Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
AGR097W8.254ON65363930470.0
SAKL0H17248g8.254ON66064819730.0
NCAS0B049708.254ON66665019320.0
KLTH0G13882g8.254ON68767219330.0
KLLA0F18931g8.254ON66564619280.0
Smik_12.1428.254ON66365119110.0
ZYRO0C01848g8.254ON64764319030.0
Kwal_56.235778.254ON68366819040.0
Skud_12.1518.254ON66464819000.0
YLR083C (EMP70)8.254ON66764818970.0
NDAI0B023708.254ON72265618990.0
KAFR0B026808.254ON66465018850.0
Suva_10.1678.254ON68466818830.0
YDR107C (TMN2)8.254ON67265618610.0
Smik_4.3538.254ON69065618370.0
KNAG0G019908.254ON66764918330.0
Kpol_543.358.254ON65864818290.0
Suva_2.2678.254ON67265618030.0
Skud_4.3688.254ON67265617960.0
TBLA0E043708.254ON67665917750.0
CAGL0B01683g8.254ON69167517740.0
TPHA0A018408.254ON68567817260.0
TBLA0H014508.254ON67365316570.0
NCAS0B038908.254ON66364816520.0
TDEL0F038108.254ON65664316110.0
Ecym_43178.254ON60563815760.0
NDAI0J014208.254ON61961415120.0
TDEL0C027107.411ON6786783481e-33
NCAS0A145207.411ON6706773428e-33
ZYRO0B03784g7.411ON6586673259e-31
YER113C (TMN3)7.411ON7066963181e-29
NDAI0A015107.411ON6796803115e-29
Smik_5.2587.411ON7067013063e-28
Skud_5.2667.411ON7076913027e-28
Suva_5.2347.411ON7066932921e-26
KAFR0K019507.411ON6646732742e-24
CAGL0G03487g7.411ON7047042662e-23
SAKL0F12914g7.411ON7075062662e-23
KLTH0C06226g7.411ON6945512592e-22
Ecym_71437.411ON6766382395e-20
Kwal_27.107467.411ON6902682172e-17
TBLA0I003307.411ON7134952111e-16
KNAG0C034307.411ON6802582064e-16
TPHA0K007307.411ON7335001743e-12
KLLA0E20835g7.411ON6762701672e-11
AGL295C7.411ON6574761663e-11
Kpol_1045.287.411ON6812841565e-10
Kpol_1033.288.303ON153169761.7
TPHA0C009608.303ON152369742.6
CAGL0L06402g8.303ON153569742.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AGR097W
         (653 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AGR097W Chr7 (920133..922094) [1962 bp, 653 aa] {ON} Syntenic ho...  1178   0.0  
SAKL0H17248g Chr8 (1530599..1532581) [1983 bp, 660 aa] {ON} simi...   764   0.0  
NCAS0B04970 Chr2 complement(909770..911770) [2001 bp, 666 aa] {O...   748   0.0  
KLTH0G13882g Chr7 (1204180..1206243) [2064 bp, 687 aa] {ON} simi...   749   0.0  
KLLA0F18931g Chr6 complement(1734636..1736633) [1998 bp, 665 aa]...   747   0.0  
Smik_12.142 Chr12 complement(273932..275923) [1992 bp, 663 aa] {...   740   0.0  
ZYRO0C01848g Chr3 (146621..148564) [1944 bp, 647 aa] {ON} simila...   737   0.0  
Kwal_56.23577 s56 complement(605281..607332) [2052 bp, 683 aa] {...   738   0.0  
Skud_12.151 Chr12 complement(277467..279461) [1995 bp, 664 aa] {...   736   0.0  
YLR083C Chr12 complement(294091..296094) [2004 bp, 667 aa] {ON} ...   735   0.0  
NDAI0B02370 Chr2 complement(593012..595180) [2169 bp, 722 aa] {O...   736   0.0  
KAFR0B02680 Chr2 complement(537048..539042) [1995 bp, 664 aa] {O...   730   0.0  
Suva_10.167 Chr10 complement(299075..301129) [2055 bp, 684 aa] {...   729   0.0  
YDR107C Chr4 complement(669016..671034) [2019 bp, 672 aa] {ON}  ...   721   0.0  
Smik_4.353 Chr4 complement(630320..632392) [2073 bp, 690 aa] {ON...   712   0.0  
KNAG0G01990 Chr7 complement(441326..443329) [2004 bp, 667 aa] {O...   710   0.0  
Kpol_543.35 s543 complement(78246..80222) [1977 bp, 658 aa] {ON}...   709   0.0  
Suva_2.267 Chr2 complement(463458..465476) [2019 bp, 672 aa] {ON...   699   0.0  
Skud_4.368 Chr4 complement(640627..642645) [2019 bp, 672 aa] {ON...   696   0.0  
TBLA0E04370 Chr5 complement(1108954..1110984) [2031 bp, 676 aa] ...   688   0.0  
CAGL0B01683g Chr2 complement(154275..156350) [2076 bp, 691 aa] {...   687   0.0  
TPHA0A01840 Chr1 (371758..373815) [2058 bp, 685 aa] {ON} Anc_8.2...   669   0.0  
TBLA0H01450 Chr8 complement(321416..323437) [2022 bp, 673 aa] {O...   642   0.0  
NCAS0B03890 Chr2 (693950..695941) [1992 bp, 663 aa] {ON} Anc_8.254    640   0.0  
TDEL0F03810 Chr6 complement(696251..698221) [1971 bp, 656 aa] {O...   625   0.0  
Ecym_4317 Chr4 (685854..687671) [1818 bp, 605 aa] {ON} similar t...   611   0.0  
NDAI0J01420 Chr10 (326749..328608) [1860 bp, 619 aa] {ON} Anc_8....   587   0.0  
TDEL0C02710 Chr3 complement(474759..476795) [2037 bp, 678 aa] {O...   138   1e-33
NCAS0A14520 Chr1 complement(2860704..2862716) [2013 bp, 670 aa] ...   136   8e-33
ZYRO0B03784g Chr2 complement(314902..316878) [1977 bp, 658 aa] {...   129   9e-31
YER113C Chr5 complement(387932..390052) [2121 bp, 706 aa] {ON}  ...   127   1e-29
NDAI0A01510 Chr1 (335693..337732) [2040 bp, 679 aa] {ON} Anc_7.4...   124   5e-29
Smik_5.258 Chr5 complement(396781..398901) [2121 bp, 706 aa] {ON...   122   3e-28
Skud_5.266 Chr5 (431486..433609) [2124 bp, 707 aa] {ON} YER113C ...   120   7e-28
Suva_5.234 Chr5 complement(363605..365725) [2121 bp, 706 aa] {ON...   117   1e-26
KAFR0K01950 Chr11 complement(401168..403162) [1995 bp, 664 aa] {...   110   2e-24
CAGL0G03487g Chr7 complement(337133..339247) [2115 bp, 704 aa] {...   107   2e-23
SAKL0F12914g Chr6 complement(1013914..1016037) [2124 bp, 707 aa]...   107   2e-23
KLTH0C06226g Chr3 (541022..543106) [2085 bp, 694 aa] {ON} simila...   104   2e-22
Ecym_7143 Chr7 (290555..292585) [2031 bp, 676 aa] {ON} similar t...    97   5e-20
Kwal_27.10746 s27 (479237..481309) [2073 bp, 690 aa] {ON} YER113...    88   2e-17
TBLA0I00330 Chr9 (52200..54341) [2142 bp, 713 aa] {ON} Anc_7.411...    86   1e-16
KNAG0C03430 Chr3 (674411..676453) [2043 bp, 680 aa] {ON} Anc_7.4...    84   4e-16
TPHA0K00730 Chr11 (150877..153078) [2202 bp, 733 aa] {ON} Anc_7....    72   3e-12
KLLA0E20835g Chr5 complement(1857426..1859456) [2031 bp, 676 aa]...    69   2e-11
AGL295C Chr7 complement(152197..154170) [1974 bp, 657 aa] {ON} S...    69   3e-11
Kpol_1045.28 s1045 (64235..66280) [2046 bp, 681 aa] {ON} (64237....    65   5e-10
Kpol_1033.28 s1033 complement(69924..74519) [4596 bp, 1531 aa] {...    34   1.7  
TPHA0C00960 Chr3 (204061..208632) [4572 bp, 1523 aa] {ON} Anc_8....    33   2.6  
CAGL0L06402g Chr12 (720723..725330) [4608 bp, 1535 aa] {ON} high...    33   2.9  

>AGR097W Chr7 (920133..922094) [1962 bp, 653 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR083C (EMP70) and
           YDR107C
          Length = 653

 Score = 1178 bits (3047), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 580/639 (90%), Positives = 580/639 (90%)

Query: 15  QGFYLPGSAPTTYRRGDAIPLLVNHITPTVFSDDRAGTDGQRDKERXXXXXXXXXPRLHM 74
           QGFYLPGSAPTTYRRGDAIPLLVNHITPTVFSDDRAGTDGQRDKER         PRLHM
Sbjct: 15  QGFYLPGSAPTTYRRGDAIPLLVNHITPTVFSDDRAGTDGQRDKERYLYAYDYYYPRLHM 74

Query: 75  CRPDKIEKVSESLGSIIFGDRLHNSPFELKMLEEKSCVALCEKTVPAEDAKFINQLIRSG 134
           CRPDKIEKVSESLGSIIFGDRLHNSPFELKMLEEKSCVALCEKTVPAEDAKFINQLIRSG
Sbjct: 75  CRPDKIEKVSESLGSIIFGDRLHNSPFELKMLEEKSCVALCEKTVPAEDAKFINQLIRSG 134

Query: 135 FFHNWLVDGLPAGREMHDARTNTVFYGTGFELGRVIRGTEDRNQEEPGEIELQTRRVLQP 194
           FFHNWLVDGLPAGREMHDARTNTVFYGTGFELGRVIRGTEDRNQEEPGEIELQTRRVLQP
Sbjct: 135 FFHNWLVDGLPAGREMHDARTNTVFYGTGFELGRVIRGTEDRNQEEPGEIELQTRRVLQP 194

Query: 195 GESVVAVPYFINHFEITVDYHKRAEDELRVVGVSVLPRSLQNPVGDKCANSGNGLVLSET 254
           GESVVAVPYFINHFEITVDYHKRAEDELRVVGVSVLPRSLQNPVGDKCANSGNGLVLSET
Sbjct: 195 GESVVAVPYFINHFEITVDYHKRAEDELRVVGVSVLPRSLQNPVGDKCANSGNGLVLSET 254

Query: 255 ADTKVTFTYSVRFHESDVSWATRWGKYLHVYDPKVQWYXXXXXXXXXXXXXXXXXXXXFR 314
           ADTKVTFTYSVRFHESDVSWATRWGKYLHVYDPKVQWY                    FR
Sbjct: 255 ADTKVTFTYSVRFHESDVSWATRWGKYLHVYDPKVQWYSLINFSLVVLLLSSIMVHSLFR 314

Query: 315 ALKTDLDRYNDFNLDNEFQEDYGWKLLHSDVFRSPSKTLLLSVFVGSGGQLFLMSACTLF 374
           ALKTDLDRYNDFNLDNEFQEDYGWKLLHSDVFRSPSKTLLLSVFVGSGGQLFLMSACTLF
Sbjct: 315 ALKTDLDRYNDFNLDNEFQEDYGWKLLHSDVFRSPSKTLLLSVFVGSGGQLFLMSACTLF 374

Query: 375 IAMLGFLSPSSRGSLGTIMFVLYAIFGGFGSYLSMSTYKMFGGEKWKVNMVLTPLLVPGI 434
           IAMLGFLSPSSRGSLGTIMFVLYAIFGGFGSYLSMSTYKMFGGEKWKVNMVLTPLLVPGI
Sbjct: 375 IAMLGFLSPSSRGSLGTIMFVLYAIFGGFGSYLSMSTYKMFGGEKWKVNMVLTPLLVPGI 434

Query: 435 IFATMLLMNFFLVMVQSSGAMPFGTMLAIVVLWFVLSIPISIMGSLFARKKNTWDQHPTK 494
           IFATMLLMNFFLVMVQSSGAMPFGTMLAIVVLWFVLSIPISIMGSLFARKKNTWDQHPTK
Sbjct: 435 IFATMLLMNFFLVMVQSSGAMPFGTMLAIVVLWFVLSIPISIMGSLFARKKNTWDQHPTK 494

Query: 495 TSQIAKQIPPQPWYLRTWPAAYIAGLFPFGAIAVELYFIYTSIWXXXXXXXXXXXXXXXX 554
           TSQIAKQIPPQPWYLRTWPAAYIAGLFPFGAIAVELYFIYTSIW                
Sbjct: 495 TSQIAKQIPPQPWYLRTWPAAYIAGLFPFGAIAVELYFIYTSIWFNTMFYMFGFLFFTFL 554

Query: 555 XXXXXXXXXXXXXXYYSLCMENWSWQWRSFIIGGIGCSTYVFINSILFTKFRLGGFVTIV 614
                         YYSLCMENWSWQWRSFIIGGIGCSTYVFINSILFTKFRLGGFVTIV
Sbjct: 555 LLTLTTALVTILLTYYSLCMENWSWQWRSFIIGGIGCSTYVFINSILFTKFRLGGFVTIV 614

Query: 615 LYVGYSLLISFLFCLVTGTIGFVSSLWFVRKIYSSIKVD 653
           LYVGYSLLISFLFCLVTGTIGFVSSLWFVRKIYSSIKVD
Sbjct: 615 LYVGYSLLISFLFCLVTGTIGFVSSLWFVRKIYSSIKVD 653

>SAKL0H17248g Chr8 (1530599..1532581) [1983 bp, 660 aa] {ON} similar
           to uniprot|P32802 Saccharomyces cerevisiae YLR083C EMP70
           Protein whose 24kDa cleavage product is found in
           endosome-enriched membrane fractions predicted to be a
           transmembrane protein
          Length = 660

 Score =  764 bits (1973), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 370/648 (57%), Positives = 453/648 (69%), Gaps = 10/648 (1%)

Query: 15  QGFYLPGSAPTTYRRGDAIPLLVNHITPTVF--SDDRAGTDGQRDKERXXXXXXXXXPRL 72
             FYLPG APTTY +GD IPLLVNH+TP+ +    D+ G     DKER          + 
Sbjct: 14  SAFYLPGVAPTTYHKGDEIPLLVNHLTPSTYFQHADQEGHTMSGDKERFLYSYDYYYDKF 73

Query: 73  HMCRPDKIEKVSESLGSIIFGDRLHNSPFELKMLEEKSCVALCEKTVPAEDAKFINQLIR 132
           H CRP+ + K  ESLGSIIFGDR++NSPFEL MLE K+CV LC+  +P +DAKFIN+LIR
Sbjct: 74  HFCRPENLIKQPESLGSIIFGDRIYNSPFELNMLENKTCVPLCKSEIPKDDAKFINKLIR 133

Query: 133 SGFFHNWLVDGLPAGREMHDARTNTVFYGTGFELG--RVIRGTEDRNQEEPGE-----IE 185
           +GFFHNWLVDGLPA REMHD RTN+ FYG GFELG   V+   ED + ++  E     I 
Sbjct: 134 NGFFHNWLVDGLPAAREMHDGRTNSYFYGNGFELGFVDVVDTIEDPDTKKVSESDYIEIA 193

Query: 186 LQTRRVLQPGESVVAVPYFINHFEITVDYHKRAEDELRVVGVSVLPRSLQNPVGDKCANS 245
              + + +    +  + YFINHF+I ++YH R ED  RVVGVSV+P S++    D C   
Sbjct: 194 DADKELKERSAKLTELSYFINHFDIKIEYHDRGEDNYRVVGVSVIPASIKRDSSDSCDTE 253

Query: 246 GNGLVLSETADTKVTFTYSVRFHESDVSWATRWGKYLHVYDPKVQWYXXXXXXXXXXXXX 305
           G  LVLSE AD  V FTYSV F  S   WATRW KYLHVYDP++QW+             
Sbjct: 254 GEPLVLSEDADNTVHFTYSVSFVPSQTLWATRWDKYLHVYDPQIQWFSLISFSLIVILLS 313

Query: 306 XXXXXXXFRALKTDLDRYNDFNLDNEFQEDYGWKLLHSDVFRSPSKTLLLSVFVGSGGQL 365
                  FRALK DL RYN+ NLD+EFQE+ GWKL+H DVFR+P +T+LLSV VGSG QL
Sbjct: 314 SVMVHSLFRALKNDLSRYNELNLDDEFQEETGWKLVHGDVFRTPERTMLLSVLVGSGAQL 373

Query: 366 FLMSACTLFIAMLGFLSPSSRGSLGTIMFVLYAIFGGFGSYLSMSTYKMFGGEKWKVNMV 425
           FLM+  T+  A+LG LSPSSRGSL T+MF+LYA+FG FGSY SM+ YK F G+ WK+NM+
Sbjct: 374 FLMAGFTILFALLGLLSPSSRGSLTTVMFILYALFGSFGSYTSMAVYKFFNGQNWKLNMI 433

Query: 426 LTPLLVPGIIFATMLLMNFFLVMVQSSGAMPFGTMLAIVVLWFVLSIPISIMGSLFARKK 485
           LTP+L+P +IF +ML +N FLV V SSGA+PFGTMLAIVVLWFV SIP+S+ GS+ +RKK
Sbjct: 434 LTPILIPSMIFISMLGLNTFLVFVHSSGAIPFGTMLAIVVLWFVFSIPLSVAGSIISRKK 493

Query: 486 NTWDQHPTKTSQIAKQIPPQPWYLRTWPAAYIAGLFPFGAIAVELYFIYTSIWXXXXXXX 545
           + WD+ PT T+QIA+QIP QPWYL+T PA+ IAG FPFG+I VELYFIY+S+W       
Sbjct: 494 SQWDR-PTNTNQIARQIPFQPWYLKTVPASLIAGTFPFGSIVVELYFIYSSLWFNKIFYM 552

Query: 546 XXXXXXXXXXXXXXXXXXXXXXXYYSLCMENWSWQWRSFIIGGIGCSTYVFINSILFTKF 605
                                  YYSLCMENW WQWR F IGG GC+ YVF+++ILFTKF
Sbjct: 553 FGFLFFSFLLLTLTTTLVTVLLTYYSLCMENWKWQWRGFWIGGAGCAFYVFVHAILFTKF 612

Query: 606 RLGGFVTIVLYVGYSLLISFLFCLVTGTIGFVSSLWFVRKIYSSIKVD 653
           +LGG  T+VLY+GYS++IS L CL+TG +GF+SSLWFVRKIY SIKVD
Sbjct: 613 KLGGLTTVVLYLGYSVVISGLCCLITGAVGFLSSLWFVRKIYGSIKVD 660

>NCAS0B04970 Chr2 complement(909770..911770) [2001 bp, 666 aa] {ON} 
          Length = 666

 Score =  748 bits (1932), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 361/650 (55%), Positives = 454/650 (69%), Gaps = 12/650 (1%)

Query: 15  QGFYLPGSAPTTYRRGDAIPLLVNHITPTVFSDDRAGTDGQRDKERXXXXXXXXXPRLHM 74
           + FYLPG APTTY  GD IPLLVNH+TP+V+          ++KE           RLH 
Sbjct: 18  RAFYLPGVAPTTYHEGDEIPLLVNHLTPSVYFQRTDANGKSKNKEHFLYSFDYYFDRLHF 77

Query: 75  CRPDKIEKVSESLGSIIFGDRLHNSPFELKMLEEKSCVALCEKTVPAEDAKFINQLIRSG 134
           C+P+ IEK  ESLGSIIFGDR++NSPFELKMLEEK+CV+LC+ T+P +DAKFIN+LI++G
Sbjct: 78  CKPEHIEKQPESLGSIIFGDRIYNSPFELKMLEEKTCVSLCKSTIPGKDAKFINKLIKNG 137

Query: 135 FFHNWLVDGLPAGREMHDARTNTVFYGTGFELG-----RVIRG----TEDRNQEEPGEIE 185
           FF NWL+DGLPA  +++D +T + FYGTGFELG     + I G    T    Q     +E
Sbjct: 138 FFQNWLIDGLPAATQVYDRKTKSEFYGTGFELGFVESFQAIDGQAPATTKPKQTTNEGLE 197

Query: 186 LQTRRV--LQPGESVVAVPYFINHFEITVDYHKRAEDELRVVGVSVLPRSLQNPVGDKCA 243
           L+TR    +Q  +++  + YF+NH++I V+YH R E   RVVGV V P S++      C 
Sbjct: 198 LETREAKNVQMVKNI-EIAYFVNHYDIQVEYHDRGEGTYRVVGVIVNPVSIKRSTPGTCE 256

Query: 244 NSGNGLVLSETADTKVTFTYSVRFHESDVSWATRWGKYLHVYDPKVQWYXXXXXXXXXXX 303
            +G+ LVLSE AD  V FTYSV+F  S+  WATRW KYLH YDP +QW+           
Sbjct: 257 TTGDPLVLSEDADNDVYFTYSVKFVPSETVWATRWDKYLHTYDPTIQWFSLVNFSIIVLL 316

Query: 304 XXXXXXXXXFRALKTDLDRYNDFNLDNEFQEDYGWKLLHSDVFRSPSKTLLLSVFVGSGG 363
                     +ALK+D  RYN+FNL+++FQED GWKL H DVFR P K++LLSV VGSG 
Sbjct: 317 LSSVVIHSLMKALKSDFARYNEFNLEDDFQEDAGWKLGHGDVFRIPHKSMLLSVLVGSGV 376

Query: 364 QLFLMSACTLFIAMLGFLSPSSRGSLGTIMFVLYAIFGGFGSYLSMSTYKMFGGEKWKVN 423
           QLFLM +C++F A LGFLSPSSRGSL T+MF+LYA+FG  GSY SM+ YK F G  WKVN
Sbjct: 377 QLFLMISCSIFFAALGFLSPSSRGSLATVMFILYALFGFVGSYTSMAVYKFFKGPYWKVN 436

Query: 424 MVLTPLLVPGIIFATMLLMNFFLVMVQSSGAMPFGTMLAIVVLWFVLSIPISIMGSLFAR 483
           M+LTP ++PG IF T++ +NFFL+   SSG +P GT+  +++LWF+ SIP++  GSL A 
Sbjct: 437 MLLTPFMIPGFIFLTIVGLNFFLMFAHSSGVVPAGTLFFMILLWFIFSIPLAFAGSLIAH 496

Query: 484 KKNTWDQHPTKTSQIAKQIPPQPWYLRTWPAAYIAGLFPFGAIAVELYFIYTSIWXXXXX 543
           KK TWD+HPTKT+QIA+QIP QPWYL+TWPA  IAG+FPFG+IAVELYFIYTS+W     
Sbjct: 497 KKCTWDEHPTKTNQIARQIPFQPWYLKTWPATMIAGIFPFGSIAVELYFIYTSLWFNKIF 556

Query: 544 XXXXXXXXXXXXXXXXXXXXXXXXXYYSLCMENWSWQWRSFIIGGIGCSTYVFINSILFT 603
                                    Y+SLC+ENW WQWR FI+GG+GC+ YVF++SILFT
Sbjct: 557 YMFGFLLFSFLLLTLTTSLVTILITYHSLCLENWQWQWRGFIVGGVGCAIYVFVHSILFT 616

Query: 604 KFRLGGFVTIVLYVGYSLLISFLFCLVTGTIGFVSSLWFVRKIYSSIKVD 653
           KF+LGGF TIVLYVGYS +IS LFC+VTG IGF+SSL FVRKIYS+IKVD
Sbjct: 617 KFKLGGFATIVLYVGYSTMISLLFCVVTGAIGFLSSLIFVRKIYSAIKVD 666

>KLTH0G13882g Chr7 (1204180..1206243) [2064 bp, 687 aa] {ON} similar
           to uniprot|P32802 Saccharomyces cerevisiae YLR083C EMP70
           Protein whose 24kDa cleavage product is found in
           endosome-enriched membrane fractions predicted to be a
           transmembrane protein
          Length = 687

 Score =  749 bits (1933), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 371/672 (55%), Positives = 457/672 (68%), Gaps = 34/672 (5%)

Query: 15  QGFYLPGSAPTTYRRGDAIPLLVNHITPTVFSDDRAGTDGQR--DKERXXXXXXXXXPRL 72
            GFYLPG APTTY  GDAIPLLVNH+TPT++    A  DG    DKE          P+ 
Sbjct: 17  SGFYLPGVAPTTYHEGDAIPLLVNHLTPTMYYQ-HADEDGNDLGDKESLLYSYDYYYPKF 75

Query: 73  HMCRPDKIEKVSESLGSIIFGDRLHNSPFELKMLEEKSCVALCEKTVPAEDAKFINQLIR 132
           H CRP+K+EK  ESLGSIIFGDR++NSPF+++ML+ K C +LC +++PA+DAKFIN+LI 
Sbjct: 76  HFCRPEKLEKQRESLGSIIFGDRIYNSPFQIEMLKNKECASLCSESIPADDAKFINKLIT 135

Query: 133 SGFFHNWLVDGLPAGREMHDARTNTVFYGTGFELGRV-IRGTEDRNQEE----------- 180
           +GFF NWLVDGLPA R+  D RT + FY  GFELG V I G+E R   +           
Sbjct: 136 NGFFQNWLVDGLPAARKTTDVRTKSEFYTPGFELGYVGIGGSELRMNGQGGSQDGDDSGS 195

Query: 181 ----------------PGEIELQTRRVLQPGESVVA---VPYFINHFEITVDYHKRAEDE 221
                           P +  L  R+ +   + +V     PYF NHFEI V YH R    
Sbjct: 196 HGSTKEVSESDYLDAPPAKRSLAKRKQVSNTKELVKQLETPYFANHFEIEVQYHDRGNGN 255

Query: 222 LRVVGVSVLPRSLQNPVGDKCANSGNGLVLSETADTKVTFTYSVRFHESDVSWATRWGKY 281
            RVVGV V P S++    D C  +G  L LSET  T+V F+YSV+F  S+  WATRW KY
Sbjct: 256 YRVVGVIVNPYSIKRESPDTCDKTGELLKLSETEATEVHFSYSVKFTPSETVWATRWDKY 315

Query: 282 LHVYDPKVQWYXXXXXXXXXXXXXXXXXXXXFRALKTDLDRYNDFNLDNEFQEDYGWKLL 341
           LHVYDPK+QW+                    +  L  DL RYN  NLD++FQE+ GWKL+
Sbjct: 316 LHVYDPKIQWFSLINFSLVVVFLSTVMIHRLYVTLTDDLSRYNQINLDDDFQEETGWKLI 375

Query: 342 HSDVFRSPSKTLLLSVFVGSGGQLFLMSACTLFIAMLGFLSPSSRGSLGTIMFVLYAIFG 401
           H DVFR+P ++L+LSV VGSG QLFLM+ACT+  A+LG LSPSSRGSL T+MF+LYA+FG
Sbjct: 376 HGDVFRTPERSLILSVLVGSGAQLFLMAACTIGFALLGLLSPSSRGSLTTVMFILYALFG 435

Query: 402 GFGSYLSMSTYKMFGGEKWKVNMVLTPLLVPGIIFATMLLMNFFLVMVQSSGAMPFGTML 461
            FGSY SM+TYK FGG  WKVNM+LTP+LVPG++F  ML +NFFLV+V+S+GA+PFGTM 
Sbjct: 436 SFGSYTSMATYKFFGGPYWKVNMLLTPILVPGLLFCVMLALNFFLVVVESAGAIPFGTMC 495

Query: 462 AIVVLWFVLSIPISIMGSLFARKKNTWDQHPTKTSQIAKQIPPQPWYLRTWPAAYIAGLF 521
            IV+LWF+ SIP+S+ GSL ARKK  WD+HPTKT QI +QIP QPWYL+T PA+ IAG+F
Sbjct: 496 VIVLLWFLFSIPLSVAGSLIARKKCKWDEHPTKTKQIPRQIPFQPWYLKTVPASLIAGIF 555

Query: 522 PFGAIAVELYFIYTSIWXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYYSLCMENWSWQW 581
           PFG+IAVELYFIY+S+W                              YYSLC+ENW WQW
Sbjct: 556 PFGSIAVELYFIYSSLWFNKIFYMFGFLFVSFLLLTLTTSLITVLLTYYSLCLENWKWQW 615

Query: 582 RSFIIGGIGCSTYVFINSILFTKFRLGGFVTIVLYVGYSLLISFLFCLVTGTIGFVSSLW 641
           R F IGG GC+ Y+FI++ILFTKFRLGGF TIVLYVGYSL++S L CL+TGT+GF+SSLW
Sbjct: 616 RGFWIGGAGCALYMFIHAILFTKFRLGGFTTIVLYVGYSLVMSLLSCLITGTVGFLSSLW 675

Query: 642 FVRKIYSSIKVD 653
           FVR+IYSS+KVD
Sbjct: 676 FVRRIYSSVKVD 687

>KLLA0F18931g Chr6 complement(1734636..1736633) [1998 bp, 665 aa]
           {ON} similar to uniprot|P32802 Saccharomyces cerevisiae
           YLR083C EMP70 Protein whose 24kDa cleavage product is
           found in endosome-enriched membrane fractions predicted
           to be a transmembrane protein
          Length = 665

 Score =  747 bits (1928), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 360/646 (55%), Positives = 453/646 (70%), Gaps = 8/646 (1%)

