIPTLQVPRLLRWRSSSSF 266
            + MVL   G    N++ K A+  F  +PS     +   L+ RS+ +F
Sbjct: 190 GDRMVLASAGDIDHNEIVKYAEKYFGHLPSSHLQNIDTGLK-RSNENF 236

>Kpol_YGOB_1024.23 s1024 (68437..69831) [1395 bp, 464 aa] {ON}
           ANNOTATED BY YGOB -
          Length = 464

 Score = 48.9 bits (115), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 57/228 (25%), Positives = 91/228 (39%), Gaps = 22/228 (9%)

Query: 42  PSETVASCAVSIATGSHNDPVEIPGLAHFCEHMVLSSGSKRHPEPNAFHETLSKNNGSQ- 100
           P+   A+  + +  GS  +  +  G AHF EH+      KR  +     E   +N GS  
Sbjct: 38  PNTPTATVGIYVDAGSRAENTKNNGTAHFLEHLAFKGTEKRSQKK---IELDIENIGSHL 94

Query: 101 NAHTSGEQTSFYFELPSSQSSDSLVFDQVVGILADALKEPIFHDVLINKEIYAINSEHVG 160
           NA+TS E T +Y +             Q + IL+D L +       I +E   I  E   
Sbjct: 95  NAYTSRENTVYYAKTLKEN------VPQAIDILSDILTKSTLDKSAIERERDVIIRE--- 145

Query: 161 NKSSLTKMMYHAVRL--LASPEHPFHQFGTGNIFTLTNMPKLHKLSLKNELVKYFREHFF 218
             S     MY  V    L    +     G   +  + N+  + +  LKN    Y  +++ 
Sbjct: 146 --SEEVDKMYDEVVFDHLHEIAYSDQSLGRTILGPIKNIKSITRDDLKN----YITQNYK 199

Query: 219 AENMVLCLRGPQSLNQLSKIAQARFSDIPSIPTLQVPRLLRWRSSSSF 266
            + MVL   G    N++ K A+  F  +PS     +   L+ RS+ +F
Sbjct: 200 GDRMVLASAGDIDHNEIVKYAEKYFGHLPSSHLQNIDTGLK-RSNENF 246

>YLR163C Chr12 complement(491866..493254) [1389 bp, 462 aa] {ON}
           MAS1Smaller subunit of the mitochondrial processing
           protease (MPP), essential processing enzyme that cleaves
           the N-terminal targeting sequences from mitochondrially
           imported proteins
          Length = 462

 Score = 47.4 bits (111), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 51/209 (24%), Positives = 89/209 (42%), Gaps = 21/209 (10%)

Query: 42  PSETVASCAVSIATGSHNDPVEIPGLAHFCEHMVLSSGSKRHPEPNAFHETLSKNNGSQ- 100
           P+ + A+  + +  GS  + V+  G AHF EH+       R  +     E   +N GS  
Sbjct: 43  PNTSSATVGIFVDAGSRAENVKNNGTAHFLEHLAFKGTQNRSQQG---IELEIENIGSHL 99

Query: 101 NAHTSGEQTSFYFELPSSQSSDSLVFD--QVVGILADALKEPIFHDVLINKEIYAINSEH 158
           NA+TS E T +Y        + SL  D  + V IL+D L + +  +  I +E   I  E 
Sbjct: 100 NAYTSRENTVYY--------AKSLQEDIPKAVDILSDILTKSVLDNSAIERERDVIIRES 151

Query: 159 VGNKSSLTKMMYHAVRLLASPEHPFHQFGTGNIFTLTNMPKLHKLSLKNELVKYFREHFF 218
                   ++++  +  +   + P  +   G I    N+  + +  LK+    Y  +++ 
Sbjct: 152 EEVDKMYDEVVFDHLHEITYKDQPLGRTILGPI---KNIKSITRTDLKD----YITKNYK 204

Query: 219 AENMVLCLRGPQSLNQLSKIAQARFSDIP 247
            + MVL   G     +L + AQ  F  +P
Sbjct: 205 GDRMVLAGAGAVDHEKLVQYAQKYFGHVP 233

>Suva_10.260 Chr10 complement(463944..465332) [1389 bp, 462 aa] {ON}
           YLR163C (REAL)
          Length = 462

 Score = 45.8 bits (107), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 51/209 (24%), Positives = 88/209 (42%), Gaps = 21/209 (10%)

Query: 42  PSETVASCAVSIATGSHNDPVEIPGLAHFCEHMVLSSGSKRHPEPNAFHETLSKNNGSQ- 100
           P+ + A+  + +  GS  + ++  G AHF EH+       R  +     E   +N GS  
Sbjct: 43  PNTSSATVGIFVDAGSRAENIKNNGTAHFLEHLAFKGTQNRSQQ---GIELEIENIGSHL 99

Query: 101 NAHTSGEQTSFYFELPSSQSSDSLVFD--QVVGILADALKEPIFHDVLINKEIYAINSEH 158
           NA+TS E T +Y        + SL  D  + V IL+D L + +     I +E   I  E 
Sbjct: 100 NAYTSRENTVYY--------AKSLQEDIPKAVEILSDILTKSVLDSNAIERERDVIIRES 151

Query: 159 VGNKSSLTKMMYHAVRLLASPEHPFHQFGTGNIFTLTNMPKLHKLSLKNELVKYFREHFF 218
                   ++++  +  +   + P  +   G I    N+  + +  LKN    Y  +++ 
Sbjct: 152 EEVDKMYDEVVFDHLHEITYKDQPLGRTILGPI---KNIKSITRSDLKN----YITKNYK 204

