Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
AGR095W8.256ON1201120162060.0
Ecym_43158.256ON1212122528240.0
SAKL0H17204g8.256ON1211124119130.0
YLR084C (RAX2)8.256ON1220125316740.0
Suva_10.1688.256ON1220125916450.0
NDAI0B023808.256ON1219123616200.0
Skud_12.1528.256ON1220125416100.0
Smik_12.1438.256ON1220125115990.0
KLLA0F18975g8.256ON1200123215670.0
NCAS0B049808.256ON1204122715280.0
KAFR0B026908.256ON1210125015290.0
TPHA0B032508.256ON1215124615130.0
ZYRO0C01804g8.256ON1209123015030.0
TDEL0F038308.256ON1195122514970.0
KLTH0G13838g8.256ON1214123514870.0
Kpol_392.108.256ON1226126614760.0
Kwal_56.235898.256ON1213123513581e-166
KNAG0G020008.256ON1202124713281e-162
TBLA0E043908.256ON1278131512901e-156
CAGL0L12144g8.256ON1156109411691e-139
CAGL0L08910g8.84ON623106820.60
Kpol_1049.21singletonON3711138745.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AGR095W
         (1201 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AGR095W Chr7 (914098..917703) [3606 bp, 1201 aa] {ON} Syntenic h...  2395   0.0  
Ecym_4315 Chr4 (679627..683265) [3639 bp, 1212 aa] {ON} similar ...  1092   0.0  
SAKL0H17204g Chr8 (1522944..1526579) [3636 bp, 1211 aa] {ON} sim...   741   0.0  
YLR084C Chr12 complement(296589..300251) [3663 bp, 1220 aa] {ON}...   649   0.0  
Suva_10.168 Chr10 complement(301631..305293) [3663 bp, 1220 aa] ...   638   0.0  
NDAI0B02380 Chr2 complement(595444..599103) [3660 bp, 1219 aa] {...   628   0.0  
Skud_12.152 Chr12 complement(279947..283609) [3663 bp, 1220 aa] ...   624   0.0  
Smik_12.143 Chr12 complement(276428..280090) [3663 bp, 1220 aa] ...   620   0.0  
KLLA0F18975g Chr6 complement(1739543..1743145) [3603 bp, 1200 aa...   608   0.0  
NCAS0B04980 Chr2 complement(912114..915728) [3615 bp, 1204 aa] {...   593   0.0  
KAFR0B02690 Chr2 complement(539470..543102) [3633 bp, 1210 aa] {...   593   0.0  
TPHA0B03250 Chr2 (745716..749363) [3648 bp, 1215 aa] {ON} Anc_8....   587   0.0  
ZYRO0C01804g Chr3 (140029..143658) [3630 bp, 1209 aa] {ON} simil...   583   0.0  
TDEL0F03830 Chr6 complement(701362..704949) [3588 bp, 1195 aa] {...   581   0.0  
KLTH0G13838g Chr7 (1197919..1201563) [3645 bp, 1214 aa] {ON} sim...   577   0.0  
Kpol_392.10 s392 (27006..30686) [3681 bp, 1226 aa] {ON} (27006.....   573   0.0  
Kwal_56.23589 s56 complement(610601..614242) [3642 bp, 1213 aa] ...   527   e-166
KNAG0G02000 Chr7 complement(443631..447239) [3609 bp, 1202 aa] {...   516   e-162
TBLA0E04390 Chr5 complement(1115294..1119130) [3837 bp, 1278 aa]...   501   e-156
CAGL0L12144g Chr12 complement(1304574..1308044) [3471 bp, 1156 a...   454   e-139
CAGL0L08910g Chr12 (973872..975743) [1872 bp, 623 aa] {ON} simil...    36   0.60 
Kpol_1049.21 s1049 (53694..64829) [11136 bp, 3711 aa] {ON} (5369...    33   5.6  

>AGR095W Chr7 (914098..917703) [3606 bp, 1201 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YLR084C (RAX2)
          Length = 1201

 Score = 2395 bits (6206), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1162/1201 (96%), Positives = 1162/1201 (96%)

Query: 1    MRLHMGLVAALAPLGDVVRGSHLESVAQHFDIKHWQTPRLDLSAARNERLLVFDDFQAFE 60
            MRLHMGLVAALAPLGDVVRGSHLESVAQHFDIKHWQTPRLDLSAARNERLLVFDDFQAFE
Sbjct: 1    MRLHMGLVAALAPLGDVVRGSHLESVAQHFDIKHWQTPRLDLSAARNERLLVFDDFQAFE 60

Query: 61   YYNYKGQQLFTGQEQHQGSSLIYYSEGTYVQLAKLDDDTVVRRIVPFGSDSFILSGTGKL 120
            YYNYKGQQLFTGQEQHQGSSLIYYSEGTYVQLAKLDDDTVVRRIVPFGSDSFILSGTGKL
Sbjct: 61   YYNYKGQQLFTGQEQHQGSSLIYYSEGTYVQLAKLDDDTVVRRIVPFGSDSFILSGTGKL 120