Query: 15  QGFYLPGSAPTTYRRGDAIPLLVNHITPTVFSDDRAGTDGQR--DKERXXXXXXXXXPRL 72
           + FYLPG APTTY  GD +PLLVNH+TP+ F      TD     DKE           + 
Sbjct: 21  EAFYLPGVAPTTYHEGDDLPLLVNHLTPSQFYK-HYDTDQHDTGDKEGFLYSYDYYYKKF 79

Query: 73  HMCRPDKIEKVSESLGSIIFGDRLHNSPFELKMLEEKSCVALCEKTVPAEDAKFINQLIR 132
           H C+P +++K  ESLGSIIFGDR++NSPF+L++L+   C +LC+  +P +DAKFIN+LI 
Sbjct: 80  HFCQPAELKKQPESLGSIIFGDRIYNSPFKLQLLKNVECQSLCKSVIPGKDAKFINKLIL 139

Query: 133 SGFFHNWLVDGLPAGREMHDARTNTVFYGTGFELG--RVIRGTEDRNQEEPGEIELQ--- 187
           +GFF NW++DGLPA R+M D +TN +FYG GFELG   V+   E   +    E+ELQ   
Sbjct: 140 NGFFQNWIIDGLPAARKMEDTKTNKIFYGNGFELGLVDVLSDYEPDTRSLHDELELQLNA 199

Query: 188 TRRVLQPGESVVAVPYFINHFEITVDYHKRAEDELRVVGVSVLPRSLQNPVGDKCANSGN 247
            + VL PG+ V  +PYF+NH++I ++YH R E+  R+VGV+V P S++    D C ++G 
Sbjct: 200 KKNVLSPGDKVTEIPYFVNHYDIQIEYHDRGENNYRIVGVTVNPASIKRDSPDSCESTGK 259

Query: 248 GLVLSETADTKVTFTYSVRFHESDVSWATRWGKYLHVYDPKVQWYXXXXXXXXXXXXXXX 307
            LVLSET D +V FTYSV+F +SD  WATRW KYLHVYDPK+QW+               
Sbjct: 260 SLVLSETEDNEVYFTYSVKFIKSDTVWATRWDKYLHVYDPKIQWFSLINFSTIVVLLSSV 319

Query: 308 XXXXXFRALKTDLDRYNDFNLDNEFQEDYGWKLLHSDVFRSPSKTLLLSVFVGSGGQLFL 367
                + ALK DL RYN+ NLD +F+E+ GWKL+H DVFRSP+K LLLSV VGSGGQL L
Sbjct: 320 MLHSLYSALKNDLARYNELNLDTDFEEETGWKLIHGDVFRSPNKALLLSVLVGSGGQLAL 379

Query: 368 MSACTLFIAMLGFLSPSSRGSLGTIMFVLYAIFGGFGSYLSMSTYKMFGGEKWKVNMVLT 427
           M   T+  A LGFLSPSSRGSL T+MF+LYAIFG FGS+ SM+TYK F G+ W++N+VLT
Sbjct: 380 MLTTTILFACLGFLSPSSRGSLSTVMFLLYAIFGSFGSFTSMATYKFFNGKAWRLNLVLT 439

Query: 428 PLLVPGIIFATMLLMNFFLVMVQSSGAMPFGTMLAIVVLWFVLSIPISIMGSLFARKKNT 487
           PLLVPG I   +L +NFFL+ V SSGA+PF TML +V+LWFV+SIP+S +GS+ A KK  
Sbjct: 440 PLLVPGSILTVVLGLNFFLIFVHSSGAIPFQTMLVLVLLWFVISIPLSAIGSVIAWKKCN 499

Query: 488 WDQHPTKTSQIAKQIPPQPWYLRTWPAAYIAGLFPFGAIAVELYFIYTSIWXXXXXXXXX 547
           W++HPTKT+QIA+QIP QPWYL+T P A +AG+FPFG+IAVELYFIY+S+W         
Sbjct: 500 WNEHPTKTNQIARQIPFQPWYLKTIPVALLAGIFPFGSIAVELYFIYSSLWFNKIYYMFG 559

Query: 548 XXXXXXXXXXXXXXXXXXXXXYYSLCMENWSWQWRSFIIGGIGCSTYVFINSILFTKFRL 607
                                Y+SLCMENW WQWRSF+IGG GC+ YVF +SILFTKFRL
Sbjct: 560 FLFFSFILLALTTSLITVLLTYHSLCMENWKWQWRSFVIGGCGCAFYVFCHSILFTKFRL 619

Query: 608 GGFVTIVLYVGYSLLISFLFCLVTGTIGFVSSLWFVRKIYSSIKVD 653
           GG  TIVLY+GYS+LIS L CLVTG IGF+SSL  VRKIYS +KVD
Sbjct: 620 GGLTTIVLYLGYSILISGLCCLVTGAIGFLSSLILVRKIYSCVKVD 665

>Smik_12.142 Chr12 complement(273932..275923) [1992 bp, 663 aa] {ON}
           YLR083C (REAL)
          Length = 663

 Score =  740 bits (1911), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 363/651 (55%), Positives = 445/651 (68%), Gaps = 16/651 (2%)

Query: 15  QGFYLPGSAPTTYRRGDAIPLLVNHITPTVF--SDDRAGTDGQRDKERXXXXXXXXXPRL 72
           + FYLPG APTTY+  D IPLLVNH+TP+++    D  G +   DKE           R 
Sbjct: 17  KAFYLPGVAPTTYKENDEIPLLVNHLTPSMYYQHKDEEGNNVSGDKENFLYSYDYYNSRF 76

Query: 73  HMCRPDKIEKVSESLGSIIFGDRLHNSPFELKMLEEKSCVALCEKTVPAEDAKFINQLIR 132
           H C+P+K+EK  ESLGSIIFGDR++NSPF+LKMLEEK CV+LC+KT+P  DAKFIN+LI+
Sbjct: 77  HFCKPEKVEKQPESLGSIIFGDRIYNSPFQLKMLEEKECVSLCKKTIPGNDAKFINKLIK 136

Query: 133 SGFFHNWLVDGLPAGREMHDARTNTVFYGTGFELG--RVIRGTEDRNQEEPGE-----IE 185
           +GFF NWL+DGLPA R + D RT T FYG GFELG   V +GT         E     +E
Sbjct: 137 NGFFQNWLIDGLPAARNVSDKRTKTSFYGAGFELGFVEVTQGTASEATPNTAETTNQGVE 196

Query: 186 LQTRRVLQPGESVVAV---PYFINHFEITVDYHKRAEDELRVVGVSVLPRSLQNPVGDKC 242
           L TR     G ++V     PYF NH++I ++YH R E   RVVGV V P S++    + C
Sbjct: 197 LDTRD----GHNMVQTYEHPYFTNHYDIRIEYHDRGEGNYRVVGVIVNPVSIKRSDPETC 252

Query: 243 ANSGNGLVLSETADTKVTFTYSVRFHESDVSWATRWGKYLHVYDPKVQWYXXXXXXXXXX 302
              G+ L+L E  D +V FTYSV+F ES+ SWATRW KYLHVYDP +QW+          
Sbjct: 253 ETDGSPLMLDEENDNEVYFTYSVKFVESETSWATRWDKYLHVYDPSIQWFSLINFSLVVV 312

Query: 303 XXXXXXXXXXFRALKTDLDRYNDFNLDNEFQEDYGWKLLHSDVFRSPSKTLLLSVFVGSG 362
                      RALK+D  RYN+ NLD++FQED GWKL H DVFR+PS++L LS+ VGSG
Sbjct: 313 LLSSVVIHSLLRALKSDFARYNELNLDDDFQEDSGWKLSHGDVFRAPSRSLTLSILVGSG 372

Query: 363 GQLFLMSACTLFIAMLGFLSPSSRGSLGTIMFVLYAIFGGFGSYLSMSTYKMFGGEKWKV 422
            QLF M  C++F A LGFLSPSSRGSL T+MF+LYA+FG  GSY SM  YK F G  WK 
Sbjct: 373 VQLFFMVTCSIFFAALGFLSPSSRGSLATVMFMLYALFGFVGSYTSMGIYKFFDGPYWKA 432

Query: 423 NMVLTPLLVPGIIFATMLLMNFFLVMVQSSGAMPFGTMLAIVVLWFVLSIPISIMGSLFA 482
           N++LTPLLVPG I   ++ +NFFL+ V SSG +P  T+  +V LWF+ SIP+S  GSL A
Sbjct: 433 NLILTPLLVPGTILIIIIALNFFLMFVHSSGVIPASTLFFMVFLWFLFSIPLSFAGSLVA 492

Query: 483 RKKNTWDQHPTKTSQIAKQIPPQPWYLRTWPAAYIAGLFPFGAIAVELYFIYTSIWXXXX 542
           RKK  WD+HPTKT+QIA+QIP QPWYL+T PA  IAG+FPFG+IAVELYFIYTS+W    
Sbjct: 493 RKKCHWDEHPTKTNQIARQIPFQPWYLKTVPATLIAGVFPFGSIAVELYFIYTSLWFNKI 552

Query: 543 XXXXXXXXXXXXXXXXXXXXXXXXXXYYSLCMENWSWQWRSFIIGGIGCSTYVFINSILF 602
                                     Y+SLC+ENW WQWR FI+GG GC+ YVFI+SILF
Sbjct: 553 FYMFGFLFFSFLLLTLTTSLVTILITYHSLCLENWKWQWRGFIVGGAGCALYVFIHSILF 612

Query: 603 TKFRLGGFVTIVLYVGYSLLISFLFCLVTGTIGFVSSLWFVRKIYSSIKVD 653
           TKF+LGGF TIVLYVGYS +IS L CLVTG+IGF+SS++F+RKIYSSIKVD
Sbjct: 613 TKFKLGGFTTIVLYVGYSSVISLLCCLVTGSIGFISSMFFIRKIYSSIKVD 663

>ZYRO0C01848g Chr3 (146621..148564) [1944 bp, 647 aa] {ON} similar
           to uniprot|P32802 Saccharomyces cerevisiae YLR083C EMP70
           Protein whose 24kDa cleavage product is found in
           endosome-enriched membrane fractions predicted to be a
           transmembrane protein
          Length = 647

 Score =  737 bits (1903), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 357/643 (55%), Positives = 444/643 (69%), Gaps = 16/643 (2%)

Query: 15  QGFYLPGSAPTTYRRGDAIPLLVNHITPTVF--SDDRAGTDGQRDKERXXXXXXXXXPRL 72
           + FYLPG APTTY   D I LLVNH+TP++    +D  G   + DKE           + 
Sbjct: 17  KAFYLPGVAPTTYHSNDEIQLLVNHLTPSMNFQHEDEDGNMVKGDKEHYLYSYDYYYSKF 76

Query: 73  HMCRPDKIEKVSESLGSIIFGDRLHNSPFELKMLEEKSCVALCEKTVPAEDAKFINQLIR 132
           H C+P+ + +   SLGS+IFGDR+ NSPF+L MLEEK CV LC   +P EDAKF+N+LI+
Sbjct: 77  HFCKPENVVRQPASLGSVIFGDRIFNSPFKLNMLEEKECVPLCSSRIPGEDAKFVNKLIK 136

Query: 133 SGFFHNWLVDGLPAGREMHDARTNTVFYGTGFELG--RVIRGTEDRNQEEPGEIELQTRR 190
           +GF  NWL+DGLPAGRE+HD+RTN+ FYGTGF+LG   V  G  D N EE        ++
Sbjct: 137 NGFMQNWLIDGLPAGREIHDSRTNSNFYGTGFQLGFVDVTEGFSDSNDEE--------KK 188

Query: 191 VLQPGESVVAVPYFINHFEITVDYHKRAEDELRVVGVSVLPRSLQNPVGDKCANSGNGLV 250
           +++  E    VPY  NH++I ++YH R  D  RVVGV+V P S++    D C  +   L 
Sbjct: 189 IMKTLE----VPYLANHYDINIEYHDRGNDNYRVVGVTVDPVSIKRSSSDSCQYNSGSLT 244

Query: 251 LSETADTKVTFTYSVRFHESDVSWATRWGKYLHVYDPKVQWYXXXXXXXXXXXXXXXXXX 310
           LSET + +V FTYSV+F +SD  WATRW KYLHVYDP +QW+                  
Sbjct: 245 LSETEENEVHFTYSVKFIKSDTVWATRWDKYLHVYDPTIQWFSLINCSVIVVALSSVVLH 304

Query: 311 XXFRALKTDLDRYNDFNLDNEFQEDYGWKLLHSDVFRSPSKTLLLSVFVGSGGQLFLMSA 370
              RALK DL RYN+FNLDNEF ED GWKL H DVFR P ++LLLS+ VGSG QLFLM A
Sbjct: 305 MLLRALKNDLSRYNEFNLDNEFHEDSGWKLSHGDVFRIPPRSLLLSILVGSGVQLFLMIA 364

Query: 371 CTLFIAMLGFLSPSSRGSLGTIMFVLYAIFGGFGSYLSMSTYKMFGGEKWKVNMVLTPLL 430
           C++  A LGFLSPSSRGSL T+MF+LYA+FG  GSY SM+ YK F G  WKVN++LTP+L
Sbjct: 365 CSIIFAALGFLSPSSRGSLPTVMFLLYALFGFVGSYTSMAIYKFFKGPLWKVNLLLTPVL 424

Query: 431 VPGIIFATMLLMNFFLVMVQSSGAMPFGTMLAIVVLWFVLSIPISIMGSLFARKKNTWDQ 490
           VPG IF T++L+NFFLV V+SSGA+P GT+  I++LWFV SIP+S  GSL A K+   D 
Sbjct: 425 VPGGIFVTIILLNFFLVFVRSSGAIPAGTLFTIILLWFVFSIPLSFAGSLIAHKRCRLDN 484

Query: 491 HPTKTSQIAKQIPPQPWYLRTWPAAYIAGLFPFGAIAVELYFIYTSIWXXXXXXXXXXXX 550
           HPTKT+QIA+QIP QPWYL+T P + IAG+FPF +IAVELYFIYTS+W            
Sbjct: 485 HPTKTNQIARQIPIQPWYLKTIPVSLIAGVFPFASIAVELYFIYTSLWFNKIFYMFGFLL 544

Query: 551 XXXXXXXXXXXXXXXXXXYYSLCMENWSWQWRSFIIGGIGCSTYVFINSILFTKFRLGGF 610
                             Y+SLC+ENW WQWRSFIIGG GC+ YVFI+SILFTKF+LGGF
Sbjct: 545 FSFLLLTFTTALVTILTTYHSLCLENWKWQWRSFIIGGCGCAIYVFIHSILFTKFKLGGF 604

Query: 611 VTIVLYVGYSLLISFLFCLVTGTIGFVSSLWFVRKIYSSIKVD 653
            T+VLY+GYS LIS L C+VTG+IGF+SS++F+RKIYSS+KVD
Sbjct: 605 TTVVLYLGYSGLISVLCCIVTGSIGFISSMFFIRKIYSSVKVD 647

>Kwal_56.23577 s56 complement(605281..607332) [2052 bp, 683 aa] {ON}
           YLR083C (EMP70) - endosomal membrane protein [contig
           176] FULL
          Length = 683

 Score =  738 bits (1904), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 367/668 (54%), Positives = 460/668 (68%), Gaps = 31/668 (4%)

Query: 15  QGFYLPGSAPTTYRRGDAIPLLVNHITPTVF---SDDRAGTDGQRDKERXXXXXXXXXPR 71
           +GFYLPG APTTY  GD+IPLLVNH+TP+++    DD     G  D+E           +
Sbjct: 18  EGFYLPGVAPTTYHEGDSIPLLVNHLTPSMYFKHVDDDGKDTG--DRESFLYSYDYYYDK 75

Query: 72  LHMCRPDKIEKVSESLGSIIFGDRLHNSPFELKMLEEKSCVALCEKTVPAEDAKFINQLI 131
            H C+P+K+EK  ESLGSIIFGDR++NSPF+L+ML++K C ALC   +PA DAKFIN+LI
Sbjct: 76  FHFCKPEKLEKQRESLGSIIFGDRIYNSPFKLEMLKDKECEALCSSKIPANDAKFINKLI 135

Query: 132 RSGFFHNWLVDGLPAGREMHDARTNTVFYGTGFELGRVIRG------------------- 172
            +GFF NWLVDGLPA R+  D RT + FY  GFELG +  G                   
Sbjct: 136 ANGFFQNWLVDGLPAARKTTDERTKSEFYTPGFELGFIDVGGAKLRMDGQGEEDAHPKGA 195

Query: 173 ----TEDRNQEEPGEIELQTRR-VLQPGESV--VAVPYFINHFEITVDYHKRAEDELRVV 225
                +D   + P + + + R+ ++ P E V  +   YF NHF I V YH R   + RVV
Sbjct: 196 TKPVAQDDYLDRPSKSKNEKRKKIVDPKELVKQLETAYFANHFNIEVQYHDRGNGDYRVV 255

Query: 226 GVSVLPRSLQNPVGDKCANSGNGLVLSETADTKVTFTYSVRFHESDVSWATRWGKYLHVY 285
           GV V P+S++    + CA +G  L LSE  +T V F+YSV+F  SD  WATRW KYLHVY
Sbjct: 256 GVIVNPQSIKRDSSNSCAATGELLKLSEEEETTVHFSYSVKFTPSDTVWATRWDKYLHVY 315

Query: 286 DPKVQWYXXXXXXXXXXXXXXXXXXXXFRALKTDLDRYNDFNLDNEFQEDYGWKLLHSDV 345
           DPK+QWY                    +R L+ DL RYN  NLD++FQE+ GWKL+H DV
Sbjct: 316 DPKIQWYSLINFSIVVIVLSSVVIHSLYRTLRDDLSRYNQLNLDDDFQEETGWKLVHGDV 375

Query: 346 FRSPSKTLLLSVFVGSGGQLFLMSACTLFIAMLGFLSPSSRGSLGTIMFVLYAIFGGFGS 405
           FR+P+K+LLLSV VGSG QLF+M+ACT+  A+LG LSPSSRGSL T+MF+LYA+FG  GS
Sbjct: 376 FRTPTKSLLLSVLVGSGTQLFVMAACTIAFALLGLLSPSSRGSLTTVMFILYALFGSLGS 435

Query: 406 YLSMSTYKMFGGEKWKVNMVLTPLLVPGIIFATMLLMNFFLVMVQSSGAMPFGTMLAIVV 465
           Y SM+TYK FGGE WKVNM+LTP+LVPG++F  +L +NFFL+MV+S+GA+PFGTM AIV+
Sbjct: 436 YTSMATYKFFGGEYWKVNMILTPILVPGLLFCVVLGLNFFLIMVESAGAIPFGTMCAIVL 495

Query: 466 LWFVLSIPISIMGSLFARKKNTWDQHPTKTSQIAKQIPPQPWYLRTWPAAYIAGLFPFGA 525
           LWFV SIP+S+ GSL A+KK  W++HPTKT QI +QIP QPWYL+T PAA IAG+FPFG+
Sbjct: 496 LWFVFSIPLSLAGSLIAKKKCRWNEHPTKTRQIPRQIPFQPWYLKTAPAALIAGIFPFGS 555

Query: 526 IAVELYFIYTSIWXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYYSLCMENWSWQWRSFI 585
           IAVELYF+Y+S+W                              YYSLC+ENW WQWR F 
Sbjct: 556 IAVELYFVYSSLWFNKIFYMFGFLFVSFLLLTLTTALVTVLLTYYSLCLENWKWQWRGFW 615

Query: 586 IGGIGCSTYVFINSILFTKFRLGGFVTIVLYVGYSLLISFLFCLVTGTIGFVSSLWFVRK 645
           IGG GC+ YVF+++ILFTKF+LGGFVTIVLYVGYSL+IS L CL+TG +GF+SSLWFVR+
Sbjct: 616 IGGAGCALYVFLHAILFTKFKLGGFVTIVLYVGYSLVISLLTCLITGAVGFMSSLWFVRR 675

Query: 646 IYSSIKVD 653
           IYSSIKVD
Sbjct: 676 IYSSIKVD 683

>Skud_12.151 Chr12 complement(277467..279461) [1995 bp, 664 aa] {ON}
           YLR083C (REAL)
          Length = 664

 Score =  736 bits (1900), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 359/648 (55%), Positives = 441/648 (68%), Gaps = 9/648 (1%)

Query: 15  QGFYLPGSAPTTYRRGDAIPLLVNHITPTVF--SDDRAGTDGQRDKERXXXXXXXXXPRL 72
           + FYLPG APTTY+  D IPLLVNH+TP+++   +D  G     DKE           R 
Sbjct: 17  KAFYLPGVAPTTYKENDEIPLLVNHLTPSMYYQHEDEQGNSVSGDKENFLYSYDYYYDRF 76

Query: 73  HMCRPDKIEKVSESLGSIIFGDRLHNSPFELKMLEEKSCVALCEKTVPAEDAKFINQLIR 132
           H CRP  +EK  ESLGS+IFGDR++NSPFEL ML+EK CV LC  T+P  DAKFIN+LI+
Sbjct: 77  HFCRPKHVEKQPESLGSVIFGDRIYNSPFELNMLQEKECVPLCNTTIPGNDAKFINKLIK 136

Query: 133 SGFFHNWLVDGLPAGREMHDARTNTVFYGTGFELG--RVIRGTEDRNQEEPGE-----IE 185
           +GFF NWL+DGLPA RE++D RT T FYG GFELG   V +GT  +   +  E     +E
Sbjct: 137 NGFFQNWLIDGLPAAREVYDGRTKTNFYGAGFELGDVEVSQGTRSKTAPKQAETTNEGLE 196

Query: 186 LQTRRVLQPGESVVAVPYFINHFEITVDYHKRAEDELRVVGVSVLPRSLQNPVGDKCANS 245
           L TR            PYF NHF+I ++YH R   + RVVGV V P S++  +   C   
Sbjct: 197 LGTRAEDYSIVETFEHPYFANHFDIMIEYHDRGGGDYRVVGVIVNPLSIKRSITGTCETD 256

Query: 246 GNGLVLSETADTKVTFTYSVRFHESDVSWATRWGKYLHVYDPKVQWYXXXXXXXXXXXXX 305
            + L+L E  D +V+FTYSV+F ES  SWATRW KYLHVYDP +QW+             
Sbjct: 257 ASPLILDEERDNEVSFTYSVKFKESATSWATRWDKYLHVYDPSIQWFSLINFSLVVVLLS 316

Query: 306 XXXXXXXFRALKTDLDRYNDFNLDNEFQEDYGWKLLHSDVFRSPSKTLLLSVFVGSGGQL 365
                   RALK+D  RYN+ NL+++FQED GWKL H DVFR PS +LLLS+ VGSG QL
Sbjct: 317 SVVIHSLLRALKSDFARYNELNLEDDFQEDSGWKLNHGDVFRPPSHSLLLSILVGSGVQL 376

Query: 366 FLMSACTLFIAMLGFLSPSSRGSLGTIMFVLYAIFGGFGSYLSMSTYKMFGGEKWKVNMV 425
           FLM  C++F A LGFLSPSSRGSL T+MF+LYA+FG  GSY SM  YK F G  WK N++
Sbjct: 377 FLMVTCSIFFAALGFLSPSSRGSLATVMFILYALFGFVGSYTSMGIYKFFNGPYWKANLL 436

Query: 426 LTPLLVPGIIFATMLLMNFFLVMVQSSGAMPFGTMLAIVVLWFVLSIPISIMGSLFARKK 485
           LTPLLVPG I   ++ +NFFL++V SSG +P  T+  +V LWF+ SIP+S  GSL ARKK
Sbjct: 437 LTPLLVPGAILLIIVALNFFLMVVHSSGVIPARTLFFMVFLWFLFSIPLSFGGSLIARKK 496

Query: 486 NTWDQHPTKTSQIAKQIPPQPWYLRTWPAAYIAGLFPFGAIAVELYFIYTSIWXXXXXXX 545
             WD+HPTKT+QIA+QIP QPWYL+T PA  IAG+FPFG+IAVELYFIYTS+W       
Sbjct: 497 CGWDEHPTKTNQIARQIPFQPWYLKTIPATLIAGIFPFGSIAVELYFIYTSLWFNKIFYM 556

Query: 546 XXXXXXXXXXXXXXXXXXXXXXXYYSLCMENWSWQWRSFIIGGIGCSTYVFINSILFTKF 605
                                  Y+SLC+ENW WQWR FI+GG+GC+ YVFI+SILFTKF
Sbjct: 557 FGFLFFSFLLLTLTTSLVTILITYHSLCLENWKWQWRGFIVGGVGCALYVFIHSILFTKF 616

Query: 606 RLGGFVTIVLYVGYSLLISFLFCLVTGTIGFVSSLWFVRKIYSSIKVD 653
           +LGGFVTIVLYVGYS +IS L CLVTG+IGF+SS++F+R+IYSSIKVD
Sbjct: 617 KLGGFVTIVLYVGYSYVISLLCCLVTGSIGFISSMFFLRRIYSSIKVD 664

>YLR083C Chr12 complement(294091..296094) [2004 bp, 667 aa] {ON}
           EMP70Protein with a role in cellular adhesion,
           filamentous growth, and endosome-to-vacuole sorting;
           similar to Tmn2p and Tmn3p; member of Transmembrane Nine
           family of proteins with 9 transmembrane segments
          Length = 667

 Score =  735 bits (1897), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 360/648 (55%), Positives = 445/648 (68%), Gaps = 10/648 (1%)

Query: 15  QGFYLPGSAPTTYRRGDAIPLLVNHITPTVF--SDDRAGTDGQRDKERXXXXXXXXXPRL 72
           + FYLPG APTTYR  D IPLLVNH+TP++     D  G +   DKE           R 
Sbjct: 21  KAFYLPGVAPTTYRENDNIPLLVNHLTPSMNYQHKDEDGNNVSGDKENFLYSYDYYYNRF 80

Query: 73  HMCRPDKIEKVSESLGSIIFGDRLHNSPFELKMLEEKSCVALCEKTVPAEDAKFINQLIR 132
           H C+P+K+EK  ESLGS+IFGDR++NSPF+L ML+EK C +LC+  +P +DAKFIN+LI+
Sbjct: 81  HFCQPEKVEKQPESLGSVIFGDRIYNSPFQLNMLQEKECESLCKTVIPGDDAKFINKLIK 140

Query: 133 SGFFHNWLVDGLPAGREMHDARTNTVFYGTGFELG--RVIRGTEDRNQEEPGE-----IE 185
           +GFF NWL+DGLPA RE++D RT T FYG GF LG  +V +GT+     +  E     +E
Sbjct: 141 NGFFQNWLIDGLPAAREVYDGRTKTSFYGAGFNLGFVQVTQGTDIEATPKGAETTDKDVE 200

Query: 186 LQTRRVLQPGESVVAVPYFINHFEITVDYHKRAEDELRVVGVSVLPRSLQNPVGDKCANS 245
           L+TR      ++   +PYF NHF+I ++YH R E   RVVGV V P S++      C  +
Sbjct: 201 LETRNDRNMVKTY-ELPYFANHFDIMIEYHDRGEGNYRVVGVIVEPVSIKRSSPGTCETT 259

Query: 246 GNGLVLSETADTKVTFTYSVRFHESDVSWATRWGKYLHVYDPKVQWYXXXXXXXXXXXXX 305
           G+ L+L E  D +V FTYSV+F+ES  SWATRW KYLHVYDP +QW+             
Sbjct: 260 GSPLMLDEGNDNEVYFTYSVKFNESATSWATRWDKYLHVYDPSIQWFSLINFSLVVVLLS 319

Query: 306 XXXXXXXFRALKTDLDRYNDFNLDNEFQEDYGWKLLHSDVFRSPSKTLLLSVFVGSGGQL 365
                   RALK+D  RYN+ NLD++FQED GWKL H DVFRSPS++L LS+ VGSG QL
Sbjct: 320 SVVIHSLLRALKSDFARYNELNLDDDFQEDSGWKLNHGDVFRSPSQSLTLSILVGSGVQL 379

Query: 366 FLMSACTLFIAMLGFLSPSSRGSLGTIMFVLYAIFGGFGSYLSMSTYKMFGGEKWKVNMV 425
           FLM  C++F A LGFLSPSSRGSL T+MF+LYA+FG  GSY SM  YK F G  WK N++
Sbjct: 380 FLMVTCSIFFAALGFLSPSSRGSLATVMFILYALFGFVGSYTSMGIYKFFNGPYWKANLI 439

Query: 426 LTPLLVPGIIFATMLLMNFFLVMVQSSGAMPFGTMLAIVVLWFVLSIPISIMGSLFARKK 485
           LTPLLVPG I   ++ +NFFL+ V SSG +P  T+  +V LWF+ SIP+S  GSL ARK+
Sbjct: 440 LTPLLVPGAILLIIIALNFFLMFVHSSGVIPASTLFFMVFLWFLFSIPLSFAGSLIARKR 499

Query: 486 NTWDQHPTKTSQIAKQIPPQPWYLRTWPAAYIAGLFPFGAIAVELYFIYTSIWXXXXXXX 545
             WD+HPTKT+QIA+QIP QPWYL+T PA  IAG+FPFG+IAVELYFIYTS+W       
Sbjct: 500 CHWDEHPTKTNQIARQIPFQPWYLKTIPATLIAGIFPFGSIAVELYFIYTSLWFNKIFYM 559