Query: 219 AENMVLCLRGPQSLNQLSKIAQARFSDIP 247
            + MVL   G     +L + AQ  F  +P
Sbjct: 205 GDRMVLAGAGAVDHEKLVEHAQKYFGHVP 233

>CAGL0H02739g Chr8 (248511..249908) [1398 bp, 465 aa] {ON} highly
           similar to uniprot|P10507 Saccharomyces cerevisiae
           YLR163c MAS1
          Length = 465

 Score = 45.4 bits (106), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 52/209 (24%), Positives = 88/209 (42%), Gaps = 21/209 (10%)

Query: 42  PSETVASCAVSIATGSHNDPVEIPGLAHFCEHMVLSSGSKRHPEPNAFHETLSKNNGSQ- 100
           P+++ A+  + +  GS  +     G AHF EH+    G++   + +   E   +N GS  
Sbjct: 45  PNKSTATVGIFVDAGSRAENERNNGTAHFLEHLAF-KGTQNRSQTDIELEI--ENIGSHL 101

Query: 101 NAHTSGEQTSFYFELPSSQSSDSLVFD--QVVGILADALKEPIFHDVLINKEIYAINSEH 158
           NA+TS E T +Y        + SL  D  + V IL+D L   +     I +E   I  E 
Sbjct: 102 NAYTSRENTVYY--------AKSLEGDVPKAVNILSDILTRSVLDPKAIERERDVIIRES 153

Query: 159 VGNKSSLTKMMYHAVRLLASPEHPFHQFGTGNIFTLTNMPKLHKLSLKNELVKYFREHFF 218
                   ++++  +  +A  + P  +   G I    N+  + +  LK+    Y  E++ 
Sbjct: 154 EEVDKMYDEVVFDHLHEIAYKQQPLGRTILGPI---KNIKSISRKDLKS----YITENYK 206

Query: 219 AENMVLCLRGPQSLNQLSKIAQARFSDIP 247
            + MVL   G     +L   AQ     IP
Sbjct: 207 GDRMVLAAAGAVDHEKLVDYAQKYLGHIP 235

>NCAS0C02970 Chr3 (558478..559863) [1386 bp, 461 aa] {ON} Anc_8.376
          Length = 461

 Score = 45.1 bits (105), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 49/206 (23%), Positives = 89/206 (43%), Gaps = 21/206 (10%)

Query: 42  PSETVASCAVSIATGSHNDPVEIPGLAHFCEHMVLSSGSKRHPEPNAFHETLSKNNGSQ- 100
           P+ + A+  + +  GS  + V+  G AHF EH+       R  +     E   +N GS  
Sbjct: 42  PNTSSATVGIFVDAGSRAENVKNNGTAHFLEHLAFKGTQNRSQK---GIELEIENIGSHL 98

Query: 101 NAHTSGEQTSFYFELPSSQSSDSLVFD--QVVGILADALKEPIFHDVLINKEIYAINSEH 158
           NA+TS E T +Y        + SL  D  + V IL+D L + +     I +E   I  E 
Sbjct: 99  NAYTSRENTVYY--------AKSLKEDIPKAVDILSDILTKSVLDPRAIERERDVIIRES 150

Query: 159 VGNKSSLTKMMYHAVRLLASPEHPFHQFGTGNIFTLTNMPKLHKLSLKNELVKYFREHFF 218
                   ++++  +  +   + P  +   G I  + ++        +N+L +Y  +++ 
Sbjct: 151 EEVDKMHDEVVFDHLHAITYKDQPLGRTILGPIKNIKSI-------TRNDLREYITKNYK 203

Query: 219 AENMVLCLRGPQSLNQLSKIAQARFS 244
            + MVL   G  + ++L + AQ  F 
Sbjct: 204 GDRMVLAGAGAVNHDELVEYAQKYFG 229

>Smik_12.225 Chr12 complement(439006..440394) [1389 bp, 462 aa] {ON}
           YLR163C (REAL)
          Length = 462

 Score = 45.1 bits (105), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 48/209 (22%), Positives = 88/209 (42%), Gaps = 21/209 (10%)

Query: 42  PSETVASCAVSIATGSHNDPVEIPGLAHFCEHMVLSSGSKRHPEPNAFHETLSKNNGSQ- 100
           P+ + A+  + +  GS  + ++  G AHF EH+       R  +     E   +N GS  
Sbjct: 43  PNTSSATVGIFVDAGSRAENLKNNGTAHFLEHLAFKGTQNRSQQG---IELEIENIGSHL 99

Query: 101 NAHTSGEQTSFYFELPSSQSSDSLVFD--QVVGILADALKEPIFHDVLINKEIYAINSEH 158
           NA+TS E T +Y        + SL  D  + V IL+D L + +     I +E   I  E 
Sbjct: 100 NAYTSRENTVYY--------AKSLEEDIPKAVDILSDILTKSVLDSNAIERERDVIIRES 151

Query: 159 VGNKSSLTKMMYHAVRLLASPEHPFHQFGTGNIFTLTNMPKLHKLSLKNELVKYFREHFF 218
                   ++++  +  +   + P  +   G I  + ++        +++L  Y  +++ 
Sbjct: 152 EEVDKMYDEVVFDHLHEITYKDQPLGRTILGPIKNIKSI-------TRSDLKDYITKNYK 204