Query: 121  QDQRLEHQLMYNLSTLEVTEILPQSLESVNDILVDGDMVYFGGQFTYSDGNKSGHSAVQW 180
            QDQRLEHQLMYNLSTLEVTEILPQSLESVNDILVDGDMVYFGGQFTYSDGNKSGHSAVQW
Sbjct: 121  QDQRLEHQLMYNLSTLEVTEILPQSLESVNDILVDGDMVYFGGQFTYSDGNKSGHSAVQW 180

Query: 181  NATSRTTSLLPFGGFGRGSSVNNILKLSGSGVLFVGRFSNLEAASYAETASVLASTEKPQ 240
            NATSRTTSLLPFGGFGRGSSVNNILKLSGSGVLFVGRFSNLEAASYAETASVLASTEKPQ
Sbjct: 181  NATSRTTSLLPFGGFGRGSSVNNILKLSGSGVLFVGRFSNLEAASYAETASVLASTEKPQ 240

Query: 241  LNVTTIETNALTSLRYSTITSDGHLDKGKFICPTSNDDSWFVPHSGDGPARGELNIKVLH 300
            LNVTTIETNALTSLRYSTITSDGHLDKGKFICPTSNDDSWFVPHSGDGPARGELNIKVLH
Sbjct: 241  LNVTTIETNALTSLRYSTITSDGHLDKGKFICPTSNDDSWFVPHSGDGPARGELNIKVLH 300

Query: 301  RIIPSKIRIYNSKKNGNEIKLFRIVTSPSQSIMNMTYIDPNTGELATCDAWCPLMPRSNL 360
            RIIPSKIRIYNSKKNGNEIKLFRIVTSPSQSIMNMTYIDPNTGELATCDAWCPLMPRSNL
Sbjct: 301  RIIPSKIRIYNSKKNGNEIKLFRIVTSPSQSIMNMTYIDPNTGELATCDAWCPLMPRSNL 360

Query: 361  TSKAAESGPADVARLVNDEKVLIKWTPDYQEFAFINQIHMEEIKFIALDSYGNNVGLVGV 420
            TSKAAESGPADVARLVNDEKVLIKWTPDYQEFAFINQIHMEEIKFIALDSYGNNVGLVGV
Sbjct: 361  TSKAAESGPADVARLVNDEKVLIKWTPDYQEFAFINQIHMEEIKFIALDSYGNNVGLVGV 420

Query: 421  ELFQTEYDAYVNSTLNQPNCGEQQLSPFSTTANIWHQGATDASYLSANVVESNPMVNVKP 480
            ELFQTEYDAYVNSTLNQPNCGEQQLSPFSTTANIWHQGATDASYLSANVVESNPMVNVKP
Sbjct: 421  ELFQTEYDAYVNSTLNQPNCGEQQLSPFSTTANIWHQGATDASYLSANVVESNPMVNVKP 480

Query: 481  VIPHSGTYTLNLYTPGCEDDGTCDYRGIVNVTLLASNGTTLMTRWIYQNNYRLKYDPLYT 540
            VIPHSGTYTLNLYTPGCEDDGTCDYRGIVNVTLLASNGTTLMTRWIYQNNYRLKYDPLYT
Sbjct: 481  VIPHSGTYTLNLYTPGCEDDGTCDYRGIVNVTLLASNGTTLMTRWIYQNNYRLKYDPLYT 540

Query: 541  GHLDPNPTVRMEWVSPINSAVNRKIMVADRVSAIIDSLDGLDDIRHPREKSLNGLFQYTP 600
            GHLDPNPTVRMEWVSPINSAVNRKIMVADRVSAIIDSLDGLDDIRHPREKSLNGLFQYTP
Sbjct: 541  GHLDPNPTVRMEWVSPINSAVNRKIMVADRVSAIIDSLDGLDDIRHPREKSLNGLFQYTP 600

Query: 601  AGSSLDNGIQKYINKDPQTDMPEGVSLVGQVYDGKLILGVKSTGHIAVVTPKGTDWNDVD 660
            AGSSLDNGIQKYINKDPQTDMPEGVSLVGQVYDGKLILGVKSTGHIAVVTPKGTDWNDVD
Sbjct: 601  AGSSLDNGIQKYINKDPQTDMPEGVSLVGQVYDGKLILGVKSTGHIAVVTPKGTDWNDVD 660

Query: 661  VTRQDVPGSLNGISPYSKGLVFTGKFNLSSGPSSALHYDGNFGSFFDLNSETSSIINMTI 720
            VTRQDVPGSLNGISPYSKGLVFTGKFNLSSGPSSALHYDGNFGSFFDLNSETSSIINMTI
Sbjct: 661  VTRQDVPGSLNGISPYSKGLVFTGKFNLSSGPSSALHYDGNFGSFFDLNSETSSIINMTI 720

Query: 721  DGSELLLFNNKFIYNTSTSQMLTSSMFQXXXXXXXXXXXXXXXFTGSIADIKHGSAHGAV 780
            DGSELLLFNNKFIYNTSTSQMLTSSMFQ               FTGSIADIKHGSAHGAV
Sbjct: 721  DGSELLLFNNKFIYNTSTSQMLTSSMFQLSALSAAANSNNDLLFTGSIADIKHGSAHGAV 780