Query: 546 XXXXXXXXXXXXXXXXXXXXXXXYYSLCMENWSWQWRSFIIGGIGCSTYVFINSILFTKF 605
                                  Y+SLC+ENW WQWR FIIGG GC+ YVFI+SILFTKF
Sbjct: 560 FGFLFFSFLLLTLTSSLVTILITYHSLCLENWKWQWRGFIIGGAGCALYVFIHSILFTKF 619

Query: 606 RLGGFVTIVLYVGYSLLISFLFCLVTGTIGFVSSLWFVRKIYSSIKVD 653
           +LGGF TIVLYVGYS +IS L CLVTG+IGF+SS+ FVRKIYSSIKVD
Sbjct: 620 KLGGFTTIVLYVGYSSVISLLCCLVTGSIGFISSMLFVRKIYSSIKVD 667

>NDAI0B02370 Chr2 complement(593012..595180) [2169 bp, 722 aa] {ON}
           Anc_8.254
          Length = 722

 Score =  736 bits (1899), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 360/656 (54%), Positives = 458/656 (69%), Gaps = 21/656 (3%)

Query: 15  QGFYLPGSAPTTYRRGDAIPLLVNHITPTVF--SDDRAGTDGQRDKERXXXXXXXXXPRL 72
           + FYLPG APTTY   D IPLLVNH+TP+++    +  G   + DKER          R 
Sbjct: 71  RAFYLPGVAPTTYHPDDEIPLLVNHLTPSMYFQHKNEDGKTMKSDKERFLYSYDYYYDRF 130

Query: 73  HMCRPDKIEKVSESLGSIIFGDRLHNSPFELKMLEEKSCVALCEKTVPAEDAKFINQLIR 132
           H C+P+ IEK  ESLGSIIFGDR++NSPF++ ML++K+CV+LC+ T+P +DAKFIN+LI+
Sbjct: 131 HFCQPEHIEKQPESLGSIIFGDRIYNSPFQINMLQDKTCVSLCKTTIPGKDAKFINKLIK 190

Query: 133 SGFFHNWLVDGLPAGREMHDARTNTVFYGTGFELG--RVIRGTEDRNQ-----EEPGE-- 183
           +GFF NWL+DGLPA R+++D+RT T FYGTGFELG   V++GT   +      ++P    
Sbjct: 191 NGFFQNWLIDGLPAARQVYDSRTKTEFYGTGFELGFVDVVQGTTTGDNANTVAKKPTTNE 250

Query: 184 -IELQTR-----RVLQPGESVVAVPYFINHFEITVDYHKRAEDELRVVGVSVLPRSLQNP 237
            +EL TR     ++L+  E    +PYF NHF+I V+YH R E+  RVVGV V P S++  
Sbjct: 251 GLELDTRDAKNVQMLKNFE----LPYFANHFDIQVEYHDRGENNYRVVGVIVNPVSIKRS 306

Query: 238 VGDKCANSGNGLVLSETADTKVTFTYSVRFHESDVSWATRWGKYLHVYDPKVQWYXXXXX 297
               C  SG  L+LSE  D  V FTYSV+F  S+  WATRW KYLH+YDP +QW+     
Sbjct: 307 TPGTCETSGAPLMLSEDQDNDVYFTYSVKFIPSETIWATRWDKYLHIYDPAIQWFSLINF 366

Query: 298 XXXXXXXXXXXXXXXFRALKTDLDRYNDFNLDNEFQEDYGWKLLHSDVFRSPSKTLLLSV 357
                           +ALK+D  RYN+ NLD++FQE+ GWKL H DVFR P ++LLLSV
Sbjct: 367 SVVVLLLSSVVIHSLLKALKSDFARYNELNLDDDFQEEAGWKLGHGDVFRIPHRSLLLSV 426

Query: 358 FVGSGGQLFLMSACTLFIAMLGFLSPSSRGSLGTIMFVLYAIFGGFGSYLSMSTYKMFGG 417
            VGSG QLFLM  C++F A LGFLSPSSRGSL T+MF+LYA+FG  GSY SM  YK FGG
Sbjct: 427 LVGSGVQLFLMIICSIFFAALGFLSPSSRGSLATVMFILYALFGFVGSYTSMGVYKFFGG 486

Query: 418 EKWKVNMVLTPLLVPGIIFATMLLMNFFLVMVQSSGAMPFGTMLAIVVLWFVLSIPISIM 477
             WKVNM+LTP+LVPG+IF  ++ +N FL+ V SSG +P  T+  +++LWFV SIP+++ 
Sbjct: 487 PYWKVNMLLTPILVPGLIFCGIVALNIFLLFVHSSGVIPAVTLFFMILLWFVFSIPLALA 546

Query: 478 GSLFARKKNTWDQHPTKTSQIAKQIPPQPWYLRTWPAAYIAGLFPFGAIAVELYFIYTSI 537
           GSL A KK  WD+HPTKT+QIA+QIP QPWYL+TWPA  IAG+FPFG+IAVELYFIY+S+
Sbjct: 547 GSLIAHKKCNWDEHPTKTNQIARQIPFQPWYLKTWPATLIAGIFPFGSIAVELYFIYSSL 606

Query: 538 WXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYYSLCMENWSWQWRSFIIGGIGCSTYVFI 597
           W                              Y+SLC+ENW WQWR FIIGG+GC+ YVFI
Sbjct: 607 WFNKIFYMFGFLLFSFFLLTLTTSLVTILITYHSLCLENWMWQWRGFIIGGVGCAIYVFI 666

Query: 598 NSILFTKFRLGGFVTIVLYVGYSLLISFLFCLVTGTIGFVSSLWFVRKIYSSIKVD 653
           +SILFTKF+LGGF TIVLYVGYS +IS LFC+VTG IGF+SS++F+RKIYSSIKV+
Sbjct: 667 HSILFTKFKLGGFTTIVLYVGYSTIISLLFCIVTGAIGFLSSMFFIRKIYSSIKVE 722

>KAFR0B02680 Chr2 complement(537048..539042) [1995 bp, 664 aa] {ON}
           Anc_8.254 YLR083C
          Length = 664

 Score =  730 bits (1885), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 356/650 (54%), Positives = 447/650 (68%), Gaps = 12/650 (1%)

Query: 15  QGFYLPGSAPTTYRRGDAIPLLVNHITPTVF--SDDRAGTDGQRDKERXXXXXXXXXPRL 72
           + FYLPG APTTY  GD IPLLVNH++P+++    +  G D   DK +          R 
Sbjct: 16  RAFYLPGVAPTTYHEGDEIPLLVNHLSPSMYWQHKNDEGKDVSSDKNKYLYSYDYYYDRF 75

Query: 73  HMCRPDKIEKVSESLGSIIFGDRLHNSPFELKMLEEKSCVALCEKTVPAEDAKFINQLIR 132
           H C+P+KIEK  ESLGSI+FGDR++NSPF+L MLEEK C +LC+ T+P  DAKFIN+LI+
Sbjct: 76  HFCQPEKIEKQPESLGSIMFGDRIYNSPFQLNMLEEKQCASLCKSTIPGNDAKFINKLIK 135

Query: 133 SGFFHNWLVDGLPAGREMHDARTNTVFYGTGFELGRV-----IRGTEDRNQ----EEPGE 183
           +GFF NWL+DGLPA  E HD RT T FYG+GFELG V     +  TE R +     +  E
Sbjct: 136 NGFFQNWLIDGLPAAHEAHDTRTGTDFYGSGFELGLVDVVQAVDETEARTKVAAANQGAE 195

Query: 184 IELQTRRVLQPGESVVAVPYFINHFEITVDYHKRAEDELRVVGVSVLPRSLQNPVGDKCA 243
           ++ +  + ++  ++V  V YF+NH++I ++YH R   + RVVGV V P S+Q      C 
Sbjct: 196 LDARDAKNVKTIKNVELV-YFVNHYDIRIEYHDRGNGDYRVVGVIVNPVSIQRSSPGSCE 254

Query: 244 NSGNGLVLSETADTKVTFTYSVRFHESDVSWATRWGKYLHVYDPKVQWYXXXXXXXXXXX 303
           ++G  L L E  D  V FTYSV F  S+ SWATRW KYLHVYDP +QW+           
Sbjct: 255 STGQPLTLQEDEDNDVYFTYSVTFVPSETSWATRWDKYLHVYDPTIQWFSLVNFSLIVLL 314

Query: 304 XXXXXXXXXFRALKTDLDRYNDFNLDNEFQEDYGWKLLHSDVFRSPSKTLLLSVFVGSGG 363
                     +ALK D  RYN+FNLD+EFQED GWKL H DVFR P K++LLSV VGSG 
Sbjct: 315 LSTVVLHSLLKALKNDFARYNEFNLDDEFQEDAGWKLCHGDVFRIPHKSMLLSVLVGSGV 374

Query: 364 QLFLMSACTLFIAMLGFLSPSSRGSLGTIMFVLYAIFGGFGSYLSMSTYKMFGGEKWKVN 423
           QLF+M + T+F A LGFLSPSSRG LGT+MF+LYA+FG  GSY SM  YK F G  WK N
Sbjct: 375 QLFIMISTTIFFAALGFLSPSSRGLLGTVMFMLYALFGFVGSYTSMGVYKFFRGPYWKAN 434

Query: 424 MVLTPLLVPGIIFATMLLMNFFLVMVQSSGAMPFGTMLAIVVLWFVLSIPISIMGSLFAR 483
           MVLTP+LVPG IF T++ MNFFL+ V SSG +P  T+  +V+LWFV SIP +  GSL A 
Sbjct: 435 MVLTPILVPGSIFITIIAMNFFLMYVHSSGVIPAKTLFFMVLLWFVFSIPSAFAGSLVAN 494

Query: 484 KKNTWDQHPTKTSQIAKQIPPQPWYLRTWPAAYIAGLFPFGAIAVELYFIYTSIWXXXXX 543
           KK  W++HPTKT QIA+QIP QPWYL+T PA +IAG+FPFG+IAVE+YFIYTS+W     
Sbjct: 495 KKCNWNEHPTKTEQIARQIPFQPWYLKTIPATFIAGIFPFGSIAVEIYFIYTSLWYNKIF 554

Query: 544 XXXXXXXXXXXXXXXXXXXXXXXXXYYSLCMENWSWQWRSFIIGGIGCSTYVFINSILFT 603
                                    Y+SLC+ENW+WQWRSFI+GG+GC+ YVFI+SILFT
Sbjct: 555 YMFGFLFVSLLLLALTTSLVTVLITYHSLCLENWNWQWRSFIVGGVGCAIYVFIHSILFT 614

Query: 604 KFRLGGFVTIVLYVGYSLLISFLFCLVTGTIGFVSSLWFVRKIYSSIKVD 653
           KF+LGGF T+VLY+GYS +IS L C+VTG+IGF+SS++FVRKI+SSIKVD
Sbjct: 615 KFKLGGFTTVVLYLGYSSIISLLCCIVTGSIGFLSSMFFVRKIFSSIKVD 664

>Suva_10.167 Chr10 complement(299075..301129) [2055 bp, 684 aa] {ON}
           YLR083C (REAL)
          Length = 684

 Score =  729 bits (1883), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 354/668 (52%), Positives = 443/668 (66%), Gaps = 29/668 (4%)

Query: 15  QGFYLPGSAPTTYRRGDAIPLLVNHITPTVF--SDDRAGTDGQRDKERXXXXXXXXXPRL 72
           + FYLPG APTTY+  D IPLLVNH+TP+++    D  G +   DKE           + 
Sbjct: 17  RAFYLPGVAPTTYKENDEIPLLVNHLTPSMYYQHQDEDGNNVSGDKEHFLYSYDYYYDKF 76

Query: 73  HMCRPDKIEKVSESLGSIIFGDRLHNSPFELKMLEEKSCVALCEKTVPAEDAKFINQLIR 132
           H C+P+ +EK  ESLGSIIFGDR++NSPFEL ML+EK CV+LC+  +P +DAKFIN+LI+
Sbjct: 77  HFCKPEHVEKQPESLGSIIFGDRIYNSPFELNMLQEKECVSLCKTVIPGDDAKFINKLIK 136

Query: 133 SGFFHNWLVDGLPAGREMHDARTNTVFYGTGFELG---------------RVIRGTEDRN 177
           +GFF NWL+DGLPA RE+HD RT T FYG GF LG               +V  G  ++ 
Sbjct: 137 NGFFQNWLIDGLPAAREVHDGRTKTDFYGAGFGLGFVEVAQVVDSETEQVQVASGETEQT 196

Query: 178 QEEPGEIELQTRRVLQPGESVVA------------VPYFINHFEITVDYHKRAEDELRVV 225
           Q   G+ E +  +    G  + A             PYF NHF+I ++YH R E   RVV
Sbjct: 197 QAADGKTEPEKGKSSNEGMELDARDQGKNMVKTREFPYFANHFDIKIEYHDRGEGNYRVV 256

Query: 226 GVSVLPRSLQNPVGDKCANSGNGLVLSETADTKVTFTYSVRFHESDVSWATRWGKYLHVY 285
           GV V P S++      C  +G+ LVL E  D +V FTYSV+F ES  SWATRW KYLHVY
Sbjct: 257 GVIVNPLSIKRSSPGTCETNGSPLVLDEANDNEVYFTYSVKFEESPTSWATRWDKYLHVY 316

Query: 286 DPKVQWYXXXXXXXXXXXXXXXXXXXXFRALKTDLDRYNDFNLDNEFQEDYGWKLLHSDV 345
           DP +QW+                     RALK+D  RYN+ NLD++FQED GWKL H DV
Sbjct: 317 DPSIQWFSLINFSLVVVLLSSVVIHSLLRALKSDFARYNELNLDDDFQEDSGWKLNHGDV 376

Query: 346 FRSPSKTLLLSVFVGSGGQLFLMSACTLFIAMLGFLSPSSRGSLGTIMFVLYAIFGGFGS 405
           FR PS++L+LS+ VGSG Q+FLM  C++F A LGFLSPSSRGSL T+MF+LYA+FG  GS
Sbjct: 377 FRPPSQSLMLSILVGSGVQIFLMVTCSIFFAALGFLSPSSRGSLATVMFILYALFGFVGS 436

Query: 406 YLSMSTYKMFGGEKWKVNMVLTPLLVPGIIFATMLLMNFFLVMVQSSGAMPFGTMLAIVV 465
           Y SM  YK F G  WK N+++TPLL+PG I   ++ +NFFL+ V SSG +P  T+  +V 
Sbjct: 437 YTSMGIYKFFDGPYWKANVIMTPLLIPGAILLVIIALNFFLMFVHSSGVIPASTLFFMVF 496

Query: 466 LWFVLSIPISIMGSLFARKKNTWDQHPTKTSQIAKQIPPQPWYLRTWPAAYIAGLFPFGA 525
           LWF+ SIP+S  GSL ARKK  WD+HPTKT+QIA+QIP QPWYL+T PA  IAG+FPFG+
Sbjct: 497 LWFLFSIPLSFAGSLVARKKCHWDEHPTKTNQIARQIPFQPWYLKTLPATLIAGIFPFGS 556

Query: 526 IAVELYFIYTSIWXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYYSLCMENWSWQWRSFI 585
           IAVELYFIYTS+W                              Y+SLC+ENW WQWR F 
Sbjct: 557 IAVELYFIYTSLWFNKIFYMFGFLFFSFLLLTLTTSLVTVMITYHSLCLENWKWQWRGFT 616

Query: 586 IGGIGCSTYVFINSILFTKFRLGGFVTIVLYVGYSLLISFLFCLVTGTIGFVSSLWFVRK 645
           +GG+GC+ YVFI+SILFTKF+LGGF TIVLY+GYS +IS L CLVTG+IGF+SS++F+RK
Sbjct: 617 VGGVGCALYVFIHSILFTKFKLGGFTTIVLYLGYSSVISLLCCLVTGSIGFISSMFFIRK 676

Query: 646 IYSSIKVD 653
           IYSSIKVD
Sbjct: 677 IYSSIKVD 684

>YDR107C Chr4 complement(669016..671034) [2019 bp, 672 aa] {ON}
           TMN2Protein with a role in cellular adhesion and
           filamentous growth; similar to Emp70p and Tmn3p; member
           of the evolutionarily conserved Transmembrane Nine
           family of proteins with nine membrane-spanning segments
          Length = 672

 Score =  721 bits (1861), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 350/656 (53%), Positives = 444/656 (67%), Gaps = 17/656 (2%)

Query: 15  QGFYLPGSAPTTYRRGDAIPLLVNHITPTVF--SDDRAGTDGQRDKERXXXXXXXXXPRL 72
           +GF LPG +PTTY  GD IPLLVN +TP+++    D  G D   DKE           R 
Sbjct: 17  KGFSLPGLSPTTYHSGDEIPLLVNRLTPSIYFQHQDEEGNDVSGDKEHFLYSYDYYNKRF 76

Query: 73  HMCRPDKIEKVSESLGSIIFGDRLHNSPFELKMLEEKSCVALCEKTVPAEDAKFINQLIR 132
           H CRP+ +EK  ESLGS+IFGDR++NSPF+L MLEEK CVALC+ T+P +DAKFIN LI+
Sbjct: 77  HFCRPEHVEKQPESLGSVIFGDRIYNSPFQLNMLEEKECVALCKSTIPGKDAKFINTLIK 136

Query: 133 SGFFHNWLVDGLPAGREMHDARTNTVFYGTGFELG-----------RVIRGTEDRNQEEP 181
           SGFF NWLVDGLPA R+ +D+RT T +YGTGFELG            V    E+   E  
Sbjct: 137 SGFFQNWLVDGLPAARKAYDSRTKTNYYGTGFELGFTDVKQTVDGKAVPSTMEELTSEAS 196

Query: 182 GE---IELQTRRVLQPG-ESVVAVPYFINHFEITVDYHKRAEDELRVVGVSVLPRSLQNP 237
            E   ++ +  + ++P     V +PYF+NHF+I V++H R  D  RVVGV V P S++  
Sbjct: 197 NEDVILDARLPKNVKPNLVKTVELPYFVNHFDIEVEFHDRGNDNYRVVGVIVNPVSIERS 256

Query: 238 VGDKCANSGNGLVLSETADTKVTFTYSVRFHESDVSWATRWGKYLHVYDPKVQWYXXXXX 297
               C+ +G  L+L E  D +V FTYSV+F  SD  WATRW KYLH+YDP++QW+     
Sbjct: 257 SPGACSTTGKPLILDEDKDNEVYFTYSVKFVASDTVWATRWDKYLHIYDPQIQWFSLINF 316

Query: 298 XXXXXXXXXXXXXXXFRALKTDLDRYNDFNLDNEFQEDYGWKLLHSDVFRSPSKTLLLSV 357
                           RALK+DL RYN+ NLDNEF ED GWKL H DVFR+PSK++LLS+
Sbjct: 317 SVIVILLSSVVMHSLLRALKSDLARYNELNLDNEFHEDSGWKLGHGDVFRTPSKSMLLSI 376

Query: 358 FVGSGGQLFLMSACTLFIAMLGFLSPSSRGSLGTIMFVLYAIFGGFGSYLSMSTYKMFGG 417
            VGSG QLFLM  C++F A +G +SP SRGSL T+MFVLYA+FG  GSY SM  YK F G
Sbjct: 377 LVGSGMQLFLMVMCSIFFAAVGLVSPVSRGSLPTVMFVLYALFGFVGSYASMGVYKFFRG 436

Query: 418 EKWKVNMVLTPLLVPGIIFATMLLMNFFLVMVQSSGAMPFGTMLAIVVLWFVLSIPISIM 477
             WK NM+LTP+L+PG IF  +++MNFFL+   SSG +P  ++  I++LWF++S+P+S  
Sbjct: 437 PYWKANMILTPILLPGAIFLLIVIMNFFLLFAHSSGVIPARSLFFIILLWFLVSVPLSFA 496

Query: 478 GSLFARKKNTWDQHPTKTSQIAKQIPPQPWYLRTWPAAYIAGLFPFGAIAVELYFIYTSI 537
           GS+ A K+  WD+HPTKT+QIA+QIP QPWYLRT  A  IAG+F FG+IAVELYFIY+S+
Sbjct: 497 GSIVAHKQCNWDEHPTKTNQIARQIPYQPWYLRTAQATLIAGIFSFGSIAVELYFIYSSL 556

Query: 538 WXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYYSLCMENWSWQWRSFIIGGIGCSTYVFI 597
           W                              YYSLC+ENW WQWRSFIIGG+GCS Y FI
Sbjct: 557 WFNKIFYMFGFLLFSFLLLTLTTSLVTILITYYSLCLENWLWQWRSFIIGGLGCSIYTFI 616

Query: 598 NSILFTKFRLGGFVTIVLYVGYSLLISFLFCLVTGTIGFVSSLWFVRKIYSSIKVD 653
           +SILFTKF+LGG +T+VLY+GYSL+IS L C+VTG IGF SS++F+RKIYS+IKV+
Sbjct: 617 HSILFTKFKLGGVITVVLYLGYSLIISALCCVVTGAIGFFSSMFFIRKIYSAIKVE 672

>Smik_4.353 Chr4 complement(630320..632392) [2073 bp, 690 aa] {ON}
           YDR107C (REAL)
          Length = 690

 Score =  712 bits (1837), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 343/656 (52%), Positives = 440/656 (67%), Gaps = 17/656 (2%)

Query: 15  QGFYLPGSAPTTYRRGDAIPLLVNHITPTVF--SDDRAGTDGQRDKERXXXXXXXXXPRL 72
           + F LPG +PTTY + D IPLLVN +TP+++    D  G D   DKE           R 
Sbjct: 35  KAFSLPGLSPTTYHKNDEIPLLVNRLTPSIYFQHQDENGKDISSDKEHYLYSYDYYNERF 94

Query: 73  HMCRPDKIEKVSESLGSIIFGDRLHNSPFELKMLEEKSCVALCEKTVPAEDAKFINQLIR 132
           H CRP+ +E+  ESLGSIIFGDR++NSPF+L+MLE K CVALCE T+P +DAKFIN+LI+
Sbjct: 95  HFCRPEHVERQPESLGSIIFGDRIYNSPFQLRMLETKECVALCENTIPGKDAKFINKLIK 154

Query: 133 SGFFHNWLVDGLPAGREMHDARTNTVFYGTGFELG----------RVIRGTEDRNQEEPG 182
           SGFF NWLVDGLPA R++ D+RT T +YGTGFELG          +VI  T +    E  
Sbjct: 155 SGFFQNWLVDGLPAARKVWDSRTKTNYYGTGFELGITAVKNTIDGKVIPSTMEELDSETS 214

Query: 183 E----IELQTRRVLQPG-ESVVAVPYFINHFEITVDYHKRAEDELRVVGVSVLPRSLQNP 237
                ++ +  + ++P     V +PYF+NHF+I V++H R +D  RVVGV+V P S++  
Sbjct: 215 NTGAALDAREPKNIKPNLVKTVELPYFVNHFDIEVEFHDRGDDNYRVVGVTVNPMSIERS 274

Query: 238 VGDKCANSGNGLVLSETADTKVTFTYSVRFHESDVSWATRWGKYLHVYDPKVQWYXXXXX 297
             D C+ +   L+L E  D ++ FTYSV+F  SD  WATRW KYLH+YDP++QW+     
Sbjct: 275 SPDSCSKATKPLILDEEGDNEIYFTYSVKFVASDTVWATRWDKYLHIYDPQIQWFSLINF 334

Query: 298 XXXXXXXXXXXXXXXFRALKTDLDRYNDFNLDNEFQEDYGWKLLHSDVFRSPSKTLLLSV 357
                           RAL +DL RYN+ NLDNEF ED GWKL H DVFR+P+K++LLSV
Sbjct: 335 SVIIVLLSSVVMHSLLRALNSDLSRYNELNLDNEFHEDSGWKLGHGDVFRTPTKSMLLSV 394

Query: 358 FVGSGGQLFLMSACTLFIAMLGFLSPSSRGSLGTIMFVLYAIFGGFGSYLSMSTYKMFGG 417
            VGSG QLFLM  C++F+A LG +SP SRGSL T+MFV YA+FG  GSY SM  YK F G
Sbjct: 395 LVGSGVQLFLMIICSIFLAALGLVSPVSRGSLPTVMFVFYALFGFVGSYTSMGVYKFFHG 454

Query: 418 EKWKVNMVLTPLLVPGIIFATMLLMNFFLVMVQSSGAMPFGTMLAIVVLWFVLSIPISIM 477
             WK N++LTP+L+PG IF  ++ MNFFL+   SSG +P  T+  I+ LWF +SIP+S  
Sbjct: 455 PYWKANLILTPILLPGGIFVLIVAMNFFLLFAHSSGVIPASTLFFIIFLWFAVSIPLSFA 514

Query: 478 GSLFARKKNTWDQHPTKTSQIAKQIPPQPWYLRTWPAAYIAGLFPFGAIAVELYFIYTSI 537
           GS+ A K   WD+HPTKT+QIA+Q+P QPWYLRT  A  IAG+F FG+IAVELYFIY+S+
Sbjct: 515 GSMIAHKWCNWDEHPTKTNQIARQVPYQPWYLRTIQATLIAGIFCFGSIAVELYFIYSSL 574

Query: 538 WXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYYSLCMENWSWQWRSFIIGGIGCSTYVFI 597
           W                              Y+SLC+ENW WQWRSFIIGG+GCS Y+FI
Sbjct: 575 WFNKIFYMFGFLLFSFLLLTLTTSLVTVLITYHSLCLENWQWQWRSFIIGGLGCSVYMFI 634

Query: 598 NSILFTKFRLGGFVTIVLYVGYSLLISFLFCLVTGTIGFVSSLWFVRKIYSSIKVD 653
           +SILFTKF+LGGF+TIVLY GYS +IS L C+VTG IGF S + F+RKIYS++K++
Sbjct: 635 HSILFTKFKLGGFITIVLYFGYSFIISALCCVVTGAIGFFSCMLFIRKIYSAVKIE 690

>KNAG0G01990 Chr7 complement(441326..443329) [2004 bp, 667 aa] {ON}
           Anc_8.254 YLR083C
          Length = 667

 Score =  710 bits (1833), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 349/649 (53%), Positives = 449/649 (69%), Gaps = 11/649 (1%)

Query: 15  QGFYLPGSAPTTYRRGDAIPLLVNHITPTVF--SDDRAGTDGQRDKERXXXXXXXXXPRL 72
             FYLPG APTTY+  D IPLLVNH++P+++   +   G + + DK R          R 
Sbjct: 20  NAFYLPGVAPTTYKANDEIPLLVNHLSPSMYWQHETEDGENMKGDKSRYLYSYDYYYDRF 79

Query: 73  HMCRPDKIEKVSESLGSIIFGDRLHNSPFELKMLEEKSCVALCEKTVPAEDAKFINQLIR 132
           H C+P+KI K  ESLGSIIFGDR++NSP+++KMLEEK+CV LC   +P +DA+FIN+LI+
Sbjct: 80  HFCQPEKIVKEPESLGSIIFGDRIYNSPYQIKMLEEKTCVPLCNTIIPGKDAEFINKLIK 139

Query: 133 SGFFHNWLVDGLPAGREMHDARTNTVFYGTGFELGRV------IRGTEDRNQEEPGEIEL 186
           +GFF NWL+DGLPA R +HD  TN+ FYG GFELG V       +      +++ G  +L
Sbjct: 140 NGFFQNWLIDGLPAARVVHDKSTNSDFYGNGFELGSVEVVQAVAQAKTHPKEDDSGSAKL 199

Query: 187 QTR--RVLQPGESVVAVPYFINHFEITVDYHKRAEDELRVVGVSVLPRSLQNPVGDKCAN 244
            TR  + +Q  ++V  +PYF NH +ITV+YH R E  LRVVGV+V P S++      C  
Sbjct: 200 STRDAKNVQMLKNV-ELPYFANHHDITVEYHDRGEGNLRVVGVTVDPISIKRSSPGTCQT 258

Query: 245 SGNGLVLSETADTKVTFTYSVRFHESDVSWATRWGKYLHVYDPKVQWYXXXXXXXXXXXX 304
           SG+ L+L E  D +V FTYSVRF  SD  WATRW KYLH YDP +QW+            
Sbjct: 259 SGDPLMLDEKNDNEVYFTYSVRFVASDTVWATRWDKYLHTYDPTIQWFSLVNFSIVVVLL 318

Query: 305 XXXXXXXXFRALKTDLDRYNDFNLDNEFQEDYGWKLLHSDVFRSPSKTLLLSVFVGSGGQ 364
                    +AL++D  RYN+ NLDNEFQED GWKL H DVFR PSK++LLS+ VGSG Q
Sbjct: 319 SSVVIHMLLKALRSDFARYNELNLDNEFQEDSGWKLTHGDVFRIPSKSMLLSILVGSGIQ 378

Query: 365 LFLMSACTLFIAMLGFLSPSSRGSLGTIMFVLYAIFGGFGSYLSMSTYKMFGGEKWKVNM 424
           LFLM + ++F A LGFLSPSSRGSLGT+MF+LYA+FG  GSY SM  YK F G  WK NM
Sbjct: 379 LFLMISVSIFFAALGFLSPSSRGSLGTVMFMLYALFGFVGSYTSMGVYKFFRGPYWKANM 438