Query: 219 AENMVLCLRGPQSLNQLSKIAQARFSDIP 247
            + MVL   G     +L + AQ  F  +P
Sbjct: 205 GDRMVLAGAGAVDHERLVQYAQKYFGHVP 233

>KNAG0A02760 Chr1 (301136..302539) [1404 bp, 467 aa] {ON} Anc_8.376
           YLR163C
          Length = 467

 Score = 44.7 bits (104), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 59/223 (26%), Positives = 95/223 (42%), Gaps = 28/223 (12%)

Query: 42  PSETVASCAVSIATGSHNDPVEIPGLAHFCEHMVLSSGSKRHPEPNAFHETLSKNNGSQ- 100
           P+   A+  + +  GS  + V+  G AHF EH+    G+K   +     E   +N GS  
Sbjct: 46  PNTASATVGIFVDAGSRAENVKNNGTAHFLEHLAF-KGTKNRSQRGIELEI--ENIGSHL 102

Query: 101 NAHTSGEQTSFYFELPSSQSSDSLVFD--QVVGILADALKEPIFHDVLINKEIYAINSEH 158
           NA+TS E T +Y        + SL  D  + V IL+D L + +     I +E   I  E 
Sbjct: 103 NAYTSRENTVYY--------AKSLREDIPKAVDILSDILTKSVLDPKAIERERDVIIRES 154

Query: 159 VGNKSSLTKMMYHAVRLLASPEHPFHQFGTGNIFTLTNMPKLHKLSLKNELVKYFREHFF 218
                   ++++  +  +A  + P  +   G I    N+  + +  L+N    Y   ++ 
Sbjct: 155 EEVDKMYDEVVFDHLHEIAYRDQPLGRTILGPI---KNIKSIKRTDLQN----YIMTNYK 207

Query: 219 AENMVLCLRGPQSLNQLSKIAQARF-----SDIPSIPTLQVPR 256
            + MVL   G    + L   AQ  F     SD+ S+P L  PR
Sbjct: 208 GDRMVLASAGSVDHDNLVAYAQKYFGHLKRSDV-SVP-LGSPR 248

>SAKL0H14168g Chr8 (1211470..1212855) [1386 bp, 461 aa] {ON} highly
           similar to uniprot|P10507 Saccharomyces cerevisiae
           YLR163C MAS1 Smaller subunit of the mitochondrial
           processing protease essential processing enzyme that
           cleaves the N-terminal targeting sequences from
           mitochondrially imported proteins
          Length = 461

 Score = 42.7 bits (99), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 50/208 (24%), Positives = 83/208 (39%), Gaps = 21/208 (10%)

Query: 42  PSETVASCAVSIATGSHNDPVEIPGLAHFCEHMVLSSGSKRHPEPNAFHETLSKNNGSQ- 100
           P+ + A+  + +  GS  +  +  G AHF EH+       R        E   +N GS  
Sbjct: 42  PNTSTATVGIFVDAGSRAENAKNNGTAHFLEHLAFKGTQNR---TQTGIELEIENIGSHL 98

Query: 101 NAHTSGEQTSFYFELPSSQSSDSLVFD--QVVGILADALKEPIFHDVLINKEIYAINSEH 158
           NA+TS E T +Y        + SL  D  Q V IL+D L   +     I +E   I  E 
Sbjct: 99  NAYTSRENTVYY--------AKSLENDIPQAVDILSDILTRSVLDPRAIERERDVIIRES 150

Query: 159 VGNKSSLTKMMYHAVRLLASPEHPFHQFGTGNIFTLTNMPKLHKLSLKNELVKYFREHFF 218
                   ++++  +  +   + P  +   G I  +       K   +++L  Y  +++ 
Sbjct: 151 EEVDKMYDEVVFDHLHAIVYQDQPLGRTILGPIKNI-------KTIQRDDLQAYISKNYS 203

Query: 219 AENMVLCLRGPQSLNQLSKIAQARFSDI 246
            + MVL   G    ++L   AQ  F  I
Sbjct: 204 GDRMVLVGAGAVDHHKLVDYAQTYFGHI 231

>KLLA0D18095g Chr4 complement(1526808..1528217) [1410 bp, 469 aa]
           {ON} highly similar to uniprot|P10507 Saccharomyces
           cerevisiae YLR163C MAS1 Smaller subunit of the
           mitochondrial processing protease essential processing
           enzyme that cleaves the N-terminal targeting sequences
           from mitochondrially imported proteins
          Length = 469

 Score = 42.7 bits (99), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 48/208 (23%), Positives = 84/208 (40%), Gaps = 21/208 (10%)

Query: 42  PSETVASCAVSIATGSHNDPVEIPGLAHFCEHMVLSSGSKRHPEPNAFHETLSKNNGSQ- 100
           P+   A+  + + TGS  +  +  G AHF EH+       R        E   +N GS  
Sbjct: 50  PNTNTATVGIFVDTGSRAENEKNNGTAHFLEHLAFKGTQNRS---QTGIELEIENIGSHL 106

Query: 101 NAHTSGEQTSFYFELPSSQSSDSLVFD--QVVGILADALKEPIFHDVLINKEIYAINSEH 158
           NA+TS E T +Y        + SL  D  + V ILAD L   +     I +E   I  E 
Sbjct: 107 NAYTSRENTVYY--------AKSLKQDIPKAVDILADILTRSVLDPKAIERERDVIIRES 158