Query: 781  ALDAEGNIFTSGTPSISGARVHRGVYLNDTATAYAYYSVSPNSSVATGGVVIETPGNNFN 840
            ALDAEGNIFTSGTPSISGARVHRGVYLNDTATAYAYYSVSPNSSVATGGVVIETPGNNFN
Sbjct: 781  ALDAEGNIFTSGTPSISGARVHRGVYLNDTATAYAYYSVSPNSSVATGGVVIETPGNNFN 840

Query: 841  LSNNIATVREMIYVKKTNFLVISTNEVEGTPGALILYDLRTLQEVAREKLNPGERINSIV 900
            LSNNIATVREMIYVKKTNFLVISTNEVEGTPGALILYDLRTLQEVAREKLNPGERINSIV
Sbjct: 841  LSNNIATVREMIYVKKTNFLVISTNEVEGTPGALILYDLRTLQEVAREKLNPGERINSIV 900

Query: 901  LFGEDNTLLVGGSFEKDGCHDLCLYNFVKRSWSAFASGLISGEIKQLQFVNNRNLIAVGS 960
            LFGEDNTLLVGGSFEKDGCHDLCLYNFVKRSWSAFASGLISGEIKQLQFVNNRNLIAVGS
Sbjct: 901  LFGEDNTLLVGGSFEKDGCHDLCLYNFVKRSWSAFASGLISGEIKQLQFVNNRNLIAVGS 960

Query: 961  MTVQSRPNILFLNFDLVRSRVVEQHEQPNGRAFNSVLTIGDSGDEYVAEDGKQVWHYSGS 1020
            MTVQSRPNILFLNFDLVRSRVVEQHEQPNGRAFNSVLTIGDSGDEYVAEDGKQVWHYSGS
Sbjct: 961  MTVQSRPNILFLNFDLVRSRVVEQHEQPNGRAFNSVLTIGDSGDEYVAEDGKQVWHYSGS 1020

Query: 1021 EWKTVTPLSGGQIRIDGISLLMLNNPRSQNKRNRVGNELVVIHGQMNSSEYGEINAMHYN 1080
            EWKTVTPLSGGQIRIDGISLLMLNNPRSQNKRNRVGNELVVIHGQMNSSEYGEINAMHYN
Sbjct: 1021 EWKTVTPLSGGQIRIDGISLLMLNNPRSQNKRNRVGNELVVIHGQMNSSEYGEINAMHYN 1080

Query: 1081 FENWEPYYFTIGSSAREEFNVPRGQIFLNQDISRQTTTSLPLEVVVSDSPPTAEPKRKLA 1140
            FENWEPYYFTIGSSAREEFNVPRGQIFLNQDISRQTTTSLPLEVVVSDSPPTAEPKRKLA
Sbjct: 1081 FENWEPYYFTIGSSAREEFNVPRGQIFLNQDISRQTTTSLPLEVVVSDSPPTAEPKRKLA 1140

Query: 1141 KGYXXXXXXXXXXXXXXXXXXXXXXXXYAFGDHNAYQPLKPRINEDEMLKTVPPEKLMKF 1200
            KGY                        YAFGDHNAYQPLKPRINEDEMLKTVPPEKLMKF
Sbjct: 1141 KGYVVLIALGLALATIALLGIIGVILAYAFGDHNAYQPLKPRINEDEMLKTVPPEKLMKF 1200

Query: 1201 I 1201
            I
Sbjct: 1201 I 1201

>Ecym_4315 Chr4 (679627..683265) [3639 bp, 1212 aa] {ON} similar to
            Ashbya gossypii AGR095W
          Length = 1212

 Score = 1092 bits (2824), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 561/1225 (45%), Positives = 789/1225 (64%), Gaps = 37/1225 (3%)

Query: 1    MRLHMGLVAALAPLGDVVRGSHLESVAQHFDIKHWQTPRLDLSAARNERLLVFDDFQAFE 60
            M +H   +  L+ +  + +GS +  V  HF+I  +  P LDLS  RN +LL+FDDFQ F+
Sbjct: 1    MYIHKYTLLVLSFVAGLAQGSQINGVVNHFNITQYTAPHLDLSTVRNSQLLIFDDFQTFD 60

Query: 61   YYNYKGQQLFTGQEQHQGSSLIYYSEGTYVQLAKLDDDTVVRRIVPFGSDSFILSGTGKL 120
            YY YKGQQ+FTG    + +SLIYYS  TYVQLA+L D   +++IVP+G DSFILSG G  
Sbjct: 61   YYTYKGQQIFTGLADERKNSLIYYSNNTYVQLAELPDGAEIKKIVPWGDDSFILSGRGVF 120

Query: 121  QDQRLEHQLMYNLSTLEVTEILPQSLESVNDILVDGDMVYFGGQFTYSDGNKSGHSAVQW 180
            +  RLEHQL+YNLS+ E+TEIL + LE VNDIL DG++VYFGG FTY+DGN SGHS V+W
Sbjct: 121  EGHRLEHQLIYNLSSFEITEILKEPLEHVNDILTDGEVVYFGGGFTYNDGNLSGHSVVKW 180