Query: 425 VLTPLLVPGIIFATMLLMNFFLVMVQSSGAMPFGTMLAIVVLWFVLSIPISIMGSLFARK 484
           +LTPLLVPG +  +++ +N FL+   SSG +P  T+  IV+LWFV+S+P ++ GSL A K
Sbjct: 439 ILTPLLVPGCLLLSIVGLNMFLLGAHSSGTIPAKTLFFIVLLWFVISVPSALAGSLIAHK 498

Query: 485 KNTWDQHPTKTSQIAKQIPPQPWYLRTWPAAYIAGLFPFGAIAVELYFIYTSIWXXXXXX 544
           K +WD+HPTKT+Q+A+Q+P QPWYL+T  A +IAG+FPFG+IAVELYFIYTS+W      
Sbjct: 499 KCSWDEHPTKTNQVARQVPFQPWYLKTVAATFIAGIFPFGSIAVELYFIYTSLWYNKIFY 558

Query: 545 XXXXXXXXXXXXXXXXXXXXXXXXYYSLCMENWSWQWRSFIIGGIGCSTYVFINSILFTK 604
                                   Y+SL +ENW WQWRSFI+GG+GC+ Y+F++SILFTK
Sbjct: 559 MFGFLFVSFLLLTLTTVLVTILITYHSLSLENWQWQWRSFIVGGVGCAIYMFVHSILFTK 618

Query: 605 FRLGGFVTIVLYVGYSLLISFLFCLVTGTIGFVSSLWFVRKIYSSIKVD 653
            +LGGFVTIVLYVGYS +IS L CLVTG+IGF+SS++FVR+IYSSIKV+
Sbjct: 619 LKLGGFVTIVLYVGYSAVISLLCCLVTGSIGFLSSMFFVRRIYSSIKVE 667

>Kpol_543.35 s543 complement(78246..80222) [1977 bp, 658 aa] {ON}
           complement(78246..80222) [1977 nt, 659 aa]
          Length = 658

 Score =  709 bits (1829), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 342/648 (52%), Positives = 442/648 (68%), Gaps = 16/648 (2%)

Query: 15  QGFYLPGSAPTTYRRGDAIPLLVNHITPTVF--SDDRAGTDGQRDKERXXXXXXXXXPRL 72
             FYLPG APTTY +GD IPLLVNH+TP++     D  G D + +KE          P+L
Sbjct: 18  SAFYLPGVAPTTYGKGDEIPLLVNHLTPSLNFQHKDDQGNDIKGNKEHFLYSFDYYFPKL 77

Query: 73  HMCRPDKIEKVSESLGSIIFGDRLHNSPFELKMLEEKSCVALCEKTVPAEDAKFINQLIR 132
           H C+P+ +EK  ESLGSI+FGDR++NSPF +KMLE + C +LC+ T+PA+DAKFIN+LI+
Sbjct: 78  HFCKPEHVEKQPESLGSILFGDRIYNSPFSIKMLENQECTSLCKVTIPADDAKFINKLIK 137

Query: 133 SGFFHNWLVDGLPAGREMHDARTNTVFYGTGFELGRV-IR------GTEDRNQEEPGEIE 185
           +GFF NWL+DGLPA R++HD +T + FYGTGF LG V +R       +   N E P    
Sbjct: 138 NGFFQNWLIDGLPAARKLHDVKTKSDFYGTGFPLGNVHVRQAVGGLASSKLNLENPAREA 197

Query: 186 LQTRRVLQPGESVVAVPYFINHFEITVDYHKRAEDELRVVGVSVLPRSLQNPVGDKCANS 245
                ++      V +P+  NH++I V+YH R E   RVVGV+V P+S     GD C   
Sbjct: 198 KNVNNMVHN----VEIPFLFNHYDINVEYHDRGEGNYRVVGVTVDPKS---STGDICTKK 250

Query: 246 GNGLVLSETADTKVTFTYSVRFHESDVSWATRWGKYLHVYDPKVQWYXXXXXXXXXXXXX 305
             GL+L ET D +V F+YSVRF  S+  WATRW KYLHVYDP +QW+             
Sbjct: 251 SGGLILLETEDNEVQFSYSVRFIPSETVWATRWDKYLHVYDPTIQWFSLINFSVVVILLS 310

Query: 306 XXXXXXXFRALKTDLDRYNDFNLDNEFQEDYGWKLLHSDVFRSPSKTLLLSVFVGSGGQL 365
                   RALK+D  RY +FNLD+ FQ+D GWKL H DVFR P K++LLS+ VGSG QL
Sbjct: 311 MVVIHSLMRALKSDFARYEEFNLDDTFQQDSGWKLGHGDVFRIPDKSMLLSILVGSGTQL 370

Query: 366 FLMSACTLFIAMLGFLSPSSRGSLGTIMFVLYAIFGGFGSYLSMSTYKMFGGEKWKVNMV 425
           FLM A ++F A +G LSPSSRGSL + MF+LYA+FG  GSY+SM  YK F G  WK NM+
Sbjct: 371 FLMVAVSIFFAAIGILSPSSRGSLPSAMFILYALFGFCGSYVSMGVYKFFNGPYWKANMI 430

Query: 426 LTPLLVPGIIFATMLLMNFFLVMVQSSGAMPFGTMLAIVVLWFVLSIPISIMGSLFARKK 485
           LTP+LVPG++F +++ +NFFL+  +SSG +P   ++ ++VLWF++SIP+S+ GSL A KK
Sbjct: 431 LTPILVPGLLFISIVGLNFFLLFSRSSGTIPPTALIFVIVLWFIISIPLSLAGSLIANKK 490

Query: 486 NTWDQHPTKTSQIAKQIPPQPWYLRTWPAAYIAGLFPFGAIAVELYFIYTSIWXXXXXXX 545
             W +HPTKT++IA+QIP QPWYL+T PA  IAGLFPFG+IAVELYFIY+S+W       
Sbjct: 491 CNWGEHPTKTNEIARQIPFQPWYLKTVPATLIAGLFPFGSIAVELYFIYSSLWFNKIFYM 550

Query: 546 XXXXXXXXXXXXXXXXXXXXXXXYYSLCMENWSWQWRSFIIGGIGCSTYVFINSILFTKF 605
                                  YYSL +ENW WQWRSFI+GG+GC+ Y+F++SI+FTKF
Sbjct: 551 FGFLFVSFLLLTLTTTLVTILITYYSLNLENWRWQWRSFIVGGVGCAFYIFVHSIIFTKF 610

Query: 606 RLGGFVTIVLYVGYSLLISFLFCLVTGTIGFVSSLWFVRKIYSSIKVD 653
           +LGGF TIVLYVGYSL+IS L  +VTG IGF+SS+ FV+KIYSS+KVD
Sbjct: 611 KLGGFTTIVLYVGYSLIISALCAVVTGAIGFISSMLFVKKIYSSVKVD 658

>Suva_2.267 Chr2 complement(463458..465476) [2019 bp, 672 aa] {ON}
           YDR107C (REAL)
          Length = 672

 Score =  699 bits (1803), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 341/656 (51%), Positives = 436/656 (66%), Gaps = 17/656 (2%)

Query: 15  QGFYLPGSAPTTYRRGDAIPLLVNHITPTVF--SDDRAGTDGQRDKERXXXXXXXXXPRL 72
           + F LPG +PTTYR  D IPLLVN +TP+++    D  G D   DKE           + 
Sbjct: 17  KAFSLPGVSPTTYRANDEIPLLVNRLTPSIYFQHKDENGKDVSSDKEHFLYSYDYYNDKF 76

Query: 73  HMCRPDKIEKVSESLGSIIFGDRLHNSPFELKMLEEKSCVALCEKTVPAEDAKFINQLIR 132
           H C+P+ +EK  ESLGS+IFGDR++NSPF+LKMLE+K CVALC+ T+P +DAKFIN LI+
Sbjct: 77  HFCKPEHVEKQPESLGSVIFGDRIYNSPFQLKMLEDKECVALCKSTIPGKDAKFINTLIK 136

Query: 133 SGFFHNWLVDGLPAGREMHDARTNTVFYGTGFELG----------RVIRGT-EDRNQEEP 181
           +GFF NWLVDGLPA R ++D+RT T +YGTGFELG          + I  T E+ + E+ 
Sbjct: 137 NGFFQNWLVDGLPAARNVYDSRTKTNYYGTGFELGFTDVKQTVGGKTIPSTMEELDSEDS 196

Query: 182 ---GEIELQTRRVLQPG-ESVVAVPYFINHFEITVDYHKRAEDELRVVGVSVLPRSLQNP 237
                ++ +  + ++P     + + +F+NHF I V+YH R     RVVGV+V P S++  
Sbjct: 197 KTGATLDARDPKNIKPNLVQTIELTHFVNHFNIQVEYHDRGNGNYRVVGVTVNPLSIERS 256

Query: 238 VGDKCANSGNGLVLSETADTKVTFTYSVRFHESDVSWATRWGKYLHVYDPKVQWYXXXXX 297
               C+ +G  L L E  D  V FTYSV+F  SD  WATRW KYLHVYDP++QW+     
Sbjct: 257 SPGACSTTGEPLTLVEDKDNDVYFTYSVKFIASDTVWATRWDKYLHVYDPQIQWFSLINF 316

Query: 298 XXXXXXXXXXXXXXXFRALKTDLDRYNDFNLDNEFQEDYGWKLLHSDVFRSPSKTLLLSV 357
                           RA+++D  RYN+ NLDNEF ED GWKL H DVFR P K+++LSV
Sbjct: 317 SIIVILLSSVVIHSILRAVRSDFARYNELNLDNEFHEDAGWKLGHGDVFRIPPKSMVLSV 376

Query: 358 FVGSGGQLFLMSACTLFIAMLGFLSPSSRGSLGTIMFVLYAIFGGFGSYLSMSTYKMFGG 417
            VGSG QLFLM  C++F A LG +SP+SRGSL T+MFVLYA+FG  GSY SM  YK F G
Sbjct: 377 LVGSGIQLFLMIICSIFFAALGLVSPASRGSLPTVMFVLYALFGFVGSYTSMGVYKFFHG 436

Query: 418 EKWKVNMVLTPLLVPGIIFATMLLMNFFLVMVQSSGAMPFGTMLAIVVLWFVLSIPISIM 477
             WK N+++TP+L+PG IF  ++ MNFFL+   SSG +P  T+  I+ LWF +SIP+S  
Sbjct: 437 PYWKANLIITPILLPGAIFLLIVAMNFFLLFAHSSGVIPARTLFFIIFLWFSVSIPLSFA 496

Query: 478 GSLFARKKNTWDQHPTKTSQIAKQIPPQPWYLRTWPAAYIAGLFPFGAIAVELYFIYTSI 537
           GS  A K+  WD+HPTKT+QIA+Q P QPWYLRT  A  IAG+F FG+IAVELYFIY+S+
Sbjct: 497 GSYIAHKRCKWDEHPTKTNQIARQSPRQPWYLRTIQATLIAGIFSFGSIAVELYFIYSSL 556

Query: 538 WXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYYSLCMENWSWQWRSFIIGGIGCSTYVFI 597
           W                              Y+SLC+ENWSWQWRSFIIGG+GCS Y+FI
Sbjct: 557 WFNKIFYMFGFLLFSFLLLTLATSLVTVFITYHSLCLENWSWQWRSFIIGGLGCSVYMFI 616

Query: 598 NSILFTKFRLGGFVTIVLYVGYSLLISFLFCLVTGTIGFVSSLWFVRKIYSSIKVD 653
           ++ILFTKF+LGGFVT+VLYVGYS +IS L C+VTG IGF SS+ F+RKIYS IKV+
Sbjct: 617 HAILFTKFKLGGFVTVVLYVGYSFIISALCCVVTGAIGFFSSMIFIRKIYSRIKVE 672

>Skud_4.368 Chr4 complement(640627..642645) [2019 bp, 672 aa] {ON}
           YDR107C (REAL)
          Length = 672

 Score =  696 bits (1796), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 336/656 (51%), Positives = 440/656 (67%), Gaps = 17/656 (2%)

Query: 15  QGFYLPGSAPTTYRRGDAIPLLVNHITPTVF--SDDRAGTDGQRDKERXXXXXXXXXPRL 72
           + F LPG +PTTY   D IPLLVN +TP+++    D  G D   DKE           R 
Sbjct: 17  KAFSLPGLSPTTYHSNDEIPLLVNRLTPSIYFQHQDENGNDISSDKEHFLYSYDYYNERF 76

Query: 73  HMCRPDKIEKVSESLGSIIFGDRLHNSPFELKMLEEKSCVALCEKTVPAEDAKFINQLIR 132
           H CRP+ +EK  ESLGS+IFGDR++NSPF+L+MLEEK CVALC+ T+P  DA+FIN+LI 
Sbjct: 77  HFCRPEHVEKQPESLGSVIFGDRIYNSPFQLRMLEEKECVALCKGTIPGRDAEFINRLII 136

Query: 133 SGFFHNWLVDGLPAGREMHDARTNTVFYGTGFELG--RVIRGTEDR---NQEEPGEIE-- 185
           SGFF NWLVDGLPA R ++D+RT T +YGTGFELG   VI+   D    N  E  +++  
Sbjct: 137 SGFFQNWLVDGLPAARSVYDSRTKTNYYGTGFELGFTDVIQTVGDETVPNTMEEADMDAS 196

Query: 186 -------LQTRRVLQPGE-SVVAVPYFINHFEITVDYHKRAEDELRVVGVSVLPRSLQNP 237
                  +++ + ++P     V +PYF+NHFEI V++H+R  D  R+VGV+V P S++  
Sbjct: 197 NAGATLHIRSPKNIRPNPVKTVELPYFVNHFEIVVEFHERGNDSYRIVGVTVNPVSIERS 256

Query: 238 VGDKCANSGNGLVLSETADTKVTFTYSVRFHESDVSWATRWGKYLHVYDPKVQWYXXXXX 297
               C+ +   L L E  D +V FTYSV+F  S   WATRW KYLH+YDP++QW+     
Sbjct: 257 SPGSCSRTRKPLTLHEDRDNEVYFTYSVKFVASATVWATRWDKYLHIYDPQIQWFSLIGF 316

Query: 298 XXXXXXXXXXXXXXXFRALKTDLDRYNDFNLDNEFQEDYGWKLLHSDVFRSPSKTLLLSV 357
                           RALK+DL RYN+ NL+NEF ED GWKL H DVFR+P K++LLSV
Sbjct: 317 SVIVILLSSAVIHSLLRALKSDLTRYNELNLNNEFHEDAGWKLSHGDVFRTPPKSMLLSV 376

Query: 358 FVGSGGQLFLMSACTLFIAMLGFLSPSSRGSLGTIMFVLYAIFGGFGSYLSMSTYKMFGG 417
            VGSG QLFLM  C++F A  G +SP SRGSL T+MF+LYA+FG  GSY SM  YK F G
Sbjct: 377 LVGSGIQLFLMIICSIFFAAFGLVSPISRGSLQTVMFLLYALFGFVGSYTSMGVYKFFHG 436

Query: 418 EKWKVNMVLTPLLVPGIIFATMLLMNFFLVMVQSSGAMPFGTMLAIVVLWFVLSIPISIM 477
             WK N+++TP+L+PG I   ++ MN FL+   SSG +P  ++  I+ LWFV+SIP+S +
Sbjct: 437 PYWKANLIITPILLPGAILLLIVAMNIFLLFAHSSGVIPAKSLFFIIFLWFVVSIPLSFV 496

Query: 478 GSLFARKKNTWDQHPTKTSQIAKQIPPQPWYLRTWPAAYIAGLFPFGAIAVELYFIYTSI 537
           GS+ A K+ +W++HPTKT+QIA+QIP QPWYLRT  A  +AG+F FG+IAVELYFIY+S+
Sbjct: 497 GSVLAHKRCSWNEHPTKTNQIARQIPHQPWYLRTTQATMVAGIFSFGSIAVELYFIYSSL 556

Query: 538 WXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYYSLCMENWSWQWRSFIIGGIGCSTYVFI 597
           W                              Y+SLC+ENW WQWRSFIIGG+GCS Y+FI
Sbjct: 557 WFNKIFYMFGFLLFSFLLLTLTTSLITVLITYHSLCLENWLWQWRSFIIGGLGCSIYMFI 616

Query: 598 NSILFTKFRLGGFVTIVLYVGYSLLISFLFCLVTGTIGFVSSLWFVRKIYSSIKVD 653
           +SILFTKF+LGGF+T+VLY+GYS ++S L C+VTG IGF SS+ F+RKIY ++KV+
Sbjct: 617 HSILFTKFKLGGFITVVLYLGYSFIMSVLCCVVTGAIGFFSSMIFIRKIYYAVKVE 672

>TBLA0E04370 Chr5 complement(1108954..1110984) [2031 bp, 676 aa]
           {ON} Anc_8.254 YLR083C
          Length = 676

 Score =  688 bits (1775), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 342/659 (51%), Positives = 433/659 (65%), Gaps = 21/659 (3%)

Query: 15  QGFYLPGSAPTTYRRGDAIPLLVNHITPTVF--SDDRAGTDGQRDKERXXXXXXXXXPRL 72
            GFYLPG APTTY   D+IPLLVNH+TP++F    D  G +   DKE           +L
Sbjct: 19  NGFYLPGVAPTTYHELDSIPLLVNHLTPSMFFKHKDSDGNELSSDKENFLYSYDYYYSKL 78

Query: 73  HMCRP--DKIEKVSESLGSIIFGDRLHNSPFELKMLEEKSCVALCEKTVPAEDAKFINQL 130
           H C+P   +I+K  ESLGSI+FGDR++NSPFELKML +++C  LC   +P +DAKFIN L
Sbjct: 79  HFCKPLDREIKKQPESLGSILFGDRIYNSPFELKMLVDENCKELCSTNIPGDDAKFINDL 138

Query: 131 IRSGFFHNWLVDGLPAGREMHDARTNTVFYGTGFELGRVIRG----------------TE 174
           I+SGF  NWL+DGLPA R+++D  T + FYG+GFELG V                    E
Sbjct: 139 IKSGFLQNWLIDGLPAARQLYDQTTKSSFYGSGFELGSVEMIQVVDEAPSHTTPKQPIVE 198

Query: 175 DRNQEEPGEIELQTRRVLQPGESVVAVPYFINHFEITVDYHKRAEDELRVVGVSVLPRSL 234
           D   +E  E +   +R  Q   S V   YF NHF+I ++YH R  +E R+VGV+V P S+
Sbjct: 199 DVLSQELDEEQATEKRANQMLVSSVERTYFANHFDIHIEYHDRGNNEYRIVGVTVNPISM 258

Query: 235 QNPVGDKCANSGNGLVLSETADTKVTFTYSVRFHESDVSWATRWGKYLHVYDPKVQWYXX 294
           +      C  +   L LSE +DT V FTYSV F +SD  WATRW KYLH+YDP +QW+  
Sbjct: 259 KRDSA-ICDTNLGKLALSEVSDTDVIFTYSVTFEKSDTVWATRWDKYLHIYDPTIQWFSL 317

Query: 295 XXXXXXXXXXXXXXXXXXFRALKTDLDRYNDFNLDNEFQEDYGWKLLHSDVFRSPSKTLL 354
                              +ALK D  RYN+FNL++ F ED GWKL H DVFR P+K++L
Sbjct: 318 INFTVIVVVLSIIVVHFLTKALKNDFVRYNEFNLNDSFDEDSGWKLAHGDVFRIPTKSML 377

Query: 355 LSVFVGSGGQLFLMSACTLFIAMLGFLSPSSRGSLGTIMFVLYAIFGGFGSYLSMSTYKM 414
           LS+FVGSG QLF M +  L +A LGFLSPS+RGSL TIMF+LYA+FG  GSY SM  Y+ 
Sbjct: 378 LSIFVGSGTQLFFMISSVLVLAALGFLSPSARGSLPTIMFILYAVFGFVGSYTSMGVYRF 437

Query: 415 FGGEKWKVNMVLTPLLVPGIIFATMLLMNFFLVMVQSSGAMPFGTMLAIVVLWFVLSIPI 474
           F G  WK NM+LTPL+VPG IF  ++ MN FLV V SS  +P GT+  +V+LW VLS+P+
Sbjct: 438 FNGPYWKANMILTPLIVPGGIFMFIISMNLFLVFVHSSDVVPIGTLSLMVLLWIVLSLPL 497

Query: 475 SIMGSLFARKKNTWDQHPTKTSQIAKQIPPQPWYLRTWPAAYIAGLFPFGAIAVELYFIY 534
           S  GSL + K+ TW  HPTKT+++ +QIP QPWYL+T PA  I G+FPFG+IAVELYFIY
Sbjct: 498 SFAGSLISFKRCTWYDHPTKTNEVLRQIPFQPWYLKTVPATLIGGIFPFGSIAVELYFIY 557

Query: 535 TSIWXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYYSLCMENWSWQWRSFIIGGIGCSTY 594
           +S+W                              Y+SLC+ENW WQWRSFIIGGIGCS Y
Sbjct: 558 SSLWFNKIFYMFGFLLVSFLLLTMTTSLVTIIVTYHSLCLENWRWQWRSFIIGGIGCSIY 617

Query: 595 VFINSILFTKFRLGGFVTIVLYVGYSLLISFLFCLVTGTIGFVSSLWFVRKIYSSIKVD 653
           +FI+SILFT+F+LGGF+TIVLYVGYS LI+ L  +VTG IGF+S+++FV+KIYSSIKV+
Sbjct: 618 IFIHSILFTEFKLGGFITIVLYVGYSALIAILCAMVTGAIGFISNMFFVKKIYSSIKVE 676

>CAGL0B01683g Chr2 complement(154275..156350) [2076 bp, 691 aa] {ON}
           highly similar to uniprot|Q04562 Saccharomyces
           cerevisiae YDR107c or uniprot|P32802 Saccharomyces
           cerevisiae YLR083c EMP70
          Length = 691

 Score =  687 bits (1774), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 342/675 (50%), Positives = 442/675 (65%), Gaps = 37/675 (5%)

Query: 16  GFYLPGSAPTTYRRGDAIPLLVNHITPTVFSD--DRAGTDGQRDKERXXXXXXXXXPRLH 73
           GFYLPG+AP TY++GDAIPLLVNH+TP++     D  G + + DK R          +LH
Sbjct: 17  GFYLPGAAPRTYKQGDAIPLLVNHLTPSLNFQHVDDDGNEIKGDKARMLYPYDYYNEKLH 76

Query: 74  MCRPDKIEKVSESLGSIIFGDRLHNSPFELKMLEEKSCVALCEKTVPAEDAKFINQLIRS 133
            C+P+KIEK  ESLGS+IFG++++NSPF +KMLE+  CV LC  T+P +DAKFIN+LI++
Sbjct: 77  FCQPEKIEKQPESLGSVIFGEKIYNSPFNVKMLEDNECVQLCSTTIPGKDAKFINKLIKN 136

Query: 134 GFFHNWLVDGLPAGREMHDARTNTVFYGTGFELG----------RVIRGTED-------- 175
           GF  NWL+DGLPA R++HD+RTNT FYG GFELG          +++  +E         
Sbjct: 137 GFMQNWLIDGLPAARKLHDSRTNTEFYGQGFELGFVEVRQAVGGKIVSESEKELQLSERD 196

Query: 176 -RNQEEPGEIELQT---------------RRVLQPGESVVAVPYFINHFEITVDYHKRAE 219
            +N  +  +IE+++               + V+    + V VP F NHF+I V+YH R  
Sbjct: 197 AKNIIDFTDIEIRSPKNLVDLSNLEVREAKNVVDNIVTNVEVPVFANHFDIEVEYHDRGN 256

Query: 220 DELRVVGVSVLPRSLQNPVGDKCANSG-NGLVLSETADTKVTFTYSVRFHESDVSWATRW 278
            + RVVGV V P SL N     CA +  + L L E  D +V FTYSV+F  SD  WATRW
Sbjct: 257 GDFRVVGVIVNPVSLDNYKSRSCALANQHKLHLDENKDNEVMFTYSVKFTPSDTPWATRW 316

Query: 279 GKYLHVYDPKVQWYXXXXXXXXXXXXXXXXXXXXFRALKTDLDRYNDFNLDNEFQEDYGW 338
            KYLH+YDPK+QW+                     RALK+D+ RYN+FNL +EF+ED GW
Sbjct: 317 DKYLHIYDPKIQWFSLINFSVIVLLLSSVAIHSLLRALKSDISRYNEFNLGDEFEEDSGW 376

Query: 339 KLLHSDVFRSPSKTLLLSVFVGSGGQLFLMSACTLFIAMLGFLSPSSRGSLGTIMFVLYA 398
           KL+H DVFR+P  ++LLSV VGSG QLFLM   ++ ++ LG LSPSSRGSL T MF+ YA
Sbjct: 377 KLVHGDVFRTPKNSMLLSVLVGSGIQLFLMIFLSIILSALGILSPSSRGSLPTAMFMFYA 436

Query: 399 IFGGFGSYLSMSTYKMFGGEKWKVNMVLTPLLVPGIIFATMLLMNFFLVMVQSSGAMPFG 458
           IFG  GSY SM  YK F G  WK NM+LTP+L+PGIIF T++ MN  L  V SS  +P  
Sbjct: 437 IFGFVGSYTSMGIYKFFKGPYWKANMILTPVLLPGIIFLTVIFMNVLLYFVGSSNVIPLA 496

Query: 459 TMLAIVVLWFVLSIPISIMGSLFARKKNTWDQHPTKTSQIAKQIPPQPWYLRTWPAAYIA 518
           T++ +V LW + SIP++  GSL + KK  WD+HPTKT++I +QIP QPW+L+T PA  I 
Sbjct: 497 TLVFMVFLWILFSIPLAFAGSLISYKKCNWDEHPTKTNEIPRQIPFQPWFLKTVPATLIG 556

Query: 519 GLFPFGAIAVELYFIYTSIWXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYYSLCMENWS 578
           GL  FG+IAVELYFIY+S+W                              Y +LC ENW+
Sbjct: 557 GLVSFGSIAVELYFIYSSLWFNKIFYMFGFLLFSIVLFSFTTGLINVIITYRALCSENWT 616

Query: 579 WQWRSFIIGGIGCSTYVFINSILFTKFRLGGFVTIVLYVGYSLLISFLFCLVTGTIGFVS 638
           WQWRSF IGG+GCS Y+FI+SILFT+F+LGGF TIVLYVGYS LISFL C+VTG IGF+ 
Sbjct: 617 WQWRSFFIGGLGCSIYIFIHSILFTQFKLGGFATIVLYVGYSFLISFLTCIVTGAIGFIC 676

Query: 639 SLWFVRKIYSSIKVD 653
           S++FVR+I++SIKVD
Sbjct: 677 SMFFVRRIFASIKVD 691

>TPHA0A01840 Chr1 (371758..373815) [2058 bp, 685 aa] {ON} Anc_8.254
           YLR083C
          Length = 685

 Score =  669 bits (1726), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 332/678 (48%), Positives = 432/678 (63%), Gaps = 47/678 (6%)

Query: 15  QGFYLPGSAPTTYRRGDAIPLLVNHITPTVFSDDRAGTDGQ-RDKERXXXXXXXXXPRLH 73
             FYLPG AP+TY  GD +PLLVNH+TP++    +     +   +E+         P+LH
Sbjct: 16  NAFYLPGVAPSTYNEGDELPLLVNHLTPSLNYQKKDDLGKKVESREKMLYSFDYYFPKLH 75

Query: 74  MCRPDKIEKVSESLGSIIFGDRLHNSPFELKMLEEKSCVALCEKTVPAEDAKFINQLIRS 133
            C+P+KI K  +SLGSI+FGDR++NSPF +KML+ ++ V LC  T+P  DAKFIN+LI++
Sbjct: 76  FCKPEKIVKQPDSLGSILFGDRIYNSPFSIKMLKPENNVKLCSITIPGSDAKFINKLIKN 135

Query: 134 GFFHNWLVDGLPAGREMHDARTNTVFYGTGFELGRV------------------------ 169
           GFF NWL+DGLPA R+++D+ T+T FY  GF LG V                        
Sbjct: 136 GFFQNWLIDGLPAARKIYDSNTHTEFYDVGFPLGFVEIKKNVGGLGIPMDAKTKDSGKKN 195

Query: 170 --------------IRGTEDRNQEEPGEIELQTRRVLQPGESVVAVPYFINHFEITVDYH 215
                          +  ED N++E  E +  ++ V       V  PY  NH+ I V+ H
Sbjct: 196 SNSDKKKDSKKKDDSQKKEDSNKKEKREPKRISKLVHN-----VEFPYLANHYVINVEVH 250

Query: 216 KRAEDELRVVGVSVLPRSLQNPVGDKCANSGNGLVLSETADTKVTFTYSVRFHESDVSWA 275
            R E   RVVGV+V P S  +    +    GN L L E  D +VTF+YSV F ES+  WA
Sbjct: 251 DRGEGNYRVVGVTVDPYSTTDSANPE---KGNKLFLDEKKDNEVTFSYSVNFIESETVWA 307

Query: 276 TRWGKYLHVYDPKVQWYXXXXXXXXXXXXXXXXXXXXFRALKTDLDRYNDFNLDNEFQED 335
           TRW KYLH Y+P +QW+                     +ALK+D  RY +FNLDN F ED
Sbjct: 308 TRWDKYLHTYNPTIQWFSLVNFSIIVLLLSALVTYSLLKALKSDFARYEEFNLDNSFNED 367