Query: 159 VGNKSSLTKMMYHAVRLLASPEHPFHQFGTGNIFTLTNMPKLHKLSLKNELVKYFREHFF 218
                   ++++  +  +     P  +   G I  + ++        +++L ++  +H+ 
Sbjct: 159 EEVDKMYDEVVFDHLHTITYKNQPLGRTILGPIKNIKSIQ-------RSDLQEFIEKHYT 211

Query: 219 AENMVLCLRGPQSLNQLSKIAQARFSDI 246
            + MVL   G    ++L + A   F  +
Sbjct: 212 GDRMVLVGTGAVDHDKLVEYAGKYFGHV 239

>NDAI0G02320 Chr7 (518661..520052) [1392 bp, 463 aa] {ON} Anc_8.376
           YLR163C
          Length = 463

 Score = 42.7 bits (99), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 49/206 (23%), Positives = 87/206 (42%), Gaps = 21/206 (10%)

Query: 42  PSETVASCAVSIATGSHNDPVEIPGLAHFCEHMVLSSGSKRHPEPNAFHETLSKNNGSQ- 100
           P+ + A+  + +  GS  +  +  G AHF EH+    G+K   +     E   +N GS  
Sbjct: 44  PNTSSATVGIFVDAGSRAENEKNNGTAHFLEHLAF-KGTKNRSQKGIELEI--ENIGSHL 100

Query: 101 NAHTSGEQTSFYFELPSSQSSDSLVFD--QVVGILADALKEPIFHDVLINKEIYAINSEH 158
           NA+TS E T +Y        + SL  D  + V IL+D L   +     I +E   I  E 
Sbjct: 101 NAYTSRENTVYY--------AKSLKEDIPKAVDILSDILTRSVLDPEAIERERDVIIRES 152

Query: 159 VGNKSSLTKMMYHAVRLLASPEHPFHQFGTGNIFTLTNMPKLHKLSLKNELVKYFREHFF 218
                   ++++  +  +   + P  +   G I  + ++        +++L KY  +++ 
Sbjct: 153 EEVDKMYDEVVFDHLHEVTYKDQPLGRTILGPIKNIQSI-------TRDDLSKYITDNYK 205

Query: 219 AENMVLCLRGPQSLNQLSKIAQARFS 244
            + MVL   G     +L + AQ  F 
Sbjct: 206 GDRMVLAGAGAVDHEKLVEYAQRCFG 231

>ZYRO0C03806g Chr3 complement(301873..303270) [1398 bp, 465 aa] {ON}
           highly similar to uniprot|P10507 Saccharomyces
           cerevisiae YLR163C MAS1 Smaller subunit of the
           mitochondrial processing protease essential processing
           enzyme that cleaves the N-terminal targeting sequences
           from mitochondrially imported proteins
          Length = 465

 Score = 42.7 bits (99), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 55/211 (26%), Positives = 85/211 (40%), Gaps = 25/211 (11%)

Query: 42  PSETVASCAVSIATGSHNDPVEIPGLAHFCEHMVLSSGSKRHPEPNAFHETLSKNNGSQ- 100
           P+ + A+  + +  GS  +     G AHF EH+    G+K   +     E   +N GS  
Sbjct: 46  PNVSSATVGIFVDAGSRAENARNNGTAHFLEHLAF-KGTKNRSQTGIELEI--ENIGSHL 102

Query: 101 NAHTSGEQTSFYFELPSSQSSDSLVFD--QVVGILADALKEPIFHDVLINKEIYAINSEH 158
           NA+TS E T ++        + SL  D  + V IL+D L   +     I +E   I  E 
Sbjct: 103 NAYTSRENTVYF--------AKSLEEDVPRAVEILSDILTRSVLDPKAIERERDVIIRE- 153

Query: 159 VGNKSSLTKMMYHAVRL--LASPEHPFHQFGTGNIFTLTNMPKLHKLSLKNELVKYFREH 216
               S     MY  V    L    +     G   +  + N+  + +  LKN    Y  ++
Sbjct: 154 ----SEEVDKMYDEVVFDHLHDVAYKNQALGRTILGPIKNIKTITREDLKN----YIDKN 205

Query: 217 FFAENMVLCLRGPQSLNQLSKIAQARFSDIP 247
           +  + MVL   G     +L + AQ  F  IP
Sbjct: 206 YKGDRMVLAGAGAIDHEKLIEYAQKSFGHIP 236

>KAFR0H02030 Chr8 (374862..376250) [1389 bp, 462 aa] {ON} Anc_8.376
           YLR163C
          Length = 462

 Score = 42.0 bits (97), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 58/223 (26%), Positives = 92/223 (41%), Gaps = 28/223 (12%)

Query: 42  PSETVASCAVSIATGSHNDPVEIPGLAHFCEHMVLSSGSKRHPEPNAFHETLSKNNGSQ- 100
           P+ + A+  + +  GS  + V+  G AHF EH+       R        E   +N GS  
Sbjct: 42  PNTSSATVGIFVDAGSRAENVKNNGTAHFLEHLAFKGTENRSQRA---IELEIENIGSHL 98

Query: 101 NAHTSGEQTSFYFELPSSQSSDSLVFD--QVVGILADALKEPIFHDVLINKEIYAINSEH 158
           NA+TS E T +Y        + SL  D  + V IL+D L +       I +E   I  E 
Sbjct: 99  NAYTSRENTVYY--------AKSLQNDIPKAVEILSDILTKSTLDPRAIERERDVIIRES 150