Query: 181  NATSRTTSLLPFGGFGRGSSVNNILKLSGSGVLFVGRFSNLEAASYAETASVLASTEKPQ 240
            +AT +++SLLPF GFG+GS VNNI+KL  S +LFVG+FS ++  +     +V +S     
Sbjct: 181  DATDKSSSLLPFYGFGQGSVVNNIIKLDDSNILFVGKFSTIDNTALLPHRNVSSSFLS-- 238

Query: 241  LNVTTIETNALTSLRYSTITSDGHLDKGKFICPTSNDDSWFVPHSGDGPARGELNIKVLH 300
             N T IETNAL SLR+S++  DG L+   F+CP  + DSW +PHS      GEL I+V++
Sbjct: 239  -NSTNIETNALASLRFSSLVHDGTLNSSAFVCPEGSADSWTIPHS----TMGELTIRVIN 293

Query: 301  RIIPSKIRIYNSKKNGNEIKLFRIVTSPSQSIMNMTYIDPNTGELATCDAWCPLMPRSNL 360
            ++ PSKIRIYNSK + N++ LFRIVTSPS+SIMNMTY+DP TG LA CDAWCPL P S L
Sbjct: 294  QMTPSKIRIYNSKDSNNQVNLFRIVTSPSRSIMNMTYVDPITGALAVCDAWCPLQPLSVL 353

Query: 361  TSKAAESGPADVARLVNDEKVLIKWTPDYQEFAFINQIHMEEIKFIALDSYGNNVGLVGV 420
            ++ A  S  + +A   N+  VL+KWT  YQEFAF+N++ ++E+ FIA+DS+G+NVGL+G+
Sbjct: 354  SNLAENSTSSVMAAFPNNNNVLVKWTAAYQEFAFVNRVPIQELTFIAIDSFGHNVGLLGI 413

Query: 421  ELFQTEYDAYVNSTLNQPNCGEQQLSPFSTTAN--IWHQGATDASYLSANVVESNPMVNV 478
            ELFQ EYD YVN+TLNQPNC  QQ  P S  +   +W+QG  D SY++ +     P V +
Sbjct: 414  ELFQAEYDTYVNNTLNQPNCDSQQNFPASVVSKDTVWYQGLPDQSYMATSFTAGKPSVTL 473

Query: 479  KPVIPHSGTYTLNLYTPGCEDDGTCDYRGIVNVTLLASNGTTLMTRWIYQNNYRLKYDPL 538
             P IP+ G YTLNL TPGC  D TC +RGIVNVT+ A NGT LM RWIYQNN  LKYDPL
Sbjct: 474  TPSIPYPGIYTLNLVTPGCLTDNTCAFRGIVNVTIRAQNGTHLMNRWIYQNNENLKYDPL 533

Query: 539  YTGHLDPNPTVRMEWVSPINSAVNRKIMVADRVSAIIDSLDGLDDIRHPREKS--LNGLF 596
            + G+LD +P V +EW+ PI+ A    +MVADRV++IIDS++ L ++++    S  LNGLF
Sbjct: 534  FRGYLDDSPNVVLEWIGPIDPAAANNVMVADRVTSIIDSIEDL-EMKNGTSNSNLLNGLF 592

Query: 597  QYTPAGSSLDNGI------QKYINKDPQTDMPEGVSLVGQVYDGKLILGVKSTGHIAVVT 650
            QY  A S+  N           I++ P  ++P   SL GQ+Y+  L +G  S   +A ++
Sbjct: 593  QY--AASNFTNTNLSTLVGSTNIDQYPVRNIPHSSSLFGQIYNDTLFIGSPSIDGLAKIS 650

Query: 651  PKGTDWNDVDVTRQ--DVPGSLNGISPYSKGLVFTGKFNLSSGPSSALHYDGNFGSFFDL 708
             +  DWND+ V  Q  D  G + GI PYS GL  T   N  +  +S+L ++G+  + F  
Sbjct: 651  RRKDDWNDIIVDPQLIDTEGPVTGIFPYSNGLALTVHSN-QTNMASSLSFNGSISTIFRS 709

Query: 709  NSETSSIINMTIDGSELLLFNNKFIYNTST-SQMLTSSMFQXXXXXXXXXXXXXXXFTGS 767
            N+ + SI+N+TIDGSE+L+F+N ++YN S+ S +  S   +                 G+
Sbjct: 710  NAPSLSILNLTIDGSEILVFDNGYVYNVSSQSDISNSETLKLSLLSAGANLEDDLILAGN 769

Query: 768  IADIKHGSAHGAVALDAEGN-IFTSGTPSISGARVHRGVYLNDTATAYAYYSVSPNSSVA 826
            +   KH   +GA+A+DA+ N + TSG PS+    ++RG+++ND+++AYAYYS S  SS  
Sbjct: 770  VQSTKHFVPNGAIAIDADSNEVVTSGLPSVDDGIIYRGLFINDSSSAYAYYSKSLGSS-- 827

Query: 827  TGGVVIETPGNNFNLSNNIATVREMIYVKKTNFLVISTNEVEGTPGALILYDLRTLQEVA 886
             GG+V+        LS + +TV +M+Y+K +N L + T+       +L ++DL       
Sbjct: 828  KGGIVVYGEHEPEYLSTDDSTVNDMLYIKDSNLLAVVTSGTSQGLASLYIHDLSADFAPI 887