Query: 336 YGWKLLHSDVFRSPSKTLLLSVFVGSGGQLFLMSACTLFIAMLGFLSPSSRGSLGTIMFV 395
            GWKL H DVFR PS+++LLS+ VGSG QLFLM   ++F+A +G +SPSSRGSL + MF 
Sbjct: 368 SGWKLGHGDVFRIPSQSMLLSILVGSGAQLFLMIISSIFLAAIGIISPSSRGSLPSAMFT 427

Query: 396 LYAIFGGFGSYLSMSTYKMFGGEKWKVNMVLTPLLVPGIIFATMLLMNFFLVMVQSSGAM 455
            YA+FG +GSY+SMS YK F G  WK NM+LTPLLVPG I  ++L +NFFL+ V SSG +
Sbjct: 428 FYALFGFWGSYISMSVYKFFKGPYWKANMILTPLLVPGFILVSILGLNFFLLFVHSSGTI 487

Query: 456 PFGTMLAIVVLWFVLSIPISIMGSLFARKKNTWDQHPTKTSQIAKQIPPQPWYLRTWPAA 515
           P   +L IVV+WFV+S+P+S +GSL A K++ W +HPTKT+QIA+QIP Q WYL+T PA 
Sbjct: 488 PMTALLLIVVIWFVISLPLSFLGSLLANKRSNWGEHPTKTNQIARQIPFQSWYLKTIPAI 547

Query: 516 YIAGLFPFGAIAVELYFIYTSIWXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYYSLCME 575
            IAG+FPFGAIAVELYFIYTS+W                              Y SLCME
Sbjct: 548 LIAGIFPFGAIAVELYFIYTSLWFNKIFYMFGFLFVSFLLLTLTTSLVTVLITYQSLCME 607

Query: 576 NWSWQWRSFIIGGIGCSTYVFINSILFTKFRLGGFVTIVLYVGYSLLISFLFCLVTGTIG 635
           NW+WQWRSF IGG+GCS Y+FI+SILFTKF+LGGF T++LY+GY+LL+S L C+VTG +G
Sbjct: 608 NWNWQWRSFTIGGVGCSLYIFIHSILFTKFKLGGFTTMILYIGYTLLLSILSCIVTGAVG 667

Query: 636 FVSSLWFVRKIYSSIKVD 653
           F+SS+ FVRKIYS+++VD
Sbjct: 668 FISSMIFVRKIYSNVRVD 685

>TBLA0H01450 Chr8 complement(321416..323437) [2022 bp, 673 aa] {ON}
           Anc_8.254 YLR083C
          Length = 673

 Score =  642 bits (1657), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 306/653 (46%), Positives = 419/653 (64%), Gaps = 15/653 (2%)

Query: 15  QGFYLPGSAPTTYRRGDAIPLLVNHITPTVFSD--DRAGTDGQRDKERXXXXXXXXXPRL 72
             FY+PG +  TY  GD I L VN +TP+++ +  D  G     DKE           + 
Sbjct: 20  NAFYIPGISANTYHPGDPIELEVNRLTPSMYFEHTDENGQSVANDKEHFLYSYDYYYDKF 79

Query: 73  HMCRPDKIEKVSESLGSIIFGDRLHNSPFELKMLEEKSCVALCEKTVPAEDAKFINQLIR 132
           H CRP+K+E+ SESLGS++FGDR++NSPFEL MLE K CV LC+ T+PA+DAKFIN+LI+
Sbjct: 80  HFCRPEKVERKSESLGSVLFGDRIYNSPFELYMLEPKECVPLCKTTIPADDAKFINKLIK 139

Query: 133 SGFFHNWLVDGLPAGREMHDARTNTVFYGTGFELGRV------------IRGTEDRNQEE 180
           +GFF+NWL+DGLP+ R+++D++T ++FY +GF LG V            I G      E 
Sbjct: 140 NGFFYNWLIDGLPSARKIYDSKTESIFYSSGFPLGSVSVEHMSGGSKVTIPGVSKLVNEA 199

Query: 181 PGEIELQTRRVLQPGE-SVVAVPYFINHFEITVDYHKRAEDELRVVGVSVLPRSLQNPVG 239
               + +  + +  G  +   V YF NHF I ++YH R  +  RVVGV+V P S++    
Sbjct: 200 VKAYKKREAKNVPAGLITAEEVEYFANHFNIHIEYHDRGNNNYRVVGVTVDPISIKRDDF 259

Query: 240 DKCANSGNGLVLSETADTKVTFTYSVRFHESDVSWATRWGKYLHVYDPKVQWYXXXXXXX 299
           + C  +GN L L+E A+ +V FTYSV F +S+ +WATRW KYLH YDP +QW+       
Sbjct: 260 ESCTPTGNQLHLNENAENQVLFTYSVDFIKSETAWATRWDKYLHTYDPSIQWFSLINFTI 319

Query: 300 XXXXXXXXXXXXXFRALKTDLDRYNDFNLDNEFQEDYGWKLLHSDVFRSPSKTLLLSVFV 359
                         RALK D+ RY D NLDN F ED GWKL H DVFR P K ++LS++V
Sbjct: 320 VVVLLSTIVIHALLRALKKDISRYTDLNLDNSFTEDSGWKLTHGDVFRMPRKAMVLSIYV 379

Query: 360 GSGGQLFLMSACTLFIAMLGFLSPSSRGSLGTIMFVLYAIFGGFGSYLSMSTYKMFGGEK 419
           GSG QLFLM  C L +A LGF+SPS RG+L T MFVLYAIFG  GSY SM  YK F G  
Sbjct: 380 GSGVQLFLMILCCLTVAALGFMSPSYRGALPTCMFVLYAIFGFVGSYTSMGVYKFFHGPY 439

Query: 420 WKVNMVLTPLLVPGIIFATMLLMNFFLVMVQSSGAMPFGTMLAIVVLWFVLSIPISIMGS 479
           WK NM+LTPLLVPG +   ++ +NFFL+ V SSG +P  T++ ++ LW ++S+P+S +GS
Sbjct: 440 WKANMILTPLLVPGSMLLLIIFLNFFLLGVHSSGTIPASTIILMICLWLLVSVPLSFLGS 499

Query: 480 LFARKKNTWDQHPTKTSQIAKQIPPQPWYLRTWPAAYIAGLFPFGAIAVELYFIYTSIWX 539
             A KK  W+ +PT  ++I ++IP QPWY+R+ P   ++G+ PFGAIAVELYFIY+S+W 
Sbjct: 500 FVAFKKCNWNDNPTTVNEIPREIPIQPWYMRSIPVVLLSGIVPFGAIAVELYFIYSSLWY 559

Query: 540 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXYYSLCMENWSWQWRSFIIGGIGCSTYVFINS 599
                                        Y+SLC+ENW WQWRSF+ GG+GC+ Y+F+ S
Sbjct: 560 NKIFYMFGFLLVSFILMIFTSVLVSIIVVYHSLCLENWRWQWRSFVAGGLGCAFYIFLYS 619

Query: 600 ILFTKFRLGGFVTIVLYVGYSLLISFLFCLVTGTIGFVSSLWFVRKIYSSIKV 652
           I FT+F+  GFV+I+LY+GYS LI  + CL+TG + F+ +++FV++I++SIKV
Sbjct: 620 IAFTRFKFTGFVSILLYMGYSSLICVVSCLITGAVSFMCNMFFVKRIFTSIKV 672

>NCAS0B03890 Chr2 (693950..695941) [1992 bp, 663 aa] {ON} Anc_8.254
          Length = 663

 Score =  640 bits (1652), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/648 (47%), Positives = 414/648 (63%), Gaps = 9/648 (1%)

Query: 15  QGFYLPGSAPTTYRRGDAIPLLVNHITPTVF--SDDRAGTDGQRDKERXXXXXXXXXPRL 72
           + F LPG  P TY++GD IPLLVNH+TP++     +  G D    K+           + 
Sbjct: 16  EAFNLPGLGPVTYQKGDDIPLLVNHLTPSMHFHHKNEEGKDISTAKKYVVHSYDYYYEKF 75

Query: 73  HMCRPDKIEKVSESLGSIIFGDRLHNSPFELKMLEEKSCVALCEKTVPAEDAKFINQLIR 132
           H C+P  IEK   S+GSI+FGDR++NSPF+L MLE K+CV LCE  +P +DA+FIN+LI+
Sbjct: 76  HFCQPVHIEKAGSSIGSILFGDRIYNSPFQLNMLENKTCVPLCESIIPGKDAEFINKLIK 135

Query: 133 SGFFHNWLVDGLPAGREMHDARTNTVFYGTGFELGRV-IRGTE------DRNQEEPGEIE 185
           +G++ NW +DGLPA RE++D RT + FYG GFELG V IR T       D   +     +
Sbjct: 136 NGYYQNWFIDGLPAAREVYDKRTKSSFYGNGFELGLVEIRQTTGDKLLPDSVHDISDLAK 195

Query: 186 LQTRRVLQPGESVVAVPYFINHFEITVDYHKRAEDELRVVGVSVLPRSLQNPVGDKCANS 245
              + ++Q     V VPYF+NHF+I ++YH+R     RVVG +V P S+       C  +
Sbjct: 196 RDAKNLVQNLIKEVEVPYFVNHFDIVIEYHERGNGNYRVVGATVNPVSIARKSAGDCTPT 255

Query: 246 GNGLVLSETADTKVTFTYSVRFHESDVSWATRWGKYLHVYDPKVQWYXXXXXXXXXXXXX 305
           G  L L+E  D  V  TYSV F  S  SW TRW KYLHVYDPK+QW+             
Sbjct: 256 GKSLTLNEEEDNNVHSTYSVTFVPSKTSWVTRWDKYLHVYDPKIQWFSLINFSLIVILLS 315

Query: 306 XXXXXXXFRALKTDLDRYNDFNLDNEFQEDYGWKLLHSDVFRSPSKTLLLSVFVGSGGQL 365
                   +ALK+D  RYN+ NLD++ +E+ GWKL+H  VFR P   ++LS+ VGSG QL
Sbjct: 316 VILINSLLKALKSDFARYNNINLDDDVKEESGWKLVHGYVFRIPKNPMILSILVGSGFQL 375

Query: 366 FLMSACTLFIAMLGFLSPSSRGSLGTIMFVLYAIFGGFGSYLSMSTYKMFGGEKWKVNMV 425
           FL+  CT+F+A +  LSP  RG+L T M +LY +FG   SY+SM  YK F G  WKVNM+
Sbjct: 376 FLVIVCTVFLAAIDILSPIYRGALPTAMIILYILFGFISSYVSMGVYKFFKGPYWKVNML 435

Query: 426 LTPLLVPGIIFATMLLMNFFLVMVQSSGAMPFGTMLAIVVLWFVLSIPISIMGSLFARKK 485
           LTP+LVPG+I  T L +N FL+  +SS  +P  T++ +++LWF +SIP+S+ GSL A+KK
Sbjct: 436 LTPILVPGLIIITFLALNLFLMFSESSSVVPAKTIMTLILLWFAVSIPLSVAGSLMAQKK 495

Query: 486 NTWDQHPTKTSQIAKQIPPQPWYLRTWPAAYIAGLFPFGAIAVELYFIYTSIWXXXXXXX 545
             WD+HPT T+QIAK IPPQ WYL+T PA+ I GLF FG+I+V+LYFIYTS+W       
Sbjct: 496 CHWDEHPTVTNQIAKVIPPQKWYLKTIPASLIGGLFSFGSISVQLYFIYTSLWFNNIFYM 555

Query: 546 XXXXXXXXXXXXXXXXXXXXXXXYYSLCMENWSWQWRSFIIGGIGCSTYVFINSILFTKF 605
                                  Y+SLC ENW WQWR F IGG+GCS YV ++S+ F + 
Sbjct: 556 YGFLLFSICLFTMTITLVTILFTYHSLCQENWKWQWRGFFIGGLGCSIYVLLHSLFFIEL 615

Query: 606 RLGGFVTIVLYVGYSLLISFLFCLVTGTIGFVSSLWFVRKIYSSIKVD 653
           +LGGF  I+LY+GYS +++ L  LVTG++GF+SS++F+++I+SS+KVD
Sbjct: 616 KLGGFTNILLYMGYSSVVTALIFLVTGSVGFLSSMFFIKRIFSSVKVD 663

>TDEL0F03810 Chr6 complement(696251..698221) [1971 bp, 656 aa] {ON}
           Anc_8.254 YLR083C
          Length = 656

 Score =  625 bits (1611), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/643 (47%), Positives = 413/643 (64%), Gaps = 12/643 (1%)

Query: 18  YLPGSAPTTYRRGDAIPLLVNHITPTVF--SDDRAGTDGQRDKERXXXXXXXXXPRLHMC 75
           +LPG +PT Y     I L VNH+TP+      D+ G + + DKE           +LH C
Sbjct: 19  FLPGISPTNYDAKSEIALYVNHLTPSRHFQHKDKDGNNIKSDKEHYLYSYDYYNSKLHFC 78

Query: 76  RPDKIEKVSESLGSIIFGDRLHNSPFELKMLEEKSCVALCEKTVPAEDAKFINQLIRSGF 135
           +P+ + + +ESLGS++FGDRL+NSPF+L MLE+KSCV+LC+  +P EDA FIN+LI++GF
Sbjct: 79  KPENVIEQAESLGSVLFGDRLYNSPFKLNMLEDKSCVSLCKSVIPGEDAAFINKLIKNGF 138

Query: 136 FHNWLVDGLPAGREMHDARTNTVFYGTGFELGRV--IRGTEDRNQEEPGEIELQTRRVLQ 193
            HNWLVDGLPAG  +++ R ++     GF LG V  ++G  +     P E       +  
Sbjct: 139 LHNWLVDGLPAGTLINNERESSAHITNGFPLGSVEIMQGVHNGAMATPRE----ETGISA 194

Query: 194 PGESVVA---VPYFINHFEITVDYHKRAEDELRVVGVSVLPRSLQNPVGDKCANSGNGLV 250
            G +VV    +P+  NH++IT+ YH+    + R+VGV V P+S++    + C  +G  + 
Sbjct: 195 HGSNVVVNLELPHLNNHYDITIQYHEPEAGKYRIVGVEVEPKSIKQ-TSNSCEFTGEQIS 253

Query: 251 LSETADTKVTFTYSVRFHESDVSWATRWGKYLHVYDPKVQWYXXXXXXXXXXXXXXXXXX 310
           LSE  D +V +TYSVR+     +WATRW  Y   YD  VQW+                  
Sbjct: 254 LSEDQDNEVLYTYSVRYVRFSHTWATRWDNYRFSYDTTVQWFSLISCVIVVIGLSSVVLH 313

Query: 311 XXFRALKTDLDRYNDFNLDNEFQEDYGWKLLHSDVFRSPSKTLLLSVFVGSGGQLFLMSA 370
              RALK+D  RYN+ NLD+EF E+ GWKL H DVFR P+K+LLLSV VGSG QL L++ 
Sbjct: 314 MLLRALKSDFARYNELNLDDEFHEESGWKLSHGDVFRMPNKSLLLSVLVGSGVQLLLLAV 373

Query: 371 CTLFIAMLGFLSPSSRGSLGTIMFVLYAIFGGFGSYLSMSTYKMFGGEKWKVNMVLTPLL 430
             + IA + F +  SR  L TI FVLYA+FG  GSY SM  Y+ F G   KVNM+LTP L
Sbjct: 374 GGIVIAAIAFNNAGSREVLPTIFFVLYALFGFVGSYASMGVYRFFKGPYPKVNMILTPFL 433

Query: 431 VPGIIFATMLLMNFFLVMVQSSGAMPFGTMLAIVVLWFVLSIPISIMGSLFARKKNTWDQ 490
           +PG+I  T++ +NFFL++  SS A+PF  + A+V+LW ++S+P+S+ GSL A K  +WDQ
Sbjct: 434 IPGLILLTIISLNFFLLIAHSSDAIPFSALFAVVLLWLIISVPLSLAGSLTAIKTCSWDQ 493

Query: 491 HPTKTSQIAKQIPPQPWYLRTWPAAYIAGLFPFGAIAVELYFIYTSIWXXXXXXXXXXXX 550
           HPTKT+QIA+QIP QPWYL+T PAA +AG+FPF +IAVELYFIY S+W            
Sbjct: 494 HPTKTNQIARQIPFQPWYLKTLPAALVAGIFPFASIAVELYFIYNSLWFHQFFYMFGFSM 553

Query: 551 XXXXXXXXXXXXXXXXXXYYSLCMENWSWQWRSFIIGGIGCSTYVFINSILFTKFRLGGF 610
                             Y+SLC+ENW WQWRSFI+GG+G + Y+FI+SI FT+F+L GF
Sbjct: 554 VSLFLLVLTTALVTVMITYHSLCLENWQWQWRSFIVGGLGSAVYIFIHSIFFTEFKLRGF 613

Query: 611 VTIVLYVGYSLLISFLFCLVTGTIGFVSSLWFVRKIYSSIKVD 653
            TIVLYVGYS+LIS L CL TG +GF SS++ VRKI+SS+KVD
Sbjct: 614 TTIVLYVGYSMLISILCCLTTGAVGFFSSMFLVRKIFSSVKVD 656

>Ecym_4317 Chr4 (685854..687671) [1818 bp, 605 aa] {ON} similar to
           Ashbya gossypii AGR097W
          Length = 605

 Score =  611 bits (1576), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 309/638 (48%), Positives = 401/638 (62%), Gaps = 48/638 (7%)

Query: 16  GFYLPGSAPTTYRRGDAIPLLVNHITPTVFSDDRAGTDGQRDKERXXXXXXXXXPRLHMC 75
           GFY PG +P TY  GD IPLLVN+++    SD     D   D              + +C
Sbjct: 16  GFYFPGVSPVTYHIGDEIPLLVNYLS----SDFLWNIDYYSDS-------------IGLC 58

Query: 76  RPDKIEKVSESLGSIIFGDRLHNSPFELKMLEEKSCVALCEKTVPAEDAKFINQLIRSGF 135
           +P+ I++ SESLGS+IFGDRL+NSPF++ ML+   CV LC+ T+   D    N      +
Sbjct: 59  KPNTIKEQSESLGSVIFGDRLYNSPFKVSMLKNSECVKLCDTTI---DTALWNTFFGYRY 115

Query: 136 FHNWLVDGLPAGREMHDARTNTVFYGTGFELGRVIRGTEDRNQEEPGEIELQTRRVLQPG 195
            +NWLVDGLP                    LG  I GT D N              L  G
Sbjct: 116 SYNWLVDGLPV-------------------LG--IDGTSDANG-------YHNNSELFMG 147

Query: 196 ESVVAVPYFINHFEITVDYHKRAEDELRVVGVSVLPRSLQNPVGDKCANSGNGLVLSETA 255
                  Y  NHF+I + Y+ R + E RVV     P SL     + C+     + +    
Sbjct: 148 YQADEQKYIYNHFDIYIHYNDRGKGEYRVVFAEAKPISLPRTGSELCSKDAKPVPIGSGN 207

Query: 256 DTKVTFTYSVRFHESDVSWATRWGKYLHVYDPKVQWYXXXXXXXXXXXXXXXXXXXXFRA 315
              +TFTYSV F +SD+SW+TRW +YLHVYD  +Q                      FR 
Sbjct: 208 HENITFTYSVIFKKSDISWSTRWDQYLHVYDFDIQLAELISFSLVVLLLSSVLVHSLFRV 267

Query: 316 LKTDLDRYNDFNLDNEFQEDYGWKLLHSDVFRSPSKTLLLSVFVGSGGQLFLMSACTLFI 375
           LK D+  Y++FNLD+EFQ+DY WK++H +VFRSPSK LLLSVFVGSG QLF M+ CT+ +
Sbjct: 268 LKRDIAAYSEFNLDDEFQQDYCWKIIHGEVFRSPSKALLLSVFVGSGSQLFFMALCTVLL 327

Query: 376 AMLGFLSPSSRGSLGTIMFVLYAIFGGFGSYLSMSTYKMFGGEKWKVNMVLTPLLVPGII 435
              GFLSPS+RGSLGT+MFVLYA+FGG GSY SMS YK FGG+ WK+N++LTPLL+P  +
Sbjct: 328 GSCGFLSPSARGSLGTVMFVLYALFGGVGSYTSMSIYKFFGGQNWKLNLILTPLLIPVFL 387

Query: 436 FATMLLMNFFLVMVQSSGAMPFGTMLAIVVLWFVLSIPISIMGSLFARKKNTWDQHPTKT 495
           F T +L+NFFL+  +SSGAMPFGTM+ I++LWF+LS+P+SI+GSL + K N WD+HP KT
Sbjct: 388 FVTTVLLNFFLIYAKSSGAMPFGTMVTIIILWFILSVPVSIIGSLLSWKLNRWDEHPAKT 447

Query: 496 SQIAKQIPPQPWYLRTWPAAYIAGLFPFGAIAVELYFIYTSIWXXXXXXXXXXXXXXXXX 555
           +QIA+Q+P QPWY++TW A ++AG+FPFGA+AVELY+IY SIW                 
Sbjct: 448 NQIARQVPSQPWYIKTWVATFLAGMFPFGAMAVELYYIYASIWGEIIFFMYGFLFVAFIL 507

Query: 556 XXXXXXXXXXXXXYYSLCMENWSWQWRSFIIGGIGCSTYVFINSILFTKFRLGGFVTIVL 615
                        YYSLCMENW WQWRSFIIGG+GCS YVF++S+ F KF+  GFV++VL
Sbjct: 508 LTLTTSLVTILLTYYSLCMENWKWQWRSFIIGGVGCSVYVFLHSLFFIKFKFPGFVSMVL 567

Query: 616 YVGYSLLISFLFCLVTGTIGFVSSLWFVRKIYSSIKVD 653
           Y+GYS ++S + CLVTG+IGF+++LWFVRKIYS+IKVD
Sbjct: 568 YLGYSAMVSIVCCLVTGSIGFLANLWFVRKIYSNIKVD 605

>NDAI0J01420 Chr10 (326749..328608) [1860 bp, 619 aa] {ON} Anc_8.254
          Length = 619

 Score =  587 bits (1512), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/614 (46%), Positives = 386/614 (62%), Gaps = 9/614 (1%)

Query: 48  DRAGTDGQRDKERXXXXXXXXXPRLHMCRPDKIEKVSESLGSIIFGDRLHNSPFELKMLE 107
           ++ G D   D +R          +LH C+P+ +EK   S+GS++FGDRL+NSPF+L ML+
Sbjct: 7   NQEGQDISTDDKRTIYSYDYYYEKLHFCKPEHVEKAGVSIGSVLFGDRLYNSPFQLNMLK 66

Query: 108 EKSCVALCEKTVPAEDAKFINQLIRSGFFHNWLVDGLPAGREMHDARTNTVFYGTGFELG 167
            K+C  LC  T+   DAKFIN+LI++G++ NWL+DGLPA RE++D RT + FYG GFELG
Sbjct: 67  NKTCERLCNSTIIGRDAKFINKLIKNGYYQNWLIDGLPAAREVYDTRTKSNFYGNGFELG 126

Query: 168 RV-IRGTEDRNQEEPGEIEL-------QTRRVLQPGESVVAVPYFINHFEITVDYHKRAE 219
            V IR T    +  P   +          + ++Q     + VPYF+NHF+I ++YH R  
Sbjct: 127 LVEIRQTTGE-KLLPNSADTFRDLHKRDAKNIVQNLMQDIEVPYFVNHFDIRIEYHDRGN 185

Query: 220 DELRVVGVSVLPRSLQNPVGDKCANSGNGLVLSETADTKVTFTYSVRFHESDVSWATRWG 279
           D  RVVGV+V P S+       C  +G  L LSE+    + FTYSV F  S+ +W TRW 
Sbjct: 186 DNYRVVGVTVNPVSIDRSPDGGCKPTGKALSLSESEVNYIHFTYSVEFIPSETAWVTRWD 245

Query: 280 KYLHVYDPKVQWYXXXXXXXXXXXXXXXXXXXXFRALKTDLDRYNDFNLDNEFQEDYGWK 339
           KYLHVYDP +QW                      +ALK+D  RY + NLD   +ED  WK
Sbjct: 246 KYLHVYDPTIQWVSIVNFSIVVIILSCAVARSLLQALKSDFSRYGELNLDETIKEDASWK 305

Query: 340 LLHSDVFRSPSKTLLLSVFVGSGGQLFLMSACTLFIAMLGFLSPSSRGSLGTIMFVLYAI 399
           L H DVFR+P   +LLS+ VGSG QLFLM  CT+F+  +G ++P SRG+L T+MF+LY  
Sbjct: 306 LGHGDVFRAPDHPMLLSILVGSGVQLFLMIICTIFLPAVGLITPGSRGTLPTVMFLLYLG 365

Query: 400 FGGFGSYLSMSTYKMFGGEKWKVNMVLTPLLVPGIIFATMLLMNFFLVMVQSSGAMPFGT 459
           F    S++SM  YK F G+KW +N +LTP LVPG++   ++ +N FL+ V SSG +P  T
Sbjct: 366 FSFISSFVSMGVYKFFNGQKWHINCILTPFLVPGLLLLVIIGLNIFLIFVHSSGVIPLAT 425

Query: 460 MLAIVVLWFVLSIPISIMGSLFARKKNTWDQHPTKTSQIAKQIPPQPWYLRTWPAAYIAG 519
             ++++LWF + +P+SI GSL ARK   WD HPTKT+ ++K IPPQ WYL+T PA+ I G
Sbjct: 426 FTSLILLWFFIGVPLSITGSLMARKTCHWDIHPTKTNTVSKVIPPQKWYLQTIPASLIGG 485

Query: 520 LFPFGAIAVELYFIYTSIWXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYYSLCMENWSW 579
           LF FG+++VELYF+YTS+W                              YYSL  ENW W
Sbjct: 486 LFSFGSLSVELYFVYTSLWFNKIFYMYGFLFGSAILFTLTVSLVTVLFTYYSLSAENWQW 545

Query: 580 QWRSFIIGGIGCSTYVFINSILFTKFRLGGFVTIVLYVGYSLLISFLFCLVTGTIGFVSS 639
           QWRSF+I G+GCS YVF++S+LFT+ +LGGF   +LY+GYS +I+ L  +VTG +GF+SS
Sbjct: 546 QWRSFLIAGLGCSFYVFLHSLLFTEVKLGGFTNALLYMGYSFVITSLAFVVTGALGFLSS 605

Query: 640 LWFVRKIYSSIKVD 653
           + FVR IYS++KVD
Sbjct: 606 MLFVRTIYSAVKVD 619

>TDEL0C02710 Chr3 complement(474759..476795) [2037 bp, 678 aa] {ON}
           Anc_7.411 YER113C
          Length = 678

 Score =  138 bits (348), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 153/678 (22%), Positives = 266/678 (39%), Gaps = 99/678 (14%)

Query: 24  PTTYRRGDAIPLLVNHITPTVFSDDRAGTDGQRDKERXXXXXXXXXPRLHMCRPDKIEK- 82
           P  YR GD + LLVN +     SD      G  D                 C P + +K 
Sbjct: 43  PNVYRWGDHVELLVNKVE----SDLTQFPYGYYDLP-------------FTCPPTEDKKP 85

Query: 83  VSESLGSIIFGDRLHNSPFELKMLEEKSCVALCEKTVPAEDAKFINQLIRSGFFHNWLVD 142
           +  SL  II GDR   S ++LK  ++ SC ALC +       +   +L+R G+   WL+D
Sbjct: 86  LHLSLNEIIRGDRKWESDYKLKFGQDASCEALCARKTKPAGMRRAQELVRQGYVVQWLID 145

Query: 143 G-LPAGREMHDARTNTVFYGTGFELGRVIRGTEDRNQEEPGEIELQTRRVLQPGESVVAV 201
             LPA         +  +Y +GF LG V   TE                           
Sbjct: 146 QELPAATTFISTIDHKKYYVSGFPLGFVDPDTEK-------------------------- 179

Query: 202 PYFINHFEITVDYHKRAEDELRVVGVSVLPRSLQNPVGDKCANSGNG-----LVLSETAD 256
            Y   H  + + Y+    +   +VG  V P+S+ +     C  +  G     L++ E  D
Sbjct: 180 TYLNTHVMMVIRYNAIDPETFTIVGFEVYPKSVSDY---HCPGASKGYEQYELIVPENED 236

Query: 257 --TKVTFTYSVRFHES-DVSWATRWGKYLH------VYDPKVQWYXXXXXXXXXXXXXXX 307
             T + FTYSV + E   V W+ RW  +L+          +  W                
Sbjct: 237 ELTYIPFTYSVYWREEFKVDWSHRWNFFLNSGEMSEASSRRFHWMTLGNSVGISFLLMLI 296

Query: 308 XXXXXFRALKTDLDRYND---FNLDNEFQEDYGWKLLHSDVFRSPSKTL---LLSVFVGS 361
                +R ++   +  ++   F  D   + D  + +  + + ++ S ++   +L++FV  
Sbjct: 297 VIANLYRIVRVGHEAGSEEFQFTFDENEEADSIYGVAKTWLAQTDSSSISFKILTIFVSI 356

Query: 362 GGQ-LFLMSACTLFIAMLGFLSPSSRGSLGTIMFVL------YAIFGGFGSYLSMSTYKM 414
           G Q LF +     F   L  L       L    F L      + +F G   ++   T   
Sbjct: 357 GVQFLFTIIGSLAFSCSLNKLHNIRNSVLSVASFFLCHWSYLWHLFVGTWLHIDHRTTND 416