Query: 159 VGNKSSLTKMMYHAVRLLASPEHPFHQFGTGNIFTLTNMPKLHKLSLKNELVKYFREHFF 218
                   ++++  +  +A  + P  +   G I    N+  + +  LK+    Y  +++ 
Sbjct: 151 EEVDKMYDEVVFDHLHDIAYKDQPLGRTILGPI---KNIKSISRTDLKS----YINKNYK 203

Query: 219 AENMVLCLRGPQSLNQLSKIAQARF-----SDIPSIPTLQVPR 256
            + MVL   G    + L   AQ  F     SD P +P L  PR
Sbjct: 204 GDRMVLAGAGAVDHDNLVTYAQKYFGHLQKSDSP-MP-LGTPR 244

>Kwal_23.3345 s23 (253614..254990) [1377 bp, 458 aa] {ON} YLR163C
           (MAS1) - mitochondrial processing protease subunit
           [contig 252] FULL
          Length = 458

 Score = 42.0 bits (97), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 52/219 (23%), Positives = 89/219 (40%), Gaps = 20/219 (9%)

Query: 42  PSETVASCAVSIATGSHNDPVEIPGLAHFCEHMVLSSGSKRHPEPNAFHETLSKNNGSQ- 100
           P+ + A+  + +  GS  +  +  G AHF EH+    G+K   +     E   +N GS  
Sbjct: 39  PNTSSATVGIFVDAGSRAENSKNNGTAHFLEHLAF-KGTKNRTQVGIEMEI--ENIGSHL 95

Query: 101 NAHTSGEQTSFYFELPSSQSSDSLVFDQVVGILADALKEPIFHDVLINKEIYAINSEHVG 160
           NA+TS E T +Y +  +            V IL+D L + +     I +E   I  E   
Sbjct: 96  NAYTSRENTVYYAKTLTQN------IPNAVDILSDILTKSVLDTNAIERERDVIIRESEE 149

Query: 161 NKSSLTKMMYHAVRLLASPEHPFHQFGTGNIFTLTNMPKLHKLSLKNELVKYFREHFFAE 220
                 ++++  +  +   + P  +   G I  +       K   + +L +Y   ++  +
Sbjct: 150 VDKMYDEVVFDHLHAITYKDQPLGRTILGPIKNI-------KTIQQRDLREYISTNYKGD 202

Query: 221 NMVLCLRGPQSLNQLSKIAQARFSDIPS--IPT-LQVPR 256
            MVL   G    ++L + A   F  IP   IP  L  PR
Sbjct: 203 RMVLAGAGDVDHDKLVEYAGKYFGHIPKSEIPVPLGSPR 241

>TDEL0F05000 Chr6 complement(942516..943886) [1371 bp, 456 aa] {ON}
           Anc_8.376 YLR163C
          Length = 456

 Score = 42.0 bits (97), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 55/211 (26%), Positives = 85/211 (40%), Gaps = 25/211 (11%)

Query: 42  PSETVASCAVSIATGSHNDPVEIPGLAHFCEHMVLSSGSKRHPEPNAFHETLSKNNGSQ- 100
           P  + A+  + +  GS  +  +  G AHF EH+    G+K   +     E   +N GS  
Sbjct: 37  PEMSTATVGIFVDAGSRAENEKNNGTAHFLEHLAF-KGTKDRTQSGIELEI--ENIGSHL 93

Query: 101 NAHTSGEQTSFYFELPSSQSSDSLVFD--QVVGILADALKEPIFHDVLINKEIYAINSEH 158
           NA+TS E T +Y        + SL  D  + V IL+D L   +     I +E   I  E 
Sbjct: 94  NAYTSRENTVYY--------AKSLRDDIPRAVDILSDILTRSVLDPRAIERERDVIIRE- 144

Query: 159 VGNKSSLTKMMYHAVRL--LASPEHPFHQFGTGNIFTLTNMPKLHKLSLKNELVKYFREH 216
               S     MY  V    L    +     G   +  + N+  + +  LK+    Y  ++
Sbjct: 145 ----SEEVDKMYDEVVFDHLHEIAYKDQSLGRTILGPVKNIKSITRKDLKD----YITKN 196

Query: 217 FFAENMVLCLRGPQSLNQLSKIAQARFSDIP 247
           +  + MVL   G    + L K A+  F  IP
Sbjct: 197 YKGDRMVLAGAGAVDHDDLVKQAERFFGHIP 227

>TBLA0H01010 Chr8 (217060..218559) [1500 bp, 499 aa] {ON} Anc_8.376
           YLR163C
          Length = 499

 Score = 42.0 bits (97), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 45/206 (21%), Positives = 81/206 (39%), Gaps = 17/206 (8%)

Query: 42  PSETVASCAVSIATGSHNDPVEIPGLAHFCEHMVLSSGSKRHPEPNAFHETLSKNNGSQ- 100
           P+ + AS  + +  GS  +  +  G AHF EH+     + R        E + +N GS  
Sbjct: 77  PNTSTASIGIYVDAGSRAENSKNNGTAHFLEHLAFKGTTTRSQRD---IELVIENLGSHL 133