Query: 887  REKLNPGERINSIVLFGEDNTLLVGGSFEKDGCHDLCLYNFVKRSWSAFASGLISGEIKQ 946
            +E    GE IN++VLFG + TLLVGG+F ++GC DLCLYN+   +W+ F  G I+G+I+Q
Sbjct: 888  KETFEIGEVINTMVLFGRNYTLLVGGTFTRNGCRDLCLYNYATNNWTRFMDGNITGDIRQ 947

Query: 947  LQFVNNRNLIAVGSMTVQSRPNILFLNFDLVRSRVVEQHEQPNGRAFNSVLTIGDSGDEY 1006
            LQF++   L+  G +      ++  +  DL    ++ + +  N   F  VLT+G+S  E 
Sbjct: 948  LQFLDGNTLMVAGLLASSDSKDLQLVEIDLSNMEIISKLQGTNTGTFQHVLTVGNSSSEL 1007

Query: 1007 VAEDGKQVWHYSGSEWKTVTPLSGGQIRIDGISLLM--LNNPRSQNKRNRVGNELVVIHG 1064
            +A DG QV+H+   +WK ++P + GQ +I+G++LL    +   S  KR+RVGNELVVI+G
Sbjct: 1008 IAHDGNQVFHFVDGQWKNISPDTSGQTQINGLTLLSTDFSQRNSIMKRDRVGNELVVING 1067

Query: 1065 QMNSSEYGEINAMHYNFENWEPYYFTIGSSAREEFNVPRGQIFLNQDISRQTTTSLPL-- 1122
              +S +YG+INAM+Y+F  W PYYF++   +  +  +P+GQ+FLN+D+S  +++ + L  
Sbjct: 1068 NFSSPDYGDINAMYYDFNGWNPYYFSVPRESNSDEVIPQGQLFLNKDVSFTSSSQIYLSN 1127

Query: 1123 EVVVSDSPPTAEPK------RKLAKGYXXXXXXXXXXXXXXXXXXXXXXXXYAFGDHNAY 1176
            +    D+P  +EP       +KLAK +                        Y FGDHNAY
Sbjct: 1128 DNDNDDTPAASEPATHEKHTKKLAKIFVVLIALALALATVAVLGVVGVLFAYLFGDHNAY 1187

Query: 1177 QPLKPRINEDEMLKTVPPEKLMKFI 1201
            +PLKPRINE EMLKTVPPEKLMKFI
Sbjct: 1188 EPLKPRINEAEMLKTVPPEKLMKFI 1212

>SAKL0H17204g Chr8 (1522944..1526579) [3636 bp, 1211 aa] {ON} similar
            to uniprot|Q12465 Saccharomyces cerevisiae YLR084C RAX2
            N-glycosylated protein involved in the maintenance of bud
            site selection during bipolar budding localization
            requires Rax1p
          Length = 1211

 Score =  741 bits (1913), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 449/1241 (36%), Positives = 676/1241 (54%), Gaps = 70/1241 (5%)

Query: 1    MRLHMGLVAALAPLGDVVRGSHLESVAQHFDIKHWQTPRLDLSAARNERLLVFDDFQAFE 60
            M   + ++ A   L  +V GS L S+ +  +I+    P++DLS++ N+ + +  DF+   
Sbjct: 1    MTAFLKILTATYALCQLVTGSQLSSLKEKLNIQDLSIPQIDLSSSVNDEMALLGDFEDLT 60

Query: 61   YYNYKGQQLFTGQEQHQGSSLIYYSEGTYVQLAKLDDDTV---VRRIVPFGSDSFILSGT 117
            +Y Y GQ+ FTG        LIYYS GT+++L  L D+     +  I+PFG DSFILSGT
Sbjct: 61   FYRYTGQENFTGSITETEKDLIYYSNGTFIKLDSLSDENATADINHIIPFGDDSFILSGT 120

Query: 118  GKL-QDQRLEHQLMYNLSTLEVTEILPQSLESVNDILVDGDMVYFGGQFTYSDGNKSGHS 176
            G L     LE QL+YNLS+LE T I  QS+ +VNDIL D ++VYFGG+F Y+ GN +GHS
Sbjct: 121  GTLPGGHNLEQQLLYNLSSLEYTAIFNQSISTVNDILADDEIVYFGGEFQYTLGNSTGHS 180

Query: 177  AVQWNATSRTTSLLPFGGFGRGSSVNNILKLSGSGVLFVGRFSNLEAASYAETASVLAST 236
             V WN+T+    LLPF GFG  S VN+IL+L    ++F G+F+ L+  +  +      S+
Sbjct: 181  VVLWNSTTNEIQLLPFKGFGLDSVVNSILRLDNDNIVFAGKFNTLDDNTLLKQIRGSNSS 240

Query: 237  EKPQLNVTTIETNALTSLRYSTITSDGHLDKGKFICPTSNDDSWFVPHSGDGPARGELNI 296
            +    N T IE + L  L+++  +S G L+    ICP+ + D WF     +G A G+  +
Sbjct: 241  K----NATDIEFDQLIPLKHAGWSSQGSLEHSSLICPSDDSDGWF----QEGTATGDFTV 292