Query: 415 FGGEKWKVNMVLTPLLVPGIIFATMLLMNFFLVMVQSSGAMPFGTMLAIVVLWFVLSIPI 474
               + +   +L    +PG++  +  ++N+ +   +SS A+PF T++  V ++FV+ IP+
Sbjct: 417 GSAGRCRTFSILCGSALPGLVMISTQMLNWIVWANESSHALPFRTIVLFVSIYFVICIPL 476

Query: 475 SIMGSLFARK--KNTWDQHPTKTSQIAKQIPP--QPWYLR----------TWPAAYIAGL 520
           S++G   + +  +      P  +S  A+ I P   P  L            +    I G 
Sbjct: 477 SLLGEEVSHRVHRKQAQNFPILSSLGARSIKPCRAPTTLAPRKISERLTFDFATFAICGF 536

Query: 521 FPFGAIAVELYFIYTSIWXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYYSLCMENW--- 577
            PF  I VEL +IY S+W                                 + M      
Sbjct: 537 LPFAVIYVELQYIYKSVWLEKTDFYYLYGFLLANIILLCIVVCEVSFLGCYVMMRKHKRV 596

Query: 578 ----SWQWRSFIIGGIGCSTYVFINSI--LFTKFRLGGFVTIVLYVGYSLLISFLFCLVT 631
               SW+W+ F++ G  C+ Y+ + S+  +F   ++ GF +I + V YSL+ + +     
Sbjct: 597 ATFDSWRWKCFMM-GTSCAWYMELYSLYYIFHTLKMTGFPSIFISVSYSLIFNIMCGCGM 655

Query: 632 GTIGFVSSLWFVRKIYSS 649
           G++G+++S W V +++ +
Sbjct: 656 GSLGYLTSCWLVNRVFCT 673

>NCAS0A14520 Chr1 complement(2860704..2862716) [2013 bp, 670 aa]
           {ON} Anc_7.411 YER113C
          Length = 670

 Score =  136 bits (342), Expect = 8e-33,   Method: Compositional matrix adjust.
 Identities = 167/677 (24%), Positives = 263/677 (38%), Gaps = 109/677 (16%)

Query: 24  PTTYRRGDAIPLLVNHITPTVFSDDRAGTDGQRDKERXXXXXXXXXPRLHMCRPDKIEKV 83
           P  Y +GD + L+VN +   +     A  D                P +H       + +
Sbjct: 44  PNYYSKGDPVELIVNKVESDLTQLPYAYYD----------LPFTCPPTMHK------KPL 87

Query: 84  SESLGSIIFGDRLHNSPFELKMLEEKSCVALCEKTVPAEDAKFINQLIRSGFFHNWLVDG 143
             SL  II GDR   S + L   E+  C  LC +    E  K   +L+++G+   WL+D 
Sbjct: 88  HLSLNEIIRGDRKWQSDYILNFGEDDQCHILCTRKTTKEGMKEAQELVKNGYVVQWLIDD 147

Query: 144 -LPAGREMHDARTNTVFYGTGFELGRVIRGTEDRNQEEPGEIELQTRRVLQPGESVVAVP 202
            LPA         +  +Y +GF LG V          E G+  L T              
Sbjct: 148 ELPAVTTFISTTDHKKYYASGFPLGFV--------DPETGKTYLNT-------------- 185

Query: 203 YFINHFEITVDYHKRAEDELRVVGVSVLPRSLQNPVGDKCANSGNG-----LVLSETAD- 256
               H  I + Y+    ++  + G  + P+S    V   C  +        LV+ E  D 
Sbjct: 186 ----HVMIVIRYNTVDTNKHTIFGFELYPKS---TVDFHCPGASKDYEQYELVVPENDDD 238

Query: 257 -TKVTFTYSVRFHESD-VSWATRWGKYLHVYD------PKVQWYXXXXXXXXXXXXXXXX 308
            T + FTYSV + E   V W  RW  YL+  +       +  W                 
Sbjct: 239 LTFIPFTYSVYWREEYLVDWEHRWDLYLNAGELSNDKSKQFHWISLANSFGIVFLISSIT 298

Query: 309 XXXXFRALKTDLDRYNDFNLDNEFQEDYG--------WKLLHSDVFRSPSKTLLLSVFVG 360
               +R  K     ++D + +   ++D G        W L      ++P   +L+ +FV 
Sbjct: 299 AVILYRTFKISRRSFSDISKE---EDDKGSIYVVARKWLLNE----QTPLANVLI-IFVS 350

Query: 361 SGGQLFLMSACTLFIAMLGFLSPSSRGS---LGTIMFVLYAIFGGF-GSYLSMSTYKMFG 416
            G Q       +L I+       + R S   +G + FV  A    F G++L  S  +M  
Sbjct: 351 MGVQFLFTVLGSLIISCSLKKLHNVRDSVLTMGLLCFVTGAFMASFTGAHLLKSREEMCS 410

Query: 417 GEKWK------VNMVLTPLLVPGIIFATMLLMNFFLVMVQSSGAMPFGTMLAIVVLWFVL 470
             + K      V  +L   L+P  +    LL+N  +    S+ A+PFGT+L ++ ++FV+
Sbjct: 411 ESQMKPTRYYPVFALLCGSLLPSFVMLVALLLNSIVWAHDSTHALPFGTVLFLISVYFVV 470

Query: 471 SIPISIMGSLFARKKNTWDQHPTKTSQIA---------KQIPPQPWYLRTWPAAYIA--- 518
            IP+S++G   A K    +  P+ +  I          K I   P  L   P + +A   
Sbjct: 471 CIPLSLLGGYIAVKST--NSKPSFSFSIGNYSDRIFVYKTITMSPSVLINRPLSSLAILA 528

Query: 519 -GLFPFGAIAVELYFIYTSIWXXXXXXX-----XXXXXXXXXXXXXXXXXXXXXXXYYSL 572
            GLFPF  I VEL ++Y S+W                                     S 
Sbjct: 529 GGLFPFIIIYVELQYVYKSLWLEKTTFYYFYGFLLANILLLCIVICEISIIGTFILLNSA 588

Query: 573 CMENWSWQWRSFIIGGIGCSTYVFINSILFTKFRLG--GFVTIVLYVGYSLLISFLFCLV 630
              + +W+W SF IG   C+ Y+ + S+ +  F L   GF +I + V Y  L + +    
Sbjct: 589 DKNSNNWRWTSFQIGA-SCAFYMEVYSLYYVFFILNIRGFSSIFISVCYGTLFNIMCGCA 647

Query: 631 TGTIGFVSSLWFVRKIY 647
           TG+I  ++S WFV+KIY
Sbjct: 648 TGSIACLTSHWFVQKIY 664

>ZYRO0B03784g Chr2 complement(314902..316878) [1977 bp, 658 aa] {ON}
           similar to uniprot|P40071 Saccharomyces cerevisiae
           YER113C Hypothetical ORF
          Length = 658

 Score =  129 bits (325), Expect = 9e-31,   Method: Compositional matrix adjust.
 Identities = 164/667 (24%), Positives = 262/667 (39%), Gaps = 97/667 (14%)

Query: 24  PTTYRRGDAIPLLVNHITPTVFSDDRAGTDGQRDKERXXXXXXXXXPRLHMCRPDKIEK- 82
           P  Y  GD + L+VN    TV S+      G  D                 C P   +K 
Sbjct: 43  PNVYSIGDPLELVVN----TVESEITDIPFGYYDLP-------------FTCPPTPEKKP 85

Query: 83  VSESLGSIIFGDRLHNSPFELKMLEEKSCVALCEKTVPAEDAKFINQLIRSGFFHNWLV- 141
           +  SL  II GDR   S ++L + ++  C  LC +    E  +    LI+SG+   W++ 
Sbjct: 86  LHLSLNEIIKGDRKWESDYKLVVGQDNPCEILCARKTTREGLQTAKDLIKSGYMVQWMID 145

Query: 142 DGLPAGREMHDARTNTVFYGTGFELGRVIRGTEDRNQEEPGEIELQTRRVLQPGESVVAV 201
           D LPA         N  +Y  GF LG V                        P  S V  
Sbjct: 146 DDLPAATTYISTTDNLKYYAPGFPLGSV-----------------------DPRSSRV-- 180

Query: 202 PYFINHFEITVDYHKRAEDELRVVGVSVLPRSLQNPVGDKCANSGNGLVLSETAD----- 256
            +F NH  + + Y+    D++ +VG    P+S+ +     C  +       E  D     
Sbjct: 181 -FFNNHVMLVIRYNLVDSDKVTIVGFEAYPKSVSD---YHCPGASKDFKPFEITDPPLEE 236

Query: 257 -TKVTFTYSVRFHE-SDVSWATRWGKYLHVYDPKVQWYXXXXXXXXXXXXXXXXXXXXFR 314
              +  TYSV + E +++ W+ RW  Y++    + Q                      F 
Sbjct: 237 IVYIPVTYSVYWREDAEIDWSDRWSLYIN----RAQLADSSSSTFHWMALANSVGIVLFV 292

Query: 315 ALKTDLDRYNDFNLDNEFQEDYGWKLLHSDVFRSPSKTL---------LLSVFVGSGGQL 365
                ++    F   NE Q +       SD+F   +  L          L V V  G Q+
Sbjct: 293 TFIVIVNLIMIFRNPNE-QLESKENEDSSDIFNVANNWLRARQGFQLNRLIVCVSMGIQV 351

Query: 366 FLMSACTLFIAMLGFLSPSSRGSLGTI---MFVLYAIFGGF-GSYLSM----STYKMFGG 417
             M    L I++      + + S+ TI    FV  A    F G++L M    S Y  +  
Sbjct: 352 MFMILGPLAISLSLTRLHNIKNSVLTIAALCFVAGAFMASFVGTWLKMDQNISAYTFYN- 410

Query: 418 EKWKVNMVLTPLLVPGIIFATMLLMNFFLVMVQSSGAMPFGTMLAIVVLWFVLSIPISIM 477
               V  VL    +PG I    L +N  + +  S+ A+PFGTM+  V  +FV+ I +S++
Sbjct: 411 ---PVFAVLCGSALPGSIMVLTLSLNCIIWIWDSTKALPFGTMVVFVSWYFVVCIVVSLL 467

Query: 478 GSLFARKKNTWDQH---PTKTS---QIAKQIPPQPWYLRTWPAAYIAGLFPFGAIAVELY 531
           G   A + +   +H   P  T+   ++ ++       L  + A  I+G  PF  I VEL 
Sbjct: 468 GGAVAAQMHRSVRHDAPPATTASDRKVLRRSRAISGKLVVFLAGLISGFLPFVIIYVELE 527

Query: 532 FIYTSIWXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYYSLCME-------NWSWQWRSF 584
           ++Y S+W                                 + M+       + +W+WR F
Sbjct: 528 YLYKSVWLEKTTLYYLYSFLFANVLLLCIVVCEISLLGCLVLMKLNHKFINDQNWRWRCF 587

Query: 585 IIGGIGCSTYVFINSILFTKF--RLGGFVTIVLYVGYSLLISFLFCLVTGTIGFVSSLWF 642
           +I   GCS Y+ I S+ +  F   + G   + + V YS + + L  L TG++G+++S WF
Sbjct: 588 VIST-GCSWYMEIYSLYYIFFIIHMTGDSAVFISVCYSFIFNVLCGLATGSLGYLTSSWF 646

Query: 643 VRKIYSS 649
           V+KI+ +
Sbjct: 647 VKKIHRT 653

>YER113C Chr5 complement(387932..390052) [2121 bp, 706 aa] {ON}
           TMN3Protein with a role in cellular adhesion and
           filamentous growth; similar to Emp70p and Tmn2p; member
           of Transmembrane Nine family with 9 transmembrane
           segments; localizes to Golgi; induced by
           8-methoxypsoralen plus UVA irradiation
          Length = 706

 Score =  127 bits (318), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 152/696 (21%), Positives = 264/696 (37%), Gaps = 119/696 (17%)

Query: 23  APTTYRRGDAIPLLVNHITPTVFSDDRAGTDGQRDKERXXXXXXXXXPRLHMCRPDKIEK 82
            P  YR+GD + L+VN +   +     A  D                P +H       + 
Sbjct: 53  TPNFYRKGDPLELIVNKVESDLTQLPYAYYD----------LPFTCPPTMHK------KP 96

Query: 83  VSESLGSIIFGDRLHNSPFELKMLEEKSCVALCEKTVPAEDAKFINQLIRSGFFHNWLVD 142
           +  SL  II GDR   S ++LK  E+  C  LC +    E  + +++L+R G+   WL+D
Sbjct: 97  LHLSLNEIIRGDRKWESDYKLKFGEDNPCETLCARKTTKEGMQTLDKLVREGYVVQWLID 156

Query: 143 G-LPAGREMHDARTNTVFYGTGFELGRVIRGTEDRNQEEPGEIELQTRRVLQPGESVVAV 201
             LPA         +  +Y +GF LG +   T+                           
Sbjct: 157 DELPAATTFISTTDHKKYYASGFPLGFIDPDTDKT------------------------- 191

Query: 202 PYFINHFEITVDYHKRAEDELRVVGVSVLPRSLQN---PVGDKCANSGNGLVLSETAD-T 257
            Y  NH  + + +H    D+  +VG  V PRS+ +   P   K       ++  +  + T
Sbjct: 192 -YLHNHVMLVIRFHASDNDKNTIVGFEVYPRSVSDYHCPGASKNYEQYEIVIPEDENELT 250

Query: 258 KVTFTYSVRFHES-DVSWATRWGKYLHVYD------PKVQWYXXXXXXXXXXXXXXXXXX 310
            + FTYSV + E  +V W  RW  +L+  +       +  W                   
Sbjct: 251 YLPFTYSVYWREEFEVDWNHRWDYFLNAGELSDEQSIQFHWMSLANSVGIVLSISFITLI 310

Query: 311 XXFRALKTDLD-----RY--------NDFNLDNEFQEDYGWKLLHSDVFRSPSKTL---- 353
              R + TD       +Y         + +LD++    Y    +  D  ++    L    
Sbjct: 311 IYVRVMYTDKSNSKSPKYMINIEGIETEDDLDDDKYGKYSVYTVAKDWIQNGRPNLFGLK 370

Query: 354 LLSVFVGSGGQLFLMSACTLFIAMLGFLSPSSRGSLGTIMFVLYAIFGGF-----GSYLS 408
           +L + V  G Q       +L I+       + R S+ T M +L+ + G F     G+ LS
Sbjct: 371 VLILLVSFGVQFLFTIIGSLTISCSMNKLHNVRNSVLT-MAILFFVLGAFMASFVGTRLS 429

Query: 409 MST------------------YKMFGGEKWKVNMVLTPLLVPGIIFATMLLMNFFLVMVQ 450
           M T                  YK F      +  +L    +PGI+  +  L+N  +    
Sbjct: 430 MVTKTKRTKANYLDDNRYLKDYKKFS----PIFTILCGSSLPGIVMVSTFLLNSIVWAHD 485

Query: 451 SSGAMPFGTMLAIVVLWFVLSIPISIMGSLFARK---KNTWDQHPTKTSQIAKQ----IP 503
           S+ A+PF T++  + ++F++ IP+S+ G + A        W    TK    +      +P
Sbjct: 486 STSALPFKTIVFFMSIYFIVCIPLSLFGGIVANNIPLPQYWLSGITKDESNSDGNGLFVP 545

Query: 504 PQPWYLR--TWPAAYIAGLFPFGAIAVELYFIYTSIWXXXXXXXX----XXXXXXXXXXX 557
                     +   Y+ G+FP   I VE+ ++Y S+W                       
Sbjct: 546 KSRAKFNPLVYCGIYLCGIFPLLVIYVEMQYVYKSLWLEKTTFYYFYGFLFLSIILLCVL 605

Query: 558 XXXXXXXXXXXYYSLCMENW----SWQWRSFIIGGIGCSTYVFINSI--LFTKFRLGGFV 611
                          C E+     +W+W+ F +G  G   Y+ + S+  +F    + GF 
Sbjct: 606 TMEISIIGSYLLMRFCFEDKVVRNNWRWKCFEMGFSG-GVYMELYSLYYIFAVLNIHGFS 664

Query: 612 TIVLYVGYSLLISFLFCLVTGTIGFVSSLWFVRKIY 647
           +I++ + YSL+ + +  L  G + ++++ WF+ KIY
Sbjct: 665 SILISICYSLIFNVMCSLGLGALSYLTASWFINKIY 700

>NDAI0A01510 Chr1 (335693..337732) [2040 bp, 679 aa] {ON} Anc_7.411
           YER113C
          Length = 679

 Score =  124 bits (311), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 158/680 (23%), Positives = 263/680 (38%), Gaps = 108/680 (15%)

Query: 24  PTTYRRGDAIPLLVNHITPTVFSDDRAGTDGQRDKERXXXXXXXXXPRLHMCRPDKIEK- 82
           P  Y +GD + L+VN +   +     A  D                P    C P   +K 
Sbjct: 43  PNFYFQGDEVELIVNKVESDLTQLPYAYYD---------------LP--FTCPPTMHKKP 85

Query: 83  VSESLGSIIFGDRLHNSPFELKMLEEKSCVALCEKTVPAEDAKFINQLIRSGFFHNWLVD 142
           +  SL  II GDR   S + LK  ++ +C  LC +    E  K   +L+  G+   WL+D
Sbjct: 86  LHLSLNEIIRGDRKWQSDYILKFGQDDTCHILCTRKTTKEGLKNAKKLVEDGYVVQWLID 145

Query: 143 G-LPAGREMHDARTNTVFYGTGFELGRVIRGTEDRNQEEPGEIELQTRRVLQPGESVVAV 201
             LPA            +Y +GF LG V          + G++ L T             
Sbjct: 146 EELPAATTFISTIDQKKYYASGFPLGFV--------DPDTGKVYLNT------------- 184

Query: 202 PYFINHFEITVDYHKRAEDELRVVGVSVLPRSLQNPVGDKCANSGNG-----LVLSETAD 256
                H  + + Y+    ++  +VG  V P+S+ +     C  +        +V+ E  D
Sbjct: 185 -----HVMLVIRYNTVDVNKHTIVGFEVYPKSVSDF---HCPGASKNYEPYEIVIPENDD 236

Query: 257 --TKVTFTYSVRFHESD-VSWATRWGKYLHVYD------PKVQWYXXXXXXXXXXXXXXX 307
             T + FTYSV + E   V W  RW  YL+  +       +  W                
Sbjct: 237 DLTFIPFTYSVYWREEYLVDWDHRWDLYLNSGELSENKTTQFHWISLANSAGIVFLMSFV 296

Query: 308 XXXXXFRALKTDLDRYNDFNLDNEFQEDYGWKLLHSDVF--RSPSKTLLLSVFVGSGGQL 365
                 R+ K+  D   D N   E +    +++  + +   R+P   LL+ +FV  G Q 
Sbjct: 297 VSVILLRSFKSSRDISTDINKSEEHRNGLVYEVARNWIINERTPLANLLI-LFVSMGVQF 355

Query: 366 FLMSACTLFIAMLGFLSPSSRGSLGTIMFVLYAIFGGFGSYLSMSTYKMFGGEKWKVNMV 425
                 +L I+     S +    +G  +  +  +    G+++S     +    K K  M 
Sbjct: 356 LFTVLGSLTIS----CSLNKLHDIGDSVLTMAVLCFVLGAFMSSYIGSVLLRLKNKATMK 411

Query: 426 LTPL--------------LVPGIIFATMLLMNFFLVMVQSSGAMPFGTMLAIVVLWFVLS 471
             P+               +PGI+    LL+N  +    S+ A+PF T++  + ++F++ 
Sbjct: 412 KQPIKKGFHLFFAILCGSFLPGIVMIVTLLLNSIVWAHDSTHALPFKTVVMFITVYFIVC 471

Query: 472 IPISIMGSLFA---RKKNTWDQHPTKTSQ-----IAKQIPPQPWY------LRTWPAAY- 516
           IP+SI+G   A   + K +       TS+      A ++ P+         L++   A  
Sbjct: 472 IPLSILGGYMANSSKTKGSLTDPKFHTSRPELELFANKLKPKKHIFLFGARLKSIKIALP 531

Query: 517 --IAGLFPFGAIAVELYFIYTSIWXXXXXXXXXX--XXXXXXXXXXXXXXXXXXXXYYSL 572
             ++G+FPF  I VEL ++Y S+W                                Y  L
Sbjct: 532 ILLSGIFPFVIIYVELQYVYKSVWLEKTAFYYFYGFLFANILLLCIVVGEIAIIGTYTML 591

Query: 573 CM---ENWSWQWRSFIIGGIGCSTYVFINSILFTKFRLG--GFVTIVLYVGYSLLISFLF 627
            M    N  W+W SF +G   C+ Y+ + S+ +  F L   GF +I + V Y  L + L 
Sbjct: 592 HMADRNNTDWRWISFFMGS-SCAWYMELYSLYYVFFILNIRGFSSIFISVCYGALFNTLC 650

Query: 628 CLVTGTIGFVSSLWFVRKIY 647
               G+I  ++S +FV K+Y
Sbjct: 651 GCAMGSIASLTSHFFVEKLY 670

>Smik_5.258 Chr5 complement(396781..398901) [2121 bp, 706 aa] {ON}
           YER113C (REAL)
          Length = 706

 Score =  122 bits (306), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 154/701 (21%), Positives = 276/701 (39%), Gaps = 118/701 (16%)

Query: 23  APTTYRRGDAIPLLVNHITPTVFSDDRAGTDGQRDKERXXXXXXXXXPRLHMCRPDKIEK 82
            P  Y+ GD + L+VN +   +     A  D                P +H         
Sbjct: 53  TPNFYKNGDPLELIVNKVESDLTQLPYAYYD----------LPFTCPPTMHK------TP 96

Query: 83  VSESLGSIIFGDRLHNSPFELKMLEEKSCVALCEKTVPAEDAKFINQLIRSGFFHNWLVD 142
           +  SL  II GDR   S ++L   E+  C  LC +    E  + +++LIR G+   WL+D
Sbjct: 97  LHLSLNEIIRGDRKWESDYKLTFGEDNPCEVLCARKTTKEGMQTLDKLIREGYVVQWLID 156

Query: 143 G-LPAGREMHDARTNTVFYGTGFELGRVIRGTEDRNQEEPGEIELQTRRVLQPGESVVAV 201
             LPA         +  +Y +GF LG +   T                     G++    
Sbjct: 157 DELPAATTFISTTDHKKYYASGFPLGFMDPDT---------------------GKT---- 191

Query: 202 PYFINHFEITVDYHKRAEDELRVVGVSVLPRSLQN---PVGDKCANSGNGLVLSETAD-T 257
            Y  NH  + + +H     +  +VG  V PRS+ +   P   K        +  +  + T
Sbjct: 192 -YLHNHVMLVIRFHSGDNGKNTIVGFEVYPRSVSDYHCPGASKTYEQYEITIPEDENELT 250

Query: 258 KVTFTYSVRFHES-DVSWATRWGKYLHVYD------PKVQWYXXXXXXXXXXXXXXXXXX 310
            + FTYSV + E  +V W  RW  +L+  +       +  W                   
Sbjct: 251 YLPFTYSVYWREEFEVDWNHRWDYFLNSGELSDEQSSQFHWMSFANSVIIVLSISLITLI 310

Query: 311 XXFRALKTDLD--RYNDF--NLDNEFQEDYGWKLLHSDVFRSPSKTLLLSVFVGSG---- 362
                + TD +    N F  N++    ED    +L++D +   S  ++   ++ +G    
Sbjct: 311 IYIGVMHTDKNNPHSNKFMINIEGIGAED----VLNNDKYSKNSVYMVAKDWIQNGKPDL 366

Query: 363 ----GQLFLMSACTLFI-AMLGFLSPS-----------SRGSLGTIMFVLYAIFGGF-GS 405
               G + L+S    F+  ++G L+ S           S  ++  + FV+ A    F G+
Sbjct: 367 FSLKGLIVLVSFGVQFLFTVIGSLTISCSMNKLHNVRNSVLTMAILCFVIGAFMASFVGT 426

Query: 406 YLSMST------YKMFGGEK-WKVNMVLTPLL-------VPGIIFATMLLMNFFLVMVQS 451
            LS+ +         FG  K +K     +P+        +PG+I  +  L+N  +    S
Sbjct: 427 RLSIVSKTRRFNANYFGDNKNFKCREKFSPIFAIICGSSLPGMIMISTFLLNSIVWAHDS 486

Query: 452 SGAMPFGTMLAIVVLWFVLSIPISIMGSLFARKKN---------TWDQHPTKTSQIAKQI 502
           + A+PF T++  + ++F++ IP+S+ G + A             T D+  +K +++    
Sbjct: 487 TNALPFKTIVFFISVYFIVCIPLSLFGGIVANNIPLPQYWLSGITIDESDSKNNKLFLPK 546

Query: 503 PPQPWYLRTWPAAYIAGLFPFGAIAVELYFIYTSIWXXXXXXXX----XXXXXXXXXXXX 558
            P  +        Y+ G+FP   I VE+ ++Y S+W                        
Sbjct: 547 SPNKFNPLVNCGIYLCGVFPLLVIYVEMQYVYKSLWLEKTTFYYFYGFLFLSIILLCVLT 606

Query: 559 XXXXXXXXXXYYSLCMENW----SWQWRSFIIGGIGCSTYVFINSI--LFTKFRLGGFVT 612
                         C E+     +W+W+ F +G  G   Y+ + S+  +F    + GF +
Sbjct: 607 MEISVIGSYLLMRFCFEDKVVRNNWRWKCFEMGFSG-GVYMELYSLYYIFAVLNIHGFSS 665

Query: 613 IVLYVGYSLLISFLFCLVTGTIGFVSSLWFVRKIYSSIKVD 653
           I++ + YSLL + +  L  G + ++++ WF+ KIY  +KV+
Sbjct: 666 ILISICYSLLFNIMCGLGLGALSYLTASWFINKIY-HVKVN 705

>Skud_5.266 Chr5 (431486..433609) [2124 bp, 707 aa] {ON} YER113C
           (REAL)
          Length = 707

 Score =  120 bits (302), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 149/691 (21%), Positives = 262/691 (37%), Gaps = 109/691 (15%)

Query: 23  APTTYRRGDAIPLLVNHITPTVFSDDRAGTDGQRDKERXXXXXXXXXPRLHMCRPDKIEK 82
            P  Y++ D + L+VN +   +     A  D                P +H       + 
Sbjct: 54  TPNFYKKNDFLELIVNKVESDLTQLPYAYYD----------LPFTCPPTMHK------KP 97

Query: 83  VSESLGSIIFGDRLHNSPFELKMLEEKSCVALCEKTVPAEDAKFINQLIRSGFFHNWLVD 142
           +  SL  II GDR   S ++L+  E+ +C  LC +    +  + +++L+R G+   WL+D
Sbjct: 98  LHLSLNEIIRGDRKWESDYKLRFGEDNACETLCARKTDKKGMQTLDKLVREGYVVQWLID 157

Query: 143 G-LPAGREMHDARTNTVFYGTGFELGRVIRGTEDRNQEEPGEIELQTRRVLQPGESVVAV 201
             LPA         +  +Y +GF LG V   T+                           
Sbjct: 158 DELPAATTFISTTDHKKYYASGFPLGFVDPDTDK-------------------------- 191

Query: 202 PYFINHFEITVDYHKRAEDELRVVGVSVLPRSLQN---PVGDKCANSGNGLVLSETAD-T 257
            Y  NH  + + +H   +D+  VVG  V P+S+ +   P   K       +V  +  D T
Sbjct: 192 TYLHNHVILVIRFHGGGDDKNTVVGFEVYPKSVSDYHCPGASKNYEQYEIVVPEDEHDLT 251

Query: 258 KVTFTYSVRFHES-DVSWATRWGKYLHVYD------PKVQWYXXXXXXXXXXXXXXXXXX 310
            + FTYSV + E  +V W  RW  +L+  +       +  W                   
Sbjct: 252 YLPFTYSVYWREEFEVDWNHRWNYFLNAGELSDEQSAQFHWMSLANSLGIVLSISFITFV 311

Query: 311 XXFRALKTDLDRYNDF-------------NLDNEFQEDYGWKLLHSDVFRSPSKTL---- 353
              R ++TD    +               +LD++        ++  D  ++    L    
Sbjct: 312 IYIRVMRTDKKNTDSHKYLINTEGIEAEDSLDDDKYGKNSVYMVTKDWIQNGKPDLFGLK 371

Query: 354 LLSVFVGSGGQLFLMSACTLFIAMLGFLSPSSRGSLGT---IMFVLYAIFGGF-GSYLSM 409
           +L V V  G Q       +L I+       + R S+ T   + FVL A    F G+ L +
Sbjct: 372 VLIVLVSFGVQFLFTIIGSLTISCSMNKLHNVRNSVLTMAILCFVLGAFMASFVGTRLGI 431

Query: 410 STYK-------MFGGEKWKVNMVLTPLL-------VPGIIFATMLLMNFFLVMVQSSGAM 455
            T +       +   + +K     +P+        +PG++     L+N  +    S+ A+
Sbjct: 432 VTKRRNINVNYLDHNKSFKNCREFSPIFAVICGSSLPGMVMIGTFLLNSVVGAHDSTNAL 491