Query: 101 NAHTSGEQTSFYFELPSSQSSDSLVFDQVVGILADALKEPIFHDVLINKEIYAINSEHVG 160
           NA+TS E T +Y +               + IL+D L +       I +E   I  E   
Sbjct: 134 NAYTSRENTVYYAKTLKDN------IPNAIDILSDILTKSTLDKNAIERERSVIIRESEE 187

Query: 161 NKSSLTKMMYHAVRLLASPEHPFHQFGTGNIFTLTNMPKLHKLSLKNELVKYFREHFFAE 220
                 ++++  +  +   + P  +   G I  +  +        +N+L  Y   ++  +
Sbjct: 188 VDQMYDEVVFDHLHEIVYKDQPLGRTILGPIKNINTIQ-------RNDLQNYITTNYKGD 240

Query: 221 NMVLCLRGPQSLNQLSKIAQARFSDI 246
            MVL   G  +  +L K A+  F  +
Sbjct: 241 RMVLAGAGDVNHEELVKYAEKYFGHV 266

>KLTH0F08954g Chr6 (770605..771981) [1377 bp, 458 aa] {ON} highly
           similar to uniprot|P10507 Saccharomyces cerevisiae
           YLR163C MAS1 Smaller subunit of the mitochondrial
           processing protease essential processing enzyme that
           cleaves the N-terminal targeting sequences from
           mitochondrially imported proteins
          Length = 458

 Score = 40.8 bits (94), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 46/207 (22%), Positives = 83/207 (40%), Gaps = 17/207 (8%)

Query: 42  PSETVASCAVSIATGSHNDPVEIPGLAHFCEHMVLSSGSKRHPEPNAFHETLSKNNGSQ- 100
           P+ + A+  + +  GS  +     G AHF EH+    G+K   +     E   +N GS  
Sbjct: 39  PNTSSATVGIFVDAGSRAENTRNNGTAHFLEHLAF-KGTKNRTQVGIELEI--ENIGSHL 95

Query: 101 NAHTSGEQTSFYFELPSSQSSDSLVFDQVVGILADALKEPIFHDVLINKEIYAINSEHVG 160
           NA+TS E T +Y +  +            V +L+D L   +     I +E   I  E   
Sbjct: 96  NAYTSRENTVYYAKTLTQN------IPNAVDVLSDILTRSVLDARAIERERDVIIRESEE 149

Query: 161 NKSSLTKMMYHAVRLLASPEHPFHQFGTGNIFTLTNMPKLHKLSLKNELVKYFREHFFAE 220
                 ++++  +  +   + P  +   G I    N+  + +  L++    Y  +++  +
Sbjct: 150 VDKMYDEVVFDHLHAITYKDQPLGRTILGPI---ENIKTIQRRDLQD----YISKNYKGD 202

Query: 221 NMVLCLRGPQSLNQLSKIAQARFSDIP 247
            MVL   G     +L + A   F  IP
Sbjct: 203 RMVLAGAGAVDHEKLVEYADKYFGHIP 229

>AGL138C Chr7 complement(453737..455149) [1413 bp, 470 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR163C
           (MAS1)
          Length = 470

 Score = 40.8 bits (94), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 48/209 (22%), Positives = 85/209 (40%), Gaps = 21/209 (10%)

Query: 42  PSETVASCAVSIATGSHNDPVEIPGLAHFCEHMVLSSGSKRHPEPNAFHETLSKNNGSQ- 100
           P+   AS  + +  GS  + V   G AHF EH+    G+K   +     E   +N GS  
Sbjct: 46  PNTATASVGIFVDAGSRAENVRNNGTAHFLEHLAF-KGTKNRTQVGIELEI--ENLGSHL 102

Query: 101 NAHTSGEQTSFYFELPSSQSSDSLVFD--QVVGILADALKEPIFHDVLINKEIYAINSEH 158
           NA+TS E T +Y        + SL  D  + + +L+D L   +     + +E   I  E 
Sbjct: 103 NAYTSRENTVYY--------AKSLQEDIPRALDVLSDILTRSVLDPKAVERERDVIIRES 154

Query: 159 VGNKSSLTKMMYHAVRLLASPEHPFHQFGTGNIFTLTNMPKLHKLSLKNELVKYFREHFF 218
                   ++++  +  ++    P  +   G I    N+  + +  LK    +Y   ++ 
Sbjct: 155 EEVDKMYDEVVFDHLHAISYENQPLGRTILGPI---ENIKSIQQRDLK----EYISTNYK 207

Query: 219 AENMVLCLRGPQSLNQLSKIAQARFSDIP 247
            + M L   G    ++L +  +  F  IP
Sbjct: 208 GDRMALVGAGAVDHDELVRYGEKYFGHIP 236

>AFR334W Chr6 (1043252..1046341) [3090 bp, 1029 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOL098C
          Length = 1029

 Score = 37.7 bits (86), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 41/188 (21%), Positives = 81/188 (43%), Gaps = 13/188 (6%)

Query: 66  GLAHFCEHMVLSSGSKRHPEPNAFHETLSKNNGSQNAHTSGEQTSFYFELPSSQSSDSLV 125
           G+ H  EH++   GS+R+P              + NA+T+ + T++        S+  L 
Sbjct: 57  GVPHTLEHLIFM-GSQRYPRKGLLDTAGGITMSTTNAYTASDHTAYEL-----VSAGWLG 110