Query: 297  KVLHRIIPSKIRIYNSKKNGNEIKLFRIVTSPSQSIMNMTYIDPNTGELATCDAWCPLMP 356
             +L  + PSK+RIYN+  +  ++ LFRI+TSP+  IMN+TY+DP TGEL+ CDAWCPL+ 
Sbjct: 293  SLLTDLRPSKLRIYNAFDSDYQVSLFRIITSPANGIMNLTYLDPQTGELSYCDAWCPLLS 352

Query: 357  RSNL-TSKAAESGPADVARLVNDEKVLIKWTPDYQEFAFINQIHMEEIKFIALDSYGNNV 415
               L  ++A  +  +D    + +    IKWT  YQEFAF+N++ +E + F+ALDSYG++V
Sbjct: 353  TELLEQAEANVTISSDSVAYIGNNNTNIKWTSAYQEFAFVNEVSVESLTFLALDSYGSSV 412

Query: 416  GLVGVELFQTEYDAYVNSTLNQPNCGEQQLSPFSTTANI--WHQGATDASYLSANVVESN 473
            GL G E++Q  Y  + N TLNQPNC        + T++   W QG+ D+SY+ +    + 
Sbjct: 413  GLDGFEMYQNGYPTFANDTLNQPNCDNINSYSHAVTSSKQQWTQGSMDSSYILSTYDGTG 472

Query: 474  --PMVNVKPVIPHSGTYTLNLYTPGCEDDGTCDYRGIVNVTLLAS-NGTTLMTRWIYQNN 530
              P VN  P I ++G YTLN+ TPGC  DG+C  RGIVNVT+    N T L T+ IYQNN
Sbjct: 473  DLPSVNFYPNITYAGDYTLNMVTPGCTGDGSCSSRGIVNVTVWDQINDTVLSTKLIYQNN 532

Query: 531  YRLKYDPLYTGHLDPNPTVRMEWVSPINSAVNRKIMVADRVSAIIDSLD----GLDDIRH 586
               KYD LY+G+L+  P + +++   IN+  +  IMVADRV  IIDS+D    GL  I  
Sbjct: 533  NDEKYDLLYSGYLESAPKITLKFYESINTDSSTSIMVADRVDVIIDSIDQSKIGLKTIN- 591

Query: 587  PREKSLNGLFQY------TPAGSSLDNGIQKYINKDPQTDMPEGVSLVGQVYDGKLILGV 640
               ++LNGLFQY      T +  SL  G    IN+    ++P    L    Y+  L++  
Sbjct: 592  ---ETLNGLFQYQISNFTTISNDSLKIG-NTTINRYSIENVPSNSELFAGYYNNTLLVDG 647

Query: 641  KSTGHIAVVTPKGTDWNDVDVTRQDVPGSLNGISPYSKGLVFTGKFNLSSGPSSALHYDG 700
               G IAV+     D N +   R    G   GI+ YS GL+F G FNLSS   S L Y+G
Sbjct: 648  AFNG-IAVLQLND-DLNIISEQRMGTGGPTEGINTYSNGLLFLGDFNLSSQQISTLSYNG 705

Query: 701  NFGSFFDLNSETSSIINMTIDGSELLLFNNKFIYNTSTSQML-TSSMFQXXXXXXXXXXX 759
             F SF +L +  +   N+TID SELL+FNN++I+N S+++ +  +S F            
Sbjct: 706  TFSSFGNLRTNITRFNNITIDDSELLVFNNRYIFNVSSNEYIRNTSSFALSLWSAGSNSK 765

Query: 760  XXXXFTGSIADIKHGSAHGAVALDAEGNIFTSGTPSISGARVHRGVYLNDTATAYAYYSV 819
                  G+++  ++   +GAV ++   +I T G PS  G RV+   Y+ND++TAYAY S 
Sbjct: 766  EDGILVGAVSQRQYTELNGAVYINDANSISTIGLPSFDGKRVYTATYINDSSTAYAYSSK 825

Query: 820  SPNSSVATGGVVIETPGNNFNLSNNIA-TVREMIYVKKTNFLVISTNEVEGTPGALILYD 878
            +     +T  V+I     + +L  + +  V  MIY K  + L + TN  +    +L L++
Sbjct: 826  ND----STHHVLIARGNRSEDLPVSWSHAVNTMIYNKDDSLLAVGTNAGDTNGTSLSLFN 881

Query: 879  LRTLQEVAREKLNPGERINSIVLFGEDNTLLVGGSFEKD----GCHDLCLYNFVKRSWSA 934
            +   + +  E L     +N+IV F ++++LLVGG F  D     C  LCLYN+    WS 
Sbjct: 882  ISNSKMIGEENLGAKSSVNAIVAFNKNSSLLVGGDFTIDKDDTSCSGLCLYNYNASKWSN 941

Query: 935  FASGLISGEIKQLQFVNNRNLIAVGSMTVQSRPNILFLNFDLVRSRV-VEQHEQPNGRAF 993
            F +  ISG I  LQF N   L+  G++  ++   I     ++  + V + +H     ++F
Sbjct: 942  FYNNSISGNITDLQFFNGTQLLISGNLYTENETGINLAKLNMASNEVTILRHGSTMVQSF 1001