Query: 456 PFGTMLAIVVLWFVLSIPISIMGSLFARK---------KNTWDQHPTKTSQIAKQIPPQP 506
           PF T++  + ++FV+ IP+S+ G + A             T D+     S++ K      
Sbjct: 492 PFRTIVFFISIYFVVCIPLSLFGGIVANNIPLPKYWLSGITKDETDGNGSKLFKPKSRTR 551

Query: 507 WYLRTWPAAYIAGLFPFGAIAVELYFIYTSIWXXXXXXXXXXXXXXXXXXXXXXXXXXXX 566
           +        Y+ G+FP   I VE+ ++Y S+W                            
Sbjct: 552 FNPLVHCGVYLCGIFPLLVIYVEMQYVYKSLWLEKTTFYFFYGFLFLSIILLCVLTMEIS 611

Query: 567 XXYYSLCME--------NWSWQWRSFIIGGIGCSTYVFINSI--LFTKFRLGGFVTIVLY 616
                L M           +W+WR F +G  G   Y+ + S+  +F    + GF +I++ 
Sbjct: 612 IIGSYLLMRFCFDDKEVRNNWRWRCFEMGFSG-GVYMELYSLYYIFVVLNIHGFSSILIS 670

Query: 617 VGYSLLISFLFCLVTGTIGFVSSLWFVRKIY 647
           + YSLL + L  L  G +  +++ WF+ +IY
Sbjct: 671 ICYSLLFNILCGLGLGALSCLTASWFINRIY 701

>Suva_5.234 Chr5 complement(363605..365725) [2121 bp, 706 aa] {ON}
           YER113C (REAL)
          Length = 706

 Score =  117 bits (292), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 154/693 (22%), Positives = 269/693 (38%), Gaps = 109/693 (15%)

Query: 23  APTTYRRGDAIPLLVNHITPTVFSDDRAGTDGQRDKERXXXXXXXXXPRLHMCRPDKIEK 82
            P  Y++GD + L+VN +   +     A  D                P +H       + 
Sbjct: 53  TPNFYKKGDPLELIVNKVESDLTQLPYAYYD----------LPFTCPPTMHK------KP 96

Query: 83  VSESLGSIIFGDRLHNSPFELKMLEEKSCVALCEKTVPAEDAKFINQLIRSGFFHNWLVD 142
           +  SL  II GDR   S + L   E+ +C  LC +    E  + +++L+R G+   WL+D
Sbjct: 97  LHLSLNEIIRGDRKWESDYILAFGEDNACQTLCARKTTKEGMQSLDKLVREGYVVQWLID 156

Query: 143 G-LPAGREMHDARTNTVFYGTGFELGRVIRGTEDRNQEEPGEIELQTRRVLQPGESVVAV 201
             LPA         +  +Y +GF LG V   T                     G++    
Sbjct: 157 DKLPAATTFISTTDHKKYYASGFPLGFVDPDT---------------------GKT---- 191

Query: 202 PYFINHFEITVDYHKRAEDELRVVGVSVLPRSLQN---PVGDKCANSGNGLVLSETAD-T 257
            Y  NH  + + +H    D+  +VG  V PRS+ +   P   K       +V  +  + T
Sbjct: 192 -YLHNHVMLVIRFHSGDNDQNTIVGFEVYPRSVSDYHCPGASKNYEQYEIVVPEDENELT 250

Query: 258 KVTFTYSVRFHES-DVSWATRW------GKYLHVYDPKVQWYXXXXXXXXXXXXXXXXXX 310
            + FTYSV + E  +V W  RW      G+  +    +  W                   
Sbjct: 251 YLPFTYSVYWREEFEVDWNHRWDYFLNSGELSNEKSAQFHWMSFANSMGIVLSISFITAV 310

Query: 311 XXFRAL-----KTDLDRY--------NDFNLDNEFQEDYGWKLLHSDVFRSPSKTL---- 353
              + +      TD  +Y         + NLD++        ++  D  ++    +    
Sbjct: 311 IYIQVMHRDKKNTDSTKYLINIEGAEVEDNLDDDKYGKNSVYMVTKDWIQNGRPNMFGLK 370

Query: 354 LLSVFVGSGGQLFLMSACTLFIAMLGFLSPSSRGSLGT---IMFVLYAIFGGF-GSYLSM 409
           +L V V  G Q       +L I+       + R S+ T   + FVL A    F G+ LS+
Sbjct: 371 VLIVLVSFGVQFLFTVIGSLTISCSMNKLHNVRNSVITMAILCFVLGAFMASFVGTRLSI 430

Query: 410 STYK-------MFGGEKWKVNMVLTPLL-------VPGIIFATMLLMNFFLVMVQSSGAM 455
            T +       +   + +      +P+        +PG++  +  L+N  +    S+ A+
Sbjct: 431 VTKRRSIEINYLDDSKNFNNCNKFSPVFAIICGSSLPGLVMVSTFLLNSIVWAHDSTNAL 490

Query: 456 PFGTMLAIVVLWFVLSIPISIMGSLFARKKN---------TWDQHPTKTSQIAKQIPPQP 506
           PF T++  + ++F++ IP+S+ G   A             T D+    +S++        
Sbjct: 491 PFRTIVFFISVYFIVCIPLSLFGGTVANNIPLPRHWLSGITKDETCGNSSRLFVPRSRTK 550

Query: 507 WYLRTWPAAYIAGLFPFGAIAVELYFIYTSIWXXXXXXXXXX-XXXXXXXXXXXXXXXXX 565
           +    +   Y+ GLFPF  I VEL ++Y S+W                            
Sbjct: 551 FNPLVYCGIYLCGLFPFLVIYVELQYVYKSVWLEKTTFYYFYGFLLLNIILLCVLTMEIS 610

Query: 566 XXXYYSL---CMENW----SWQWRSFIIGGIGCSTYVFINSI--LFTKFRLGGFVTIVLY 616
               YSL   C E+     +W+W+ F +G  G   Y+ + S+  +F    + GF + ++ 
Sbjct: 611 IIGSYSLMRFCFEDKDVRNNWRWKCFEMGFSG-GVYMELYSLYYIFAVLNIHGFSSTLIS 669

Query: 617 VGYSLLISFLFCLVTGTIGFVSSLWFVRKIYSS 649
           + YSLL + +  L  G + ++++ WF+ KIY S
Sbjct: 670 ICYSLLFNIMCGLGLGGLSYLTASWFINKIYHS 702

>KAFR0K01950 Chr11 complement(401168..403162) [1995 bp, 664 aa] {ON}
           Anc_7.411 YER113C
          Length = 664

 Score =  110 bits (274), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 167/673 (24%), Positives = 256/673 (38%), Gaps = 102/673 (15%)

Query: 23  APTTYRRGDAIPLLVNHITPTVFSDDRAGTDGQRDKERXXXXXXXXXPRLHMCRPDKIEK 82
            P  YR+GD + L+VN I     SD      G  D                +C P    K
Sbjct: 38  TPNIYRKGDDVELIVNKIE----SDLTKLPYGYYDLP-------------FICPPTNQRK 80

Query: 83  -VSESLGSIIFGDRLHNSPFELKMLEEKSCVALC-EKTVPAEDAKFINQLIRSGFFHNWL 140
            +  SL  I+ GDR   S + L   ++  C  LC  KT P    K IN L++  +   W 
Sbjct: 81  PLHMSLTEILRGDRKWQSDYSLTFGKDNDCAVLCARKTTPEGIQKAIN-LVKKDYIVQWS 139

Query: 141 VDG-LPAGREMHDARTNTVFYGTGFELGRVIRGTEDRNQEEPGEIELQTRRVLQPGESVV 199
           +D  LPA         N  +Y  GF LG V   TE                         
Sbjct: 140 IDNDLPASTTFISTSENRKYYIPGFSLGFVDPDTE------------------------- 174

Query: 200 AVPYFINHFEITVDYHKRAEDELRVVGVSVLPRSLQNPVGDKCANSGNGLVLSETADTKV 259
              Y  NH  + + YH   ++   +VG+ V P+S+ +      + +     L    D +V
Sbjct: 175 -TAYLNNHVMLVIRYHAIDDEHFTIVGLEVYPKSVSDYHCPGASRNYEQFELVANDDEEV 233

Query: 260 T---FTYSVRFHES-DVSWATRW------GKYLHVYDPKVQWYXXXXXXXXXXXXXXXXX 309
           T   FTYSV + E  DV W  R+      G+       K +W                  
Sbjct: 234 TYIPFTYSVYWREEFDVEWKDRYSFFSNSGELSKEITDKFRWILLANSSGLALFISMIVS 293

Query: 310 XXXFRALKTDLDRYNDFNLDNEFQEDYGWKLLHSDVFRSPSKTLLLSVFVGSGGQLFLMS 369
               R  K + +  +         +    K L +D  R+     L+ V V  G       
Sbjct: 294 VIFLRISKKNKNENSAIESKKGSMDVIARKWLRND--RTIHFNFLI-VLVSFGVHFAFTL 350

Query: 370 ACTLFIAMLGFLSPSSRGSLGTIMFVLYAIFGGF-----GSYLSMSTYK-MFGGEKWKVN 423
             +L I+       + R S+ T++ +L+ + GGF     G+ L M   K M+ G   +++
Sbjct: 351 LGSLAISCSLQKFDNIRNSVLTLV-LLFFVLGGFMASFVGTCLIMQKNKTMYKGSLKRLH 409

Query: 424 ------MVLTPLLVPGIIFATMLLMNFFLVMVQSSGAMPFGTMLAIVVLWFVLSIPISIM 477
                 M    LL   I+  T+ L N       SS A+P  T+L ++ ++F++ IP+S++
Sbjct: 410 YSPLFAMCCGSLLPAVIMIITIFLNNIVWAH-GSSRALPLKTILFLISIYFIVCIPLSLL 468

Query: 478 GSLFAR---KKNTWDQHPTKTSQ-----------IAKQIPPQPWYLRTWPAAYIAGLFPF 523
           G  +A    +K T     +   Q             K I   P+   +   A I GLFPF
Sbjct: 469 GGSYASDICQKRTLRAFSSPAQQKLAVTNSNLARTIKSIFDDPF---SGLLASIGGLFPF 525

Query: 524 GAIAVELYFIYTSIWXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYYSLCM-------EN 576
             I VEL  +Y  +W                                 + M       EN
Sbjct: 526 FIIYVELQHVYKFVWLEKASFYYLRWFLFANIIILCIVVVEIAIISAYIMMHSSRSSLEN 585

Query: 577 WSWQWRSFIIGGIGCSTYVFINSILFTKFRLG--GFVTIVLYVGYSLLISFLFCLVTGTI 634
            SW+WRSF I    C+ Y+ + S+ +  + L   GF +I+L V  S L + L     G+I
Sbjct: 586 -SWRWRSFQISS-SCAWYMELYSLYYIFYVLNTTGFSSILLSVCSSALFNGLCGCALGSI 643

Query: 635 GFVSSLWFVRKIY 647
           G++++ WFV ++Y
Sbjct: 644 GYLATCWFVGRVY 656

>CAGL0G03487g Chr7 complement(337133..339247) [2115 bp, 704 aa] {ON}
           similar to uniprot|P40071 Saccharomyces cerevisiae
           YER113c
          Length = 704

 Score =  107 bits (266), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 159/704 (22%), Positives = 275/704 (39%), Gaps = 129/704 (18%)

Query: 24  PTTYRRGDAIPLLVNHITPTVFSDDRAGTDGQRDKERXXXXXXXXXPRLHMCRPDKIEK- 82
           P  Y+ GD + L+VN +   +     A  D                P   +C P K +K 
Sbjct: 53  PNLYKIGDHVELIVNKVESDLTQLPYAYYD---------------LP--FICPPTKEKKP 95

Query: 83  VSESLGSIIFGDRLHNSPFELKMLEEKSCVALCEKTVPAEDAKFINQLIRSGFFHNWLVD 142
           +  SL  I  GDR   S ++L    +  C  LC +    E      +L++ G+   WL+D
Sbjct: 96  LHLSLDEIFRGDRKWQSDYKLSFGIDSPCEILCARKTKKEGMIKAKELVQQGYVTQWLID 155

Query: 143 -GLPAGREMHDARTNTVFYGTGFELGRVIRGTEDRNQEEPGEIELQTRRVLQPGESVVAV 201
             LPA      +  +  +Y  GF +G V    +DR  +                      
Sbjct: 156 ESLPAATTFISSTNHNKYYAAGFPVGYV----DDRTGK---------------------- 189

Query: 202 PYFINHFEITVDYHKRAEDELRVVGVSVLPRSLQN---PVGDKCANSGNGLVLSETAD-- 256
            +  NH  + + YH  +E+E  +VG  V P+S+ +   P  +K  +    +++ E  D  
Sbjct: 190 TFLNNHVMLVIRYHPVSEEEFTIVGFEVYPKSVSDYHCPGANK-NHDKYEIIVPEKDDEL 248

Query: 257 TKVTFTYSVRFHES-DVSWATRWGKYLH---VYDPKVQWYXXXXXXXXXXXXXXXXXXXX 312
           T + FTYSV + E  +V W  RW  +L+   + + K   +                    
Sbjct: 249 TFIPFTYSVYWREEFEVDWNHRWNYFLNNGELSNSKANQFHWMSFLNSVGIASMTTTIVS 308

Query: 313 FRALKT---------DLDRYNDFNLDNEFQEDYG--------------------WKLL-- 341
              LK          +++   +   DNE   D                      WK L  
Sbjct: 309 IILLKIFSKKERESRNINTSTNLGQDNEDDNDDKISGSVFVNAKTWITVGKIPYWKALIC 368

Query: 342 HSDVFRSPSKTLLLSVFVG-SGGQLFLMSACTLFIAMLGFLSPSS-RGSLGTIMFVLYAI 399
            + +    S T+L S+ +  S  +L  +    L ++++ F+  ++  G +G+ +++ Y I
Sbjct: 369 LTSMGIQFSFTILGSLIISCSLSKLHNIRFTVLTMSLICFICGAAISGYIGSRLYIEYQI 428

Query: 400 FGGFGSYLSMSTYKMFGGEKWKVNMVLTPLLVPGIIFATMLLMNFFLVMVQSSGAMPFGT 459
             G   YL     +    + +K ++V    L PG++      +N  ++   S+ A+PF T
Sbjct: 429 LKG---YLRNEVNRT---KVYKFSVVCGSSL-PGLLMVISFSLNCIILAHDSTNALPFKT 481

Query: 460 MLAIVVLWFVLSIPISIMGSLFAR--KKNTWDQHPTKTSQIAKQIPPQ---------PWY 508
            + +V ++FV  IP+S++G + A   K ++++     TS     I  +           Y
Sbjct: 482 EVFLVSIYFVTCIPLSLLGGVLALNCKVDSYNTLKRITSLRRNTISRKSRSDFTKKVSLY 541

Query: 509 LR----------TWPAAYIAGLFPFGAIAVELYFIYTSIWXXXXXXXXXX--XXXXXXXX 556
            R          T   A   G F F  I VEL ++Y S+W                    
Sbjct: 542 QRLVFDIKHDSFTTFGALAGGFFSFIIIWVELQYVYKSVWLEKTSFYYYYGFLLANILIL 601

Query: 557 XXXXXXXXXXXXYYSLCMEN-----WSWQWRSFIIGGIGCSTYVFINSILFTKFRLG--G 609
                       Y  L  +N      +W W+SF++G   C+ Y+ + S+ +  F L   G
Sbjct: 602 SIVTIEIAIIGCYVMLKAKNDRYLRHTWGWKSFLMGS-SCAWYMELYSLYYIFFVLNMQG 660

Query: 610 FVTIVLYVGYSLLISFLFCLVTGTIGFVSSLWFVRKIYSSIKVD 653
           F +I + V YSLL + +     G++ +++S   V +IY   KVD
Sbjct: 661 FSSIFISVCYSLLFNGMCGWALGSLSYLTSYMLVTQIY---KVD 701

>SAKL0F12914g Chr6 complement(1013914..1016037) [2124 bp, 707 aa]
           {ON} similar to uniprot|P40071 Saccharomyces cerevisiae
           YER113C Hypothetical ORF
          Length = 707

 Score =  107 bits (266), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 112/506 (22%), Positives = 202/506 (39%), Gaps = 87/506 (17%)

Query: 75  CRPDKIEK-VSESLGSIIFGDRLHNSPFELKMLEEKSCVALCEKTVPAEDAKFINQLIRS 133
           C P  ++K +  SL  II GDR   S + L   +++ C+ LC++    +  +  ++LI+ 
Sbjct: 92  CPPTNVKKPLHLSLNEIIRGDRKWQSDYLLHFKKDEHCLRLCDRKTSPDALRKAHELIKQ 151

Query: 134 GFFHNWLVDG-LPAGREMHDARTNTVFYGTGFELGRVIRGTEDRNQEEPGEIELQTRRVL 192
           G+   WL+D  LPA       + +  +Y +GF LG + + T                   
Sbjct: 152 GYVVQWLIDDELPAATTFISTKDHKKYYASGFPLGFMDKDT------------------- 192

Query: 193 QPGESVVAVPYFINHFEITVDYHKRAEDELRVVGVSVLPRSLQNPVGDKCANSGNGLVLS 252
             G++     Y  NH  + + YH    ++  +VG+ V P+S+ +     C  +       
Sbjct: 193 --GKT-----YLNNHVMLVIRYHTVDINKFTIVGLEVYPKSVSD---YHCPGASKNFDHY 242

Query: 253 ETADTK-----VTFTYSVRFHES-DVSWATRW------GKYLHVYDPKVQWYXXXXXXXX 300
           E    +     + FTYS+ + E  +V W  RW      G+       +  W         
Sbjct: 243 EVNTEETETTYIPFTYSIYWREEFNVDWTNRWNFFINSGEISQEKSSQFHWISLANSVVI 302

Query: 301 XXXXXXXXXXXXFRALKTDLDRYNDFNLDNEFQEDYGWKLLHSDVFRSPSKTLLLSVFVG 360
                        +++ TD     +    +  Q    W + HS +         L+VF  
Sbjct: 303 VTLMTLVVALILAKSVSTD-----ETVSTSTSQVASQWVVQHSYLLNH------LNVFTA 351

Query: 361 SGGQLFLMSACTLFIAMLGFLSPSSRGSLGTIMFVLYAIFGGFGSYLSMSTYKMFGGEKW 420
            G Q       +L I+       + R S+ T+  + + I G + S    +          
Sbjct: 352 MGVQFLFTILGSLIISCSMNKLHNIRNSVLTMALMCF-ISGAYTSSFVGALLSANHNTTI 410

Query: 421 KVNMVLTPLLVPGIIFATMLLMNFFLVMVQSSGAMPFGTMLAIVVLWFVLSIPISIMGSL 480
           K+++     L PG     +L++N  +    S+ A+PFGT++ ++ ++F++ IP+SI+G +
Sbjct: 411 KISIACGSAL-PGFTLCVVLILNCIIWAKDSTHALPFGTIVLLITVYFIVCIPLSILGGV 469

Query: 481 ---FARKKNT-----------------WDQHPTKTSQIAKQIP------PQPWYLRTWPA 514
              + R+K                   +D  P   +++   +P        P  LR  P 
Sbjct: 470 SATYTRRKCLSLDPRSIINRFFLLNIHYDDQPVVENKV--HLPRISGNSKLPLMLRQ-PV 526

Query: 515 --AYIAGLFPFGAIAVELYFIYTSIW 538
               I+G+ PF  I VEL F+Y S+W
Sbjct: 527 LLTVISGIVPFIVIYVELLFVYKSLW 552

 Score = 45.4 bits (106), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 26/75 (34%), Positives = 45/75 (60%), Gaps = 3/75 (4%)

Query: 579 WQWRSFIIGGIGCSTYVFINSILF--TKFRLGGFVTIVLYVGYSLLISFLFCLVTGTIGF 636
           W+W+SF IGG   + Y+   S+ +  T  ++  F +I+L+  YS L +FL     G +G+
Sbjct: 632 WRWKSFQIGG-SVAWYLEAYSLYYFLTVLKIRDFSSILLFFCYSALFNFLCWCSFGALGY 690

Query: 637 VSSLWFVRKIYSSIK 651
           +S  WFV +I+++ K
Sbjct: 691 LSCCWFVNRIHTNSK 705

>KLTH0C06226g Chr3 (541022..543106) [2085 bp, 694 aa] {ON} similar
           to uniprot|P40071 Saccharomyces cerevisiae YER113C
           Hypothetical ORF
          Length = 694

 Score =  104 bits (259), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 130/551 (23%), Positives = 206/551 (37%), Gaps = 101/551 (18%)

Query: 24  PTTYRRGDAIPLLVNHITPTVFSDDRAGTDGQRDKERXXXXXXXXXPRLHMCRPDKIEK- 82
           P  Y+RGD + L VN +   + +      D +                  +C P + +K 
Sbjct: 46  PNVYKRGDKVDLTVNKVESEITNLPYGYYDLR-----------------FVCPPSETKKP 88

Query: 83  VSESLGSIIFGDRLHNSPFELKMLEEKSCVALCEKTVPAEDAKFINQLIRSGFFHNWLVD 142
           +  SL  +I GDR   S + L+    + C  LC++    +  +  ++LIR  +  +WL+D
Sbjct: 89  LHLSLDEVIRGDRKWESDYNLEFGVGQDCERLCDRKTMPDGLRQADRLIRENYMVHWLID 148

Query: 143 G-LPAGREMHDARTNTVFYGTGFELGRVIRGTEDRNQEEPGEIELQTRRVLQPGESVVAV 201
           G LPA       R+   FY  GF LGRV   T+  +                        
Sbjct: 149 GDLPAATTFASTRSGKKFYTAGFPLGRVDHETDKTHLH---------------------- 186

Query: 202 PYFINHFEITVDYHKRAEDELRVVGVSVLPRSLQNPVGDKCANSGNGLVLS--ETADTKV 259
               NH  + + Y     +   +VG  V PRS+ +      + S    V++  ET  T +
Sbjct: 187 ----NHLMLVIRYQAFDFNRYAIVGFEVYPRSVSDYQCPGASKSFEPYVINTEETEVTYI 242

Query: 260 TFTYSVRF-HESDVSWATRWGKYLH----VYDPKVQWYXXXXXXXXXXXXXXXXXXXXFR 314
            FTYSV +  ES++ W+ RW  +      + +  V ++                      
Sbjct: 243 PFTYSVYWREESNIDWSHRWNLFFDGGSMLPNGNVSFFYWISLANSAIVVALMTLFIALI 302

Query: 315 ALKTDLDRYNDF--NLDNEFQEDYGWKLLHSDVFRSPSKTLLLSVFVGSGGQLFLMSACT 372
            LK    R +DF   L  E+     + L   ++  S     L S+    G      S C 
Sbjct: 303 FLKI---RADDFVGTLAFEWASQPVYYLTQLNLAASMGIQFLFSII---GSSTISCSLCK 356

Query: 373 LFIAMLGFLSPSSRGSLGTIMFVLYAIFGGFGSYLSMSTYKMFGGEKWKVNMVLTPLLVP 432
           +          S   S   I FVL A        L     KM  G       VL    +P
Sbjct: 357 VHNIR------SWELSTAAICFVLGAYTSSLVGSLLAPGPKMNLGTS-----VLCGCTLP 405

Query: 433 GIIFATMLLMNFFLVMVQSSGAMPFGTMLAIVVLWFVLSIPISIMGSLFARKKNT----- 487
            +    + + N  + +  SS A+PFGT+LA++  +FV+ +P+S +G   ARK  +     
Sbjct: 406 ALALVVVAVFNSVVWIKDSSAALPFGTLLALLTSYFVICLPLSFLGGFSARKLRSAPANG 465

Query: 488 --WDQHPTKTSQI---------------AKQIPP---QPWYLRTWPAAYIAGLFPFGAIA 527
             ++Q     S +                K+IP     P+ L       + G  PF    
Sbjct: 466 LNYEQSKVPFSFLLSIEYHEYNLLPAGQEKEIPAILSNPFLLTI-----VTGFPPFVVTC 520

Query: 528 VELYFIYTSIW 538
            EL F+Y S+W
Sbjct: 521 TELLFVYRSLW 531

 Score = 37.0 bits (84), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 39/68 (57%), Gaps = 3/68 (4%)

Query: 578 SWQWRSFIIGGIGCSTYVFINSILFTKF--RLGGFVTIVLYVGYSLLISFLFCLVTGTIG 635
           SW+W++F+ G    + Y  + S+ +  F   L  F +I+L+V Y+ L + +     G +G
Sbjct: 618 SWRWKAFMAGA-SVAWYFELYSLYYLIFVLHLRDFSSILLFVCYTSLFNLMCWCAFGALG 676

Query: 636 FVSSLWFV 643
           +++ LWF+
Sbjct: 677 YLTCLWFL 684

>Ecym_7143 Chr7 (290555..292585) [2031 bp, 676 aa] {ON} similar to
           Ashbya gossypii AGL295C
          Length = 676

 Score = 96.7 bits (239), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 142/638 (22%), Positives = 230/638 (36%), Gaps = 111/638 (17%)

Query: 75  CRPDKIEK-VSESLGSIIFGDRLHNSPFELKMLEEKSCVALCEKTVPAEDAKFINQLIRS 133
           C P K  + V  SL  +  GDR   S ++L    E  C  LC +          + LIR 
Sbjct: 76  CTPTKSRRMVHHSLYEVFSGDRKWQSDYKLYFNRENKCSTLCFRKTQPSGLIEADSLIRQ 135

Query: 134 GFFHNWLVDG-LPAGREMHDARTNTVFYGTGFELGRVIRGTEDRNQEEPGEIELQTRRVL 192
            +    L+D  +PA +     R N  +Y  GF LG V   T+                  
Sbjct: 136 NYTVQLLIDEIMPASKTYVSMRDNKRYYVPGFPLGFVDPETD------------------ 177

Query: 193 QPGESVVAVPYFINHFEITVDYHKRAEDELRVVGVSVLPRSLQNPVGDKCANSGN----- 247
                   V Y  NHF + + Y+    ++  +VG  V P+S+ +   D C  S       
Sbjct: 178 --------VTYLHNHFMLVIRYNAVDINKYTIVGFEVYPKSVSD---DHCPGSSKDYENY 226

Query: 248 GLVLSETADTKVTFTYSVRFHES-DVSWATRWGKYLHVYDPKVQWYXXXXXXXXXXXXXX 306
            +  SE     +  TYSV + E   V W  RW  YL   D  V                 
Sbjct: 227 AVNPSEKDVVFIPITYSVYWREEFMVDWENRWNFYLSAGDLDVN----KSLCFRGIKVTM 282

Query: 307 XXXXXXFRALKTDLDRYNDFNLDNEFQEDYGWKLLHSDVFRSPSKTLLLSVFVGSGGQ-L 365
                   +L   + R     L       +   +    V R     L L+ FV  G Q +
Sbjct: 283 VFIILTLMSLAIIVSR-----LGLGTGSMFITAVASEWVRRGAPCLLFLNTFVSMGIQVI 337

Query: 366 FLMSACTLFIAMLGFLSPSSR-----GSLGTIMFVLYAIFGGFGSYLSMSTYKMFGGEKW 420
           F   A  L I  +G L   S       +L  +  +  + FGG    + +S   +    + 
Sbjct: 338 FAAPATLLLICSMGKLHNISNFLVCIAALCYMTGIFMSAFGG----ILLSGNLLDNKAQI 393

Query: 421 KVNMVLTPLLVPGIIFATMLLMNFFLVMVQSSGAMPFGTMLAIVVLWFVLSIPISIMGSL 480
           +   VL    +P +  A ++L N    +++    MPF  +  ++ L+F++S+P+S++G  
Sbjct: 394 RKYSVLYGSALPALTVAVLVLANSIAWIIERGKEMPFRDITLLLALYFMVSLPLSLLGGT 453

Query: 481 FARKKNTWDQH----------------PTK-------------TSQIAKQIPPQPWYLRT 511
            A  K   DQH                P+K             T   A +  P  W  + 
Sbjct: 454 SASYKLK-DQHFQLYSLSTKYTGTPVSPSKPTFWFNFEYDTRGTPACAHEQIPM-WLSKP 511

Query: 512 WPAAYIAGLFPFGAIAVELYFIYTSIWXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYYS 571
           +    I G+ PF AI +++ FI+  +W                                 
Sbjct: 512 FLITSIIGIIPFLAIYLQMEFIWKPLWTHSKSLFQIYVSLIIGMILQSILVMEICILIMY 571

Query: 572 LCMENW---------------------SWQWRSFIIGGIGCSTYVFINSILFTKF--RLG 608
           + M +                      SW+W++F +GG   + Y    S+ +  F  RL 
Sbjct: 572 VHMHHGDDSECCFDDTCVTGRISNAVSSWRWKAFYMGG-AAAWYWEAYSLYYMIFILRLR 630

Query: 609 GFVTIVLYVGYSLLISFLFCLVTGTIGFVSSLWFVRKI 646
            F +I+LY+ Y  L++  +    G+IG+++  WF+ K+
Sbjct: 631 NFGSILLYLSYGTLLNVFYFYSFGSIGYLACCWFLNKL 668

>Kwal_27.10746 s27 (479237..481309) [2073 bp, 690 aa] {ON} YER113C -
           Hypothetical ORF [contig 33] FULL
          Length = 690

 Score = 88.2 bits (217), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 67/268 (25%), Positives = 109/268 (40%), Gaps = 54/268 (20%)