Query: 126 FDQVVGILADALKEPIFHDVLINKEIYAINSEHVGNKSSLTKMM---YHAVRLLASPEHP 182
           F +++ +  D L  P   +     E+Y ++   + +K  +   M    H    +A  E  
Sbjct: 111 FKKLLPVYLDHLLHPTLTEHAFTTEVYHLDPNDLTDKGVVYSEMEAREHESSDVAILEKG 170

Query: 183 FHQFGTGNIF--TLTNMPKLHKLSLKNELVKYFR-EHFFAENMVLCLRGPQSLNQLSKIA 239
              F  GN +   +  + K H  +L N  V+ F  E +  +N+ L + G    ++L +I 
Sbjct: 171 RQMFPEGNGYRSEVGGLTK-HLRTLTNAEVRAFHAEMYTPDNICLVICGNVPEHELLQIV 229

Query: 240 QARFSDIP 247
           +   +++P
Sbjct: 230 EEFDAELP 237

>YOL098C Chr15 complement(132725..135838) [3114 bp, 1037 aa] {ON}
           Putative metalloprotease
          Length = 1037

 Score = 37.0 bits (84), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 44/207 (21%), Positives = 88/207 (42%), Gaps = 34/207 (16%)

Query: 66  GLAHFCEHMVLSSGSKRHPEPNAFHETLSKNNGSQNAHTSGEQTSFYFELPSSQSSDSLV 125
           G  H  EH++   GSK +P         + +  + NA T  +QT +        S+    
Sbjct: 57  GAPHTLEHLIFM-GSKSYPYKGLLDTAGNLSLSNTNAWTDTDQTVYTL-----SSAGWKG 110

Query: 126 FDQVVGILADALKEPIFHDVLINKEIYAINSEHVGNKSSLTKMMYHAV------------ 173
           F +++    D +  P   D     E+Y I+ E++G+K  +   M  A+            
Sbjct: 111 FSKLLPAYLDHILHPTLTDEACLTEVYHIDPENLGDKGVVFSEM-EAIETQGWYISGLEK 169

Query: 174 RLLASPEHPFHQFGTG----NIFTLTNMPKLHKLSLKNELVKYFREHFFAENMVLCLRGP 229
           + L  PE   ++  TG    N+ TLTN          +E+ ++ +  + ++N+ + + G 
Sbjct: 170 QRLMFPEGSGYRSETGGLTKNLRTLTN----------DEIRQFHKSLYSSDNLCVIVCGN 219

Query: 230 QSLNQLSKIAQARFSDIPSIPTLQVPR 256
              ++L  + +   + +P IP+  +P+
Sbjct: 220 VPTDELLTVMEEWDNKLPEIPS-NIPK 245

>Ecym_4191 Chr4 (396094..397482) [1389 bp, 462 aa] {ON} similar to
           Ashbya gossypii AGL138C
          Length = 462

 Score = 34.7 bits (78), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 52/223 (23%), Positives = 87/223 (39%), Gaps = 28/223 (12%)

Query: 42  PSETVASCAVSIATGSHNDPVEIPGLAHFCEHMVLSSGSKRHPEPNAFHETLSKNNGSQ- 100
           P+ + A+  + +  GS  +     G AHF EH+     + R        E   +N GS  
Sbjct: 42  PNTSTATVGIFVDAGSRAENSRNNGTAHFLEHLAFKGTTNR---SQVGIELEIENIGSHL 98

Query: 101 NAHTSGEQTSFYFELPSSQSSDSLVFD--QVVGILADALKEPIFHDVLINKEIYAINSEH 158
           NA+TS E T +Y        + SL  D  + + IL+D L     +   I +E   I  E 
Sbjct: 99  NAYTSRENTVYY--------AKSLKEDIPKAMDILSDILTRSTLNPKAIERERDVIIRE- 149

Query: 159 VGNKSSLTKMMYHAVRL--LASPEHPFHQFGTGNIFTLTNMPKLHKLSLKNELVKYFREH 216
               S     MY  V    L +  +     G   +  + N+  +     + +L +Y   +
Sbjct: 150 ----SEEVDKMYDEVVFDHLHAITYKDQALGRTILGPIENIKSIQ----RKDLAEYISTN 201

Query: 217 FFAENMVLCLRGPQSLNQLSKIAQARFSDI--PSIPT-LQVPR 256
           +  + M L   G    ++L +  +  F  I   ++P  L  PR
Sbjct: 202 YTGDRMALVGAGSVDHDKLVEYGERYFGHIRKSAVPVPLGSPR 244

>KLLA0F03575g Chr6 (337386..340505) [3120 bp, 1039 aa] {ON} weakly
            similar to uniprot|P53950 Saccharomyces cerevisiae
            YNL054W VAC7 Integral vacuolar membrane protein may
            function to regulate Fab1p kinase activity
          Length = 1039

 Score = 34.7 bits (78), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 43/74 (58%), Gaps = 7/74 (9%)

Query: 950  VLAKLTAPQFKHDYVDELLSLLTSN---SLGKLEKTSGPANLMSQIE--ANVHSGQRNTS 1004
            + AKL+APQ K +  D+LL+ L +    S+  +  + GP +  S+ +  A++ S  RNT 
Sbjct: 402  IPAKLSAPQLKQN--DKLLNRLKNTRHTSIAAIPNSQGPPSSNSEQDDVASLRSINRNTM 459

Query: 1005 LAMKSHKRLRTQIS 1018
              M+S K  RTQ+S
Sbjct: 460  QEMQSIKSHRTQMS 473

>Skud_4.211 Chr4 complement(369208..370539) [1332 bp, 443 aa] {ON}
           YDL044C (REAL)
          Length = 443