Query: 994  NSVLTIGDSGDEYVAEDGKQVWHYSGSEWKTVTPLSGGQIRIDGISLLMLNNPRSQNKRN 1053
               +T   + DE + +   ++ +Y+  EWK +T          G  L+ L   ++ +KR+
Sbjct: 1002 ---VTFDHTTDELITQSDNEISYYTNGEWKNLTSEDFNDSLYMGAQLIPL--KQTSSKRD 1056

Query: 1054 RVGNELVVIHGQMNSSEYGEINAMHYNFENWEPYYFTIGSSAREEFNVPRGQIFLNQDIS 1113
             V N  ++++G +  S YG ++AM Y+FE+W PY+   G +A    N     IF+N+D+S
Sbjct: 1057 -VSNRALLVNGDLKHSTYGSVSAMLYDFEDWMPYFIVDGENAGRASN-----IFMNKDLS 1110

Query: 1114 RQTTTSLPLE------------VVVSDSPPTAEPKRKLAKGYXXXXXXXXXXXXXXXXXX 1161
               TT   L+            +    S        K+ +G+                  
Sbjct: 1111 SLYTTQTILQGSNTSTSTTSSNMPSETSDKNESSSDKIDRGFVVLIGLALAIGTVAVLGG 1170

Query: 1162 XXXXXXYAF-GDHNAYQPLKPRINEDEMLKTVPPEKLMKFI 1201
                  Y F G+   Y+PLKPR++E +M+ TVPPEKLMKF+
Sbjct: 1171 AGAIIAYFFAGNKGQYEPLKPRVDEGDMIDTVPPEKLMKFV 1211

>YLR084C Chr12 complement(296589..300251) [3663 bp, 1220 aa] {ON}
            RAX2N-glycosylated protein involved in the maintenance of
            bud site selection during bipolar budding; localization
            requires Rax1p; RAX2 mRNA stability is regulated by Mpt5p
          Length = 1220

 Score =  649 bits (1674), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 422/1253 (33%), Positives = 670/1253 (53%), Gaps = 85/1253 (6%)

Query: 1    MRLHMGLVAALAPLGDVVRGSHLESVAQHFDIKHWQTPRLDLSAARNERLLVFDDFQAFE 60
            M +H     A   L ++ + S LE++    DI+    P L++S   +  + +     A  
Sbjct: 1    MFVHRLWTLAFPFLVEISKASQLENIKSLLDIEDNVLPNLNISQNNSNAVQILGGVDALS 60

Query: 61   YYNYKGQQLFTGQEQHQGSS--LIYYSEGTYVQLAKLDDDTVVRRIVPFGSDSFILSGTG 118
            +Y Y GQQ FT +   + SS  L+YYS  TY+QL    DDT + +I PFG DSFILSG+G
Sbjct: 61   FYEYTGQQNFTKEIGPETSSHGLVYYSNNTYIQLEDASDDTRIDKITPFGVDSFILSGSG 120

Query: 119  KLQDQRLEHQLMYNLSTLEVTEILPQSLESVNDILVDGDMVYFGGQFTYSDGNKSGHSAV 178
             + +  + +Q++YNLSTL +T I  QSL +V  +L D   +YFGG F+Y++G+ +G+SA+
Sbjct: 121  TINNISVGNQILYNLSTLSMTPIFNQSLGAVQAVLADNSSIYFGGNFSYNNGSMTGYSAL 180

Query: 179  QWNATSRTTSLLPFGGFGRGSSVNNILKLSGSGVLFVGRFSNLEAASYAETASVLASTEK 238
             W++ S TT LLPFGGFG  SSVN+I+KL+   +LF G+F  L+  S   ++S   +   
Sbjct: 181  IWDSISNTTQLLPFGGFGENSSVNSIVKLNNDNILFAGQFYTLDDPSALISSSNNGTNST 240

Query: 239  PQLNVTTIETNALTSLRYSTITSDGH--LDKGKFICPTSNDDSWFVPHSGDGPARGELNI 296
              LN TT+E      LRY++  S G         +CP +N+D+W  P +      G L  
Sbjct: 241  SSLNATTLELGQRIPLRYASWDSQGSTTFASDSLVCPNTNEDAWLYPDT-----SGSLVC 295

Query: 297  KVLHRIIPSKIRIYNSKKNGNEIKLFRIVTSPSQSIMNMTYIDPNTGELATCDAWCPLMP 356
             + + + P+KIR+YNS+++ +EI +F+I+T PS SIMN+TY+DP +GEL  C  +CPL  
Sbjct: 296  NLPYEVSPTKIRLYNSQRSDSEISVFQILTDPSSSIMNLTYLDPLSGELKNCGEFCPLYS 355

Query: 357  RSNLTSKAAE-SGPADVARLVNDEKVLIKWTPDYQEFAFINQIHMEEIKFIALDSYGNNV 415
            R+ L S +   S   D+   +++ K  +KWT D+Q+FAF+N++ +  +KF+AL+SYG +V
Sbjct: 356  RATLLSASQNVSSSMDMITFIDNNKTDVKWTSDFQDFAFVNELPVSSLKFVALNSYGGSV 415