Query: 24  PTTYRRGDAIPLLVNHITPTVFSDDRAGTDGQRDKERXXXXXXXXXPRLHMCRP-DKIEK 82
           P  Y++GD + +++N     V S+      G  D +              +C P DK + 
Sbjct: 42  PNVYKKGDKVDVIINK----VVSETARFPYGYYDLQ-------------FVCPPSDKKKP 84

Query: 83  VSESLGSIIFGDRLHNSPFELKMLEEKSCVALCEKTVPAEDAKFINQLIRSGFFHNWLV- 141
           +  SL  II GDR   S + L   E   C+ LC++    E  K  + LIR G+  +WL+ 
Sbjct: 85  LHLSLNEIIRGDRKWESDYNLAFGERHDCLRLCDRKTKPEGLKQADALIRQGYVAHWLID 144

Query: 142 DGLPAGREMHDARTNTVFYGTGFELGRVIRGTEDRNQEEPGEIELQTRRVLQPGESVVAV 201
           D LPA       ++   FY  GF LG V                          ++V   
Sbjct: 145 DDLPAATTFAKTKSGKKFYTAGFPLGEV--------------------------DAVTGK 178

Query: 202 PYFINHFEITVDYHKRAEDELRVVGVSVLPRSLQNPVGDKCANSGNG-----LVLSETAD 256
               NH  + V Y     ++  ++G  V P+S+ +     C  +        +   E+  
Sbjct: 179 TRLYNHLMLVVRYQTVDVNKHTIIGFEVYPKSVSDA---HCPGANKDYQPYEINTEESEI 235

Query: 257 TKVTFTYSVRF-HESDVSWATRWGKYLH 283
           T + FTYS+ +  ES++ W+ RW  ++H
Sbjct: 236 TYIPFTYSIYWREESNIDWSHRWNFFIH 263

 Score = 64.3 bits (155), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 42/134 (31%), Positives = 67/134 (50%), Gaps = 32/134 (23%)

Query: 431 VPGIIFATMLLMNFFLVMVQSSGAMPFGTMLAIVVLWFVLSIPISIMGSLFARK-KNTWD 489
           +PG++  T+L++N  + +  SS A+PFGT++  V  +F++S P+S++G   ARK KN   
Sbjct: 400 LPGLVLFTVLVLNGIVWLKDSSSAIPFGTVVVFVAGYFMISFPLSLLGGFSARKMKNAAK 459

Query: 490 QHPTKTSQIAKQIPPQPWYL--------RTWPA-----------------AYIAGLFPFG 524
             P      A  I   P+          R+WPA                   +AG+ PF 
Sbjct: 460 LAP------ANAISKSPFSFLLTLSYDTRSWPATALGKPFPIALSNPILLTILAGIAPFV 513

Query: 525 AIAVELYFIYTSIW 538
            I VEL+++Y S+W
Sbjct: 514 VICVELFYVYKSMW 527

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 41/75 (54%), Gaps = 1/75 (1%)

Query: 578 SWQWRSFIIGG-IGCSTYVFINSILFTKFRLGGFVTIVLYVGYSLLISFLFCLVTGTIGF 636
           SW+W+SF+ GG +     ++    L     L    +I+L+V Y+ L +F+     G +G+
Sbjct: 614 SWRWKSFVAGGSVAWYLELYSLYYLIFVLHLRDLSSILLFVCYTALFNFMCWCAFGALGY 673

Query: 637 VSSLWFVRKIYSSIK 651
           +S LWF+  I SS K
Sbjct: 674 LSCLWFLSHISSSSK 688

>TBLA0I00330 Chr9 (52200..54341) [2142 bp, 713 aa] {ON} Anc_7.411
           YER113C
          Length = 713

 Score = 85.9 bits (211), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 108/495 (21%), Positives = 184/495 (37%), Gaps = 80/495 (16%)

Query: 24  PTTYRRGDAIPLLVNHITPTVFSDDRAGTDGQRDKERXXXXXXXXXPRLHMCRP-DKIEK 82
           P  Y+ GD + +  N   P    DD A +                 P   +C P D    
Sbjct: 62  PNLYKVGDKVQITTNKALP----DDPAVSQPA--------LCYYDLP--FVCPPSDTKRP 107

Query: 83  VSESLGSIIFGDRLHNSPFELKMLEEKSCVALCEKTVPAEDAKFINQLIRSGFFHNWLVD 142
           +  SL  +  GD L  S + L+  +++ C  LC +    +  +    LI++ +   W VD
Sbjct: 108 IHNSLTELFNGDYLSESDYILEFAKDEPCHILCSRKTSKKGMQRAYDLIKNDYIVQWYVD 167

Query: 143 G-LPAGREMHDARTNTVFYGTGFELGRVIRGTEDRNQEEPGEIELQTRRVLQPGESVVAV 201
             LP G      + N   Y  GF LG            + G+  L T             
Sbjct: 168 NDLPVGTTYISNKVNKKQYLPGFSLGYF--------DNQTGQAYLNT------------- 206

Query: 202 PYFINHFEITVDYHKRAEDELRVVGVSVLPRSLQNPVGDKCANSGNGLV-----LSETAD 256
                H    V YH    D   +VG+ V PRS+   V   C  +    +     + E  D
Sbjct: 207 -----HLMFVVRYHAVTSDTFTIVGLEVYPRSI---VDYNCPGASKDFIPLEVKVPENND 258

Query: 257 --TKVTFTYSVRFHES-DVSWATRWGKY------LHVYDPKVQWYXXXXXXXXXXXXXXX 307
             T + F+YSV + E  D+ W  RW  +      L   D    WY               
Sbjct: 259 DPTYLPFSYSVYWREEFDLPWNQRWDLFKTADELLREKDLSFHWY------SLINSNSIT 312

Query: 308 XXXXXFRALKTDLDRYNDFNLDNEFQEDYGWKLLHSDVFRSPSKTLLLSVFVGSGGQLFL 367
                F  L   ++R     L N+  +     +  +   R P+   + ++ + SG Q F 
Sbjct: 313 VGVITFLCLVISMNRMRI--LYNKSWKKRQLSITTTTTTRYPN---IFTICITSGIQFFF 367

Query: 368 MSACTLFIAMLGFLSPSSRGSLGTIMFVLYAIFGG-----FGSYLSMSTYKM--FGGEKW 420
           +   ++ I    F          TI+  L+ I  G     F   L   T+ +  F  + +
Sbjct: 368 LLISSVLIT---FQISKFHQIKDTIIVALFFIAFGIIVSVFIGTLIQRTFILTNFPDKYY 424

Query: 421 KVNMVLTPLLVPGIIFATMLLMNFFLVMVQSSGAMPFGTMLAIVVLWFVLSIPISIMGSL 480
             N +L    +P  I  +M ++N  + + + + A PF   +     +F+LSIP+SI+  +
Sbjct: 425 LTNPILFGSTLPAFILLSMFIINSIIYLSEKNHAFPFKLSMYFFTSYFILSIPLSIISGV 484

Query: 481 FARKKNTWDQHPTKT 495
            + +  ++ ++P+++
Sbjct: 485 LSTRFISFPKYPSRS 499

 Score = 32.3 bits (72), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 24/65 (36%), Positives = 35/65 (53%), Gaps = 9/65 (13%)

Query: 578 SWQWRSFIIGGIGCSTYVFINSILFTKFRLGGFV-----TIVLYVGYSLLISFLFCLVTG 632
           SWQWRSF IG    S ++FI   +F  F  G  V     T +  + Y  L++ LF L+ G
Sbjct: 631 SWQWRSFFIGA---SPFIFIEFYIF-YFVFGIKVITVSATQIASIYYFTLLNVLFSLMLG 686

Query: 633 TIGFV 637
           +I ++
Sbjct: 687 SISYM 691

>KNAG0C03430 Chr3 (674411..676453) [2043 bp, 680 aa] {ON} Anc_7.411
           YER113C
          Length = 680

 Score = 84.0 bits (206), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 64/258 (24%), Positives = 118/258 (45%), Gaps = 39/258 (15%)

Query: 430 LVPGIIFATMLLMNFFLVMVQSSGAMPFGTMLAIVVLWFVLSIPISIMGSLFARKKNTWD 489
           L+PG++  T +++N  + +  S+  +PF T++ ++ ++F++ IP+S++G   A  K++ +
Sbjct: 420 LLPGMVILTAIILNCIIWLHTSTNVLPFATIMKLLFIYFIVCIPLSVLGGSIAANKDSEE 479

Query: 490 QHPTKTSQI-------AKQIPPQP----------------WYLR-------TWPAAYIAG 519
               ++  I       A +I  +                 W L+       T  +   +G
Sbjct: 480 YSRLRSDSIKRISRTRANKIMDEDQGTDVRTTRKLKYKVRWQLKKMMLDTVTVVSLLASG 539

Query: 520 LFPFGAIAVELYFIYTSIWXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYYSLCM----- 574
           +FPF  I VEL F+Y S+W                                 L M     
Sbjct: 540 IFPFIMIYVELQFVYKSVWYEKTTFYYYYGFLLANIILLCLVICDIAIICSYLMMTVSSK 599

Query: 575 -ENWSWQWRSFIIGGIGCSTYVFINSI--LFTKFRLGGFVTIVLYVGYSLLISFLFCLVT 631
             + SW+W++F +    C+ Y+   SI  +F    +  F +I++ V YSLL + L  L  
Sbjct: 600 DNSDSWKWKTFQLSS-SCAWYMEAYSIYYVFKVLNMRDFSSILISVCYSLLFNALCGLAM 658

Query: 632 GTIGFVSSLWFVRKIYSS 649
           G+IG+++SLWFV+++Y S
Sbjct: 659 GSIGYLASLWFVKRVYRS 676

 Score = 79.7 bits (195), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 70/266 (26%), Positives = 108/266 (40%), Gaps = 54/266 (20%)

Query: 23  APTTYRRGDAIPLLVNHITPTVFSDDRAGTDGQRDKERXXXXXXXXXPRLHMCRPDKIEK 82
            PT YR GD + ++VN I     SD      G  D              L    P  ++K
Sbjct: 34  TPTIYRHGDPVEIIVNKIE----SDATQLPYGYYD--------------LPFTCPPTVDK 75

Query: 83  --VSESLGSIIFGDRLHNSPFELKMLEEKSCVALCEKTVPAEDAKFINQLIRSGFFHNWL 140
             +  SL  +I GDR   S +EL+  ++  C  LC +    +  + +++ I+  +   W 
Sbjct: 76  KPLHLSLNEVIRGDRKWQSNYELEFGKDTECTVLCARKTNPDGMRSLDKFIKQEYVVQWF 135

Query: 141 VDG-LPAGREMHDARTNTVFYGTGFELGRVIRGTEDRNQEEPGEIELQTRRVLQPGESVV 199
           +D  LPA            +YG+GF LG V         EE G++               
Sbjct: 136 IDKELPAATTFISTVDQKKYYGSGFPLGFV--------DEETGKV--------------- 172

Query: 200 AVPYFINHFEITVDYHKRAEDELRVVGVSVLPRSLQN---PVGDKCANSGNGLVLSETA- 255
              Y  NH  + + YH   +    +VG  + P+S+ +   P   K  +    +V+ E A 
Sbjct: 173 ---YVNNHVMMVIRYHAIDDYNFTIVGFEIYPKSVSDYHCPGASKDYDQYE-VVVPEIAN 228

Query: 256 -DTKVTFTYSVRFHES-DVSWATRWG 279
            DT + FTYSV + E  DV W  R+ 
Sbjct: 229 EDTFIPFTYSVYWREEFDVEWKDRYN 254

>TPHA0K00730 Chr11 (150877..153078) [2202 bp, 733 aa] {ON} Anc_7.411
           YER113C
          Length = 733

 Score = 71.6 bits (174), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 113/500 (22%), Positives = 188/500 (37%), Gaps = 93/500 (18%)

Query: 24  PTTYRRGDAIPLLVNHITPTVFSDDRAGTDGQRDKERXXXXXXXXXPRLHMCRPDKIEK- 82
           P TY  GD + ++VN +   V   D  G     D            P  ++C P   +K 
Sbjct: 48  PNTYTFGDPVEVIVNKM---VQEKDMLG-----DSNEGVSYKYHDLP--YICPPTNTKKS 97

Query: 83  VSESLGSIIFGDRLHNSPFELKMLEEKSCVALCEKTVPAEDAKFINQLIRSGFFHNWLVD 142
           +  SL  +  GD    S + LK   +  C ALC +       +   ++I   +  NW +D
Sbjct: 98  IHNSLKELFNGDYNEQSDYILKFGVDNDCQALCLRKTYNAGIRKAKEMIDEDYIVNWFID 157

Query: 143 G-LPAGREMHDARTNTVFYGTGFELGRVIRGTEDRNQEEPGEIELQTRRVLQPGESVVAV 201
             LPA      + T    Y  GF LG            E G                   
Sbjct: 158 DYLPAATTYISSVTRKKKYFEGFSLG--------WKDPETGSY----------------- 192

Query: 202 PYFINHFEITVDYHKRAEDELRVVGVSVLPRSLQNPVGDKCANSGNGLVLSETADTK--- 258
            Y  NH  + + Y+   +++  +VG  V P+S+ +    +C  +  G    E  D +   
Sbjct: 193 -YINNHVMLVIRYNAVDDNKFNIVGFEVYPKSIPDL---QCPGARRGHGHYELKDLENND 248

Query: 259 ----VTFTYSVRFHES-DVSWATRWGKY-------LHVYDPKVQ---------WYXXXXX 297
               + F+YSV + E  +  W TRW  +       L   D  +Q         WY     
Sbjct: 249 EFSLIPFSYSVYWREEFEYDWRTRWSLFVRPNYMDLDAEDESLQLGFISNLLHWYSPYTT 308

Query: 298 XXXXXXXXXXXXXXXFRALKTDLDRYNDFNLDNEFQEDYGWKLLHSDVFRSPSKTLLLSV 357
                             L  D++ +    + N  +    W    + + ++  K +LL++
Sbjct: 309 VIIFTILLFLV-----SLLVLDINSHKLVFMSNP-KTVIAWATTANKLNKT-WKNILLNI 361

Query: 358 FVGSGGQLFLMSACTLFIAMLGFLSPSSRGSLGTIM-FVLYAIF---------GGF-GSY 406
            V  G Q        LFI M   +  SS  SL  I  +V+  I          G F G++
Sbjct: 362 LVSMGCQ-------ALFIFMPVIVIQSSLWSLHNISNYVMLQIICWISASLLVGSFVGTW 414

Query: 407 LSMSTY--KMFGGEKWKVNMVLTPLLVPGIIFATMLLMNFFLVMVQSSGAMPFGTMLAIV 464
           L M  +  KM      K+++V   +L PG+  A + + N     ++ + + PF  +  ++
Sbjct: 415 LRMYMFQKKMTPNYDPKMSIVCGSIL-PGLTLAGVTVFNTVTWFLEGNSSYPFRKLSWLI 473

Query: 465 VLWFVLSIPISIMGSLFARK 484
            ++F+ SIP+S++G   A K
Sbjct: 474 FVYFIFSIPMSLIGGSLAVK 493

 Score = 32.0 bits (71), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 14/37 (37%), Positives = 24/37 (64%)

Query: 613 IVLYVGYSLLISFLFCLVTGTIGFVSSLWFVRKIYSS 649
           ++L +GYSLL + L  L  G I +++S+WF+   + S
Sbjct: 689 LLLSIGYSLLFNLLIGLAAGFISYMASVWFIVNRFKS 725

>KLLA0E20835g Chr5 complement(1857426..1859456) [2031 bp, 676 aa]
           {ON} similar to uniprot|P40071 Saccharomyces cerevisiae
           YER113C Hypothetical ORF
          Length = 676

 Score = 68.9 bits (167), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 61/270 (22%), Positives = 106/270 (39%), Gaps = 56/270 (20%)

Query: 23  APTTYRRGDAIPLLVNHITPTVFSDDRAGTDGQRDKERXXXXXXXXXPRLHM-CRPDK-I 80
           +P  Y  GD + + VN +     SD    + G  D              LH  C P + +
Sbjct: 58  SPNFYEYGDKVDITVNKVE----SDLTHFSYGYYD--------------LHFTCPPSQDM 99

Query: 81  EKVSESLGSIIFGDRLHNSPFELKMLEEKSCVALCEKTVPAEDAKFINQLIRSGFFHNWL 140
           + +  +   I++G++   S ++L   +++ CV LC++    E  K   +LI+  +   WL
Sbjct: 100 KPLPLTFSDILYGNKKWQSDYQLTFGKDEDCVRLCDRKTNGEGKKQAYELIKQNYVVQWL 159

Query: 141 V-DGLPAGREMHDARTNTVFYGTGFELGRVIRGTEDRNQEEPGEIELQTRRVLQPGESVV 199
             D LP      + +    +Y +GF LG          Q +P   E              
Sbjct: 160 ADDDLPGATTYLNTKDKKKYYSSGFPLG----------QYDPETDE-------------- 195

Query: 200 AVPYFINHFEITVDYHKRAEDELRVVGVSVLPRSLQNPVGDKCANSGNGLVLSETADTK- 258
              Y  NH  I + YH   + +  +VG  V P+S+ +     C  +       +   T  
Sbjct: 196 --AYINNHVMIVIRYHTIDQGKNTIVGFEVYPKSVSD---HHCPGASKDYTPYKIDPTNE 250

Query: 259 ----VTFTYSVRFHES-DVSWATRWGKYLH 283
               ++FTY+V + E   V W  RW  +++
Sbjct: 251 DIEFISFTYAVYWREDFKVDWKNRWNFFIN 280

 Score = 67.4 bits (163), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 68/263 (25%), Positives = 111/263 (42%), Gaps = 40/263 (15%)

Query: 422 VNMVLTPLLVPGIIFATMLLMNFFLVMVQSSGAMPFGTMLAIVVLWFVLSIPISIMGSLF 481
           VN ++    +PGI    +LL+N+ L    ++  +P GT+  +   +F++ +PISI+G   
Sbjct: 409 VNSIIFGSTLPGITLVIVLLLNYILKANNAANTLPHGTVALLFGAYFIVCVPISIIGGKC 468

Query: 482 ARK------KNTW---------DQHPTKTSQIAKQIPPQPWYLRTWPAAYIA-GLFPFGA 525
           A +       NT          ++H T+   +  +    P+ L+   A  +  GL PF  
Sbjct: 469 ADRFLKVNSTNTLLNSFALAEVNKHDTRPLYVESK-NSIPFVLKNPIAITLTFGLIPFAL 527

Query: 526 IAVELYFIYTSIWXXXXXXXXXX--XXXXXXXXXXXXXXXXXXXXYYSLCMEN------W 577
           I VEL F Y S+W                                Y  L   N      W
Sbjct: 528 IYVELLFAYKSLWLQKTTLYYLYGFLLSNIVIVCICICLLSIIGCYIHLNYGNDSLNFKW 587

Query: 578 ------------SWQWRSFIIGGIGCSTYVFINSILFTKF--RLGGFVTIVLYVGYSLLI 623
                       SW+W++F +GG   + Y+   SIL+  F  R   F++  L+V YS L 
Sbjct: 588 DNVIGRVLEACHSWRWKAFHMGG-AVAWYMEAYSILYLIFVARYRDFISSFLFVCYSTLF 646

Query: 624 SFLFCLVTGTIGFVSSLWFVRKI 646
           + L     G++ ++SSLWF+ K+
Sbjct: 647 NILCWTAFGSLSYLSSLWFIGKL 669

>AGL295C Chr7 complement(152197..154170) [1974 bp, 657 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YER113C
          Length = 657

 Score = 68.6 bits (166), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 102/476 (21%), Positives = 172/476 (36%), Gaps = 83/476 (17%)

Query: 24  PTTYRRGDAIPLLVNHITPTVFSDDRAGTDGQRDKERXXXXXXXXXPRLHMCRP-DKIEK 82
           P+ Y RG+ + LLV++I                D+E            L  C P  +   
Sbjct: 39  PSAYTRGERVQLLVDNI--------------WTDRE-----VWGYYETLFTCPPPAEARA 79

Query: 83  VSESLGSIIFGDRLHNSPFELKMLEEKSCVALCEKTVPAEDAKFINQLIRSGFFHNWLVD 142
           +  SLG +   +    S + L +  E  C  LC + +  +  + + Q+IR G    W +D
Sbjct: 80  IYGSLGQVFRREMPWESNYVLHVRAETQCQPLCMRELRPDSHRRLIQMIRDGAQVRWTLD 139

Query: 143 GLPAGREMHDARTNTVFYGTGFELGRVIRGTEDRNQEEPGEIELQTRRVLQPGESVVAVP 202
           GLPA     D R ++  Y  GF+LG V          E G + L                
Sbjct: 140 GLPAATTYPD-RQSSYRYEAGFKLGEV--------DAETGHVRLH--------------- 175

Query: 203 YFINHFEITVDYHKRAEDELRVVGVSVLPRSLQNPVGDKCANSGNG-----LVLSETADT 257
              NH  + V Y    +    +VG    PRS+    G+ C           L     A  
Sbjct: 176 ---NHVMLVVRYRILDDGRYVIVGFEAYPRSV---AGEGCTGGQTEYEHFWLNPDAQAMI 229

Query: 258 KVTFTYSVRF-HESDVSWATRWGKYLHVYDPKVQWYXXXXXXXXXXXXXXXXXXXXFRAL 316
            V FTY+V + ++S V W  RW  Y  +                                
Sbjct: 230 MVPFTYAVYWRYQSAVKWNERWRLYSDLQQLTGIVQSPGSLVLSRGLFAAMVGTLVLGMA 289

Query: 317 KTDLDR---YNDFNLDNEFQEDYGWKLLHSDVFRSPSKTLLLSVFVGSGGQLFLMSACTL 373
              L++        L    QED    ++ S+ F            VG+G Q   ++A   
Sbjct: 290 SAYLNKRCPATMHTLVTLLQED----MVGSEFFHG---------LVGAGLQTMSLAAA-- 334

Query: 374 FIAMLGFLSPSSRGSLGTIMFVLYAIFGGFGSYLSM-------STYKMFGGEKWKVNMVL 426
             A++   +  + G +  +  VL A     G+YL+        +T +     ++    V+
Sbjct: 335 -YALVECENDKAHG-VTHVTIVLAATICALGAYLAAFYGVWTWATTQSVVVHRYIKRSVI 392

Query: 427 TPLLVPGIIFATMLLMNFFLVMVQSSGAMPFGTMLAIVVLWFVLSIPISIMGSLFA 482
               +P ++F T  +++  +++   +  +PF T LA++ L+   S  +S+ G   A
Sbjct: 393 CGSAIPILLFVTAAIVHLIVMLSDRTRGIPFATELAVLALYIPASAILSVFGGFTA 448

>Kpol_1045.28 s1045 (64235..66280) [2046 bp, 681 aa] {ON}
           (64237..66282) [2046 nt, 682 aa]
          Length = 681

 Score = 64.7 bits (156), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 68/284 (23%), Positives = 107/284 (37%), Gaps = 67/284 (23%)

Query: 24  PTTYRRGDAIPLLVNHITPTVFSDDRAGTDGQRDKERXXXXXXXXXPRLH-----MCRPD 78
           P  Y+ GD + LLVN    T+ +D +                    P ++     +C P 
Sbjct: 49  PNVYKVGDNVDLLVNKAISTLNADLK--------------------PYIYHDLPFVCPPT 88

Query: 79  KIEK-VSESLGSIIFGDRLHNSPFELKMLEEKSCVALCEKTVPAEDAKFINQLIRSGFFH 137
            + K V     S+  GD L  S ++LK  ++  C  LC +            +I+  +  
Sbjct: 89  SVRKPVHLEFDSLFRGDTLSESDYKLKFGDDYECEILCARKTNKNGVSKAIDMIKQDYQI 148

Query: 138 NWLVDG-LPAGREMHDARTNTVFYGTGFELGRVIRGTEDRNQEEPGEIELQTRRVLQPGE 196
            W +D  LP         T    Y  GF LGR     +D+N+                  
Sbjct: 149 LWSIDDELPISMPYISTITQRKKYIPGFPLGRF---DKDKNK------------------ 187

Query: 197 SVVAVPYFINHFEITVDYHKRAEDELRVVGVSVLPRSLQNPVGDKCANSGNG-----LVL 251
                 Y  NH  + + Y+   +D+  +VG  V  RS+ +     C  +        LV+
Sbjct: 188 -----VYLYNHSMLVIRYNAIDDDKFTIVGFEVYLRSVSDY---HCPGASKNYEEYELVI 239

Query: 252 SETAD--TKVTFTYSVRFHES-DVSWATRWGKY---LHVYDPKV 289
            E  D  T + FTYSV + E  D+ W +RW  +   +   DPK+
Sbjct: 240 PENDDDLTFIPFTYSVYWREEFDIDWTSRWNLFDNDIEEEDPKL 283

 Score = 40.0 bits (92), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 48/236 (20%), Positives = 88/236 (37%), Gaps = 39/236 (16%)

Query: 448 MVQSSGAMPFGTMLAIVVLWFVLSIPISIMGSLFARK--------------KNTWDQHPT 493
           +++SS   PF T+  ++  ++++ +P SI+G   A+K               N  + +  
Sbjct: 449 LIESSSRYPFKTLTMMISFFYIICVPFSIIGGGLAKKYRKHYKEMFGNITLDNENNDNDE 508

Query: 494 KTSQIAKQIPP--QPWYLRTWPAAYIAGLFPFGAIAVELYFIYTSIWXXXXXXXXXXXXX 551
           K    A+  P       L T   + I  + PF  I  ELY+I+T+ W             
Sbjct: 509 KKRFKAQHRPSSINKNKLGTLVYSLITAIVPFFIIKSELYWIFTNKWLNYTTFIKSFIFL 568

Query: 552 XXXXXXXXXXXXXXXXX--YYSLCM-----ENW-----SWQWRSFIIGGIGC------ST 593
                              + ++ M       W     S +W  F+     C      S 
Sbjct: 569 IIKLFIIIITVSSTSLVGLFVNIMMTKKGISQWRDDPISLRWSCFLNSFNICYLTGLYSL 628

Query: 594 YVFINSILFTKFRLGGFVTIVLYVGYSLLISFLFCLVTGTIGFVSSLWFVRKIYSS 649
           Y  I  I     R+ GF   VL + Y++ ++ +  +  G I +++  W + K+Y +
Sbjct: 629 YYIIEVI-----RIHGFSMTVLTIFYTIALNVILGISCGAIAYMTCYWLIIKLYKN 679

>Kpol_1033.28 s1033 complement(69924..74519) [4596 bp, 1531 aa] {ON}
           complement(69924..74519) [4596 nt, 1532 aa]
          Length = 1531

 Score = 33.9 bits (76), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 36/69 (52%), Gaps = 7/69 (10%)

Query: 570 YSLCMENWSWQWR----SFIIGGIGCSTYVFINSILFTKFRLGGFVTIVLYVGYSLLISF 625
           Y + ++N  +Q +    + I+G +G     FI SIL   FR+ GF TI   V Y   +S 
Sbjct: 643 YKVALKNIEFQAKKGELACIVGKVGSGKSAFIQSILGDLFRVKGFATIHGNVAY---VSQ 699

Query: 626 LFCLVTGTI 634
           L  ++ GT+
Sbjct: 700 LPWIMNGTV 708

>TPHA0C00960 Chr3 (204061..208632) [4572 bp, 1523 aa] {ON} Anc_8.303
           YDR135C
          Length = 1523

 Score = 33.1 bits (74), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 37/69 (53%), Gaps = 7/69 (10%)

Query: 570 YSLCMENWSWQWR----SFIIGGIGCSTYVFINSILFTKFRLGGFVTIVLYVGYSLLISF 625
           Y + ++N +++ R    + I+G +G     FI SIL   FR+ GF +I   V Y   +S 
Sbjct: 630 YKVALKNINFEARKGELACIVGKVGSGKSAFIQSILGDLFRVKGFASIHGNVAY---VSQ 686

Query: 626 LFCLVTGTI 634
           L  ++ GT+
Sbjct: 687 LAWIMNGTV 695

>CAGL0L06402g Chr12 (720723..725330) [4608 bp, 1535 aa] {ON} highly
           similar to uniprot|P39109 Saccharomyces cerevisiae
           YDR135c YCF1 or uniprot|P14772 Saccharomyces cerevisiae
           YLL015w BPT1
          Length = 1535

 Score = 33.1 bits (74), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 37/69 (53%), Gaps = 7/69 (10%)

Query: 570 YSLCMENWSWQWR----SFIIGGIGCSTYVFINSILFTKFRLGGFVTIVLYVGYSLLISF 625
           Y + ++N ++Q +    S I+G +G     F+ S+L   FR+ GF TI   V Y   +S 
Sbjct: 661 YKVALKNINYQAKKGELSCIVGKVGSGKSAFLQSLLGDLFRVKGFATIHGSVAY---VSQ 717

Query: 626 LFCLVTGTI 634
           +  ++ GT+
Sbjct: 718 VAWIMNGTV 726

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.325    0.141    0.444 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 60,827,592
Number of extensions: 2399488
Number of successful extensions: 6980
Number of sequences better than 10.0: 51
Number of HSP's gapped: 6908
Number of HSP's successfully gapped: 91
Length of query: 653
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 537
Effective length of database: 40,180,143
Effective search space: 21576736791
Effective search space used: 21576736791
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 69 (31.2 bits)