 Score = 33.9 bits (76), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 27/91 (29%), Positives = 38/91 (41%), Gaps = 19/91 (20%)

Query: 72  EHMVLSSGSKRHPE-PNAFHETLSKNNGSQ-----------NAHTSGEQTSFYFELPSSQ 119
           E +V +   K H + PN  HE L +  G+             A    EQT    E    +
Sbjct: 101 EKIVFNHSQKAHRKLPNKDHEFLKETAGNDYVYQGTEPSTVGARAISEQTRTLLEQIFDK 160

Query: 120 SSD-------SLVFDQVVGILADALKEPIFH 143
            +D       SL FDQ   + A+A+KEP+ H
Sbjct: 161 DNDVSKKNQKSLDFDQYKDVTAEAIKEPVAH 191

>NDAI0B05550 Chr2 complement(1357161..1360523) [3363 bp, 1120 aa] {ON}
            Anc_5.417 YDR359C
          Length = 1120

 Score = 34.3 bits (77), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 21/36 (58%)

Query: 171  HAVRLLASPEHPFHQFGTGNIFTLTNMPKLHKLSLK 206
            HAV  L+S  HP  QF  GN   L +MP ++ +S K
Sbjct: 1042 HAVTTLSSAPHPQQQFPNGNGSNLGSMPNVNNVSSK 1077

>CAGL0H07183g Chr8 complement(706436..707932) [1497 bp, 498 aa] {ON}
           similar to uniprot|P38793 Saccharomyces cerevisiae
           YHR070w
          Length = 498

 Score = 33.9 bits (76), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 23/89 (25%), Positives = 42/89 (47%), Gaps = 11/89 (12%)

Query: 499 AVKFQAFVNEFMSQDTVRIILLGNLSKCYFNCNPDKITTDTYFEYEYVKI----FIDLEV 554
           A +F+ F  + ++ D+  +++    S C F  +  K+  ++    E+ ++    F D E+
Sbjct: 217 ATQFRTFPMKVIAGDSTNLVVEQKESDCTFRFDFSKVYWNSRLHTEHQRLVTDYFKDGEI 276

Query: 555 LGCDDIHYRFTIPGPNPFMVPVGHKLSFI 583
           + CD         G  PF VP G K SF+
Sbjct: 277 V-CD------VFAGVGPFAVPAGKKPSFV 298

>KNAG0C01450 Chr3 (284898..289967) [5070 bp, 1689 aa] {ON} Anc_1.251
            YKR031C
          Length = 1689

 Score = 32.7 bits (73), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 34/140 (24%), Positives = 62/140 (44%), Gaps = 13/140 (9%)

Query: 994  ANVHSGQRNTSLAMKSHKRLRTQISYRRYNF----DEDDEPVDARTLQNLKLSEYMRFFR 1049
            A  HSG+RN++++  S + L T  + +        D  D P D     +++L +Y+R   
Sbjct: 425  AGNHSGRRNSTVSASSSE-LSTHFTLKNTKMKQLQDLIDAPDDRTQPLHIRLEKYLRLLN 483

Query: 1050 QRISIYSGKRA-----KLSIMVYSAMSKEEVQGKMLYLQIESFLKMKGFNIP---SKDLN 1101
              +S+           + SI+ Y    +   +GK  +L I S  K +G+N+      DL 
Sbjct: 484  AALSLRPHANRLFEFYEFSILGYYLSYETGYKGKEGHLVIRSSAKAQGWNVSHFRRNDLR 543

Query: 1102 AIVQKSKGKPTALLKGLLSY 1121
            A++ +   K   +    L+Y
Sbjct: 544  AMISRHTPKWFLVRDSYLTY 563

>TBLA0A06940 Chr1 complement(1694417..1697392) [2976 bp, 991 aa]
           {ON} Anc_5.541 YDR430C
          Length = 991

 Score = 32.7 bits (73), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 30/122 (24%), Positives = 56/122 (45%), Gaps = 8/122 (6%)

Query: 44  ETVASCAVSIATGSHNDPVEIPGLAHFCEHMVLSSGSKRHPEPNAFHETLSKN-NGSQNA 102
           +TV +  V    G   +P +  G+AH  EH  L  GSK++P  + F + L+++ +   NA
Sbjct: 61  DTVDTNNV-FCVGFKTNPPDSTGVAHILEHTTL-CGSKKYPVRDPFFKMLNRSLSNFMNA 118

Query: 103 HTSGEQTSFYFELPSSQSSDSLVFDQVVGILADALKEPIFHDVLINKEIYAINSEHVGNK 162
            T  + T + F   +S+      F  +  +  DA   P+       +E + + ++   +K
Sbjct: 119 MTGHDYTMYPFATTNSKD-----FKNLQDVYLDATFSPLLKQEDFFQEGWRLENKDATDK 173

Query: 163 SS 164
            S
Sbjct: 174 DS 175

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.135    0.388 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 121,261,855
Number of extensions: 5322282
Number of successful extensions: 15356
Number of sequences better than 10.0: 86
Number of HSP's gapped: 15580
Number of HSP's successfully gapped: 123
Length of query: 1193
Length of database: 53,481,399
Length adjustment: 121
Effective length of query: 1072
Effective length of database: 39,606,813
Effective search space: 42458503536
Effective search space used: 42458503536
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 72 (32.3 bits)