Query: 416  GLVGVELFQTEYDAYVNSTLNQPNCGE--QQLSPFSTTANIWHQGATDASYLSANVV--- 470
            GL G+EL+Q  +  Y N +LN+  C       S  + ++N W+ G T  SY++A  V   
Sbjct: 416  GLSGLELYQDTFSTYANDSLNEYGCSALTNDSSSSTLSSNDWYNGLTGESYIAAKYVPDQ 475

Query: 471  -ESNPMVNVKPVIPHSGTYTLNLYTPGCEDDGTCDYRGIVNVTLLASNGTTLM-TRWIYQ 528
             E  P V   P I H G YT+N+YTPGC  D TC  RGIVNVT+      T+M T  IYQ
Sbjct: 476  NEPIPRVKFYPNIIHPGHYTINMYTPGCLQDNTCSARGIVNVTMWNQQNNTIMKTYLIYQ 535

Query: 529  NNYRLKYDPLYTGHLDPNPTVRMEWVSPINSAVNRKIMVADRVSAIIDSLDGL----DDI 584
            NN  LKYD +Y+G+LD +P + +E+VS I +     ++VAD+V+ I  SLD      D  
Sbjct: 536  NNDNLKYDQIYSGYLDFSPEIVLEYVSGIYTTNTATVVVADQVNVITVSLDAFNTLSDSS 595

Query: 585  RHPREKSLNGLFQYTPAG--SSLDNGIQ---KYINKDPQTDMPEGVSLVGQVYDGKLILG 639
               +E  LNG+ QY  +   S+  N  +     +N  P  + P+  SL   +YD KL++G
Sbjct: 596  NAKKETLLNGILQYQKSNFTSTRLNETKVGNTTLNLFPVKNYPKNSSLYADIYDNKLVIG 655

Query: 640  VKSTGHIAVVTPKGTDWNDVDVT---RQDVPGSLNGISPYSKGLVFTGKFNLSSGPSSAL 696
              S   I++V       +D +VT    Q + G ++GI+  ++GL+  G    S+  S+  
Sbjct: 656  GVS-NRISIVDLN----DDFEVTSSKNQTIQGDVHGITKTNQGLLIFGDILSSNNQSAVF 710

Query: 697  HYDGNFGSFFDLNSETSSIINMTIDGSELLLFNNKFIYNTSTSQML-TSSMFQXXXXXXX 755
             ++G+F + F+ +   +S +N+++  ++ ++ +N ++ N S++ ++  SS F        
Sbjct: 711  LFNGSFENVFNQSRTVNSALNISLANNDFIVLDNDYVVNASSNALIRNSSSFSLSLWAAG 770

Query: 756  XXXXXXXXFTGSIADIKHGSAHGAVALDAEGNIFTSGTP-SISGARV-HRGVYLNDTATA 813
                    F+G+++ +++G+ +G+V    E  I     P ++ G  V + G YLN++ATA
Sbjct: 771  NNGDGDVLFSGAVSHMQYGNLNGSVRFLNENEI----EPLNLEGGIVPYLGAYLNESATA 826

Query: 814  YAYYSVSPNSSVATGGVVIETPGNNFNLSNNIATVREMIYVKKTNFLVISTNEVEGTPGA 873
            YAY   S N    +  V    P  N++     + + +M+Y      L +S      T   
Sbjct: 827  YAYEVDSLNKIYFSNEVY---PSWNWS-----SGITQMLYADNQTLLAVSAG--SSTTAE 876

Query: 874  LILYDLRTLQEVAREKLNPGERINSIVLFGEDNTLLVGGSFE--KDGCHDLCLYNFVKRS 931
            L ++DLR L  +A E L    RIN++V F ++ ++LVGG F+  +  C  LCLYN+  ++
Sbjct: 877  LSIFDLRNLTMIANETLGSNARINALVNFEKNCSMLVGGDFQMTEPNCTGLCLYNYESKT 936

Query: 932  WSAFASGLISGEIKQLQFVNNRNLIAVGSMTVQSRPNILFLNFDLVRSRVVEQHEQPNGR 991
            WS F +  I GEI QL F N+  LI  G    +   +I   +F+L  S ++       G+
Sbjct: 937  WSTFLNNTIFGEITQLSFTNSSELIISGLFETKEYQSIRLGSFNLTNSTMIPLLSGSEGK 996

Query: 992  AFNSVLTIGDSGDEYVAEDGKQVWHYSGSEWKTVTPLSGGQIRIDGISLLMLN-NPRSQN 1050
              NS     DS    VA +   ++ Y   EW  +T L G    I  +S +  +    + N
Sbjct: 997  -LNSFTVTEDS---IVAWNDTSLFIYRNQEWN-ITSLPGNASSISSVSAIYTDIESNTLN 1051

Query: 1051 KR--NRVGN-ELVVIHGQMNSSEYGEINAMHYNFENWEPYYFTIGSSAREEFNVPRGQIF 1107
            KR  N V N  +++++G  N S+YG + ++ ++F+ W PY+ +  ++      +    IF
Sbjct: 1052 KRGINNVNNGSILLLNGNFNISQYGYLQSLLFDFQKWTPYFISETTNTSNYNPI----IF 1107

Query: 1108 LNQDISRQTTTSLPLEVV------------------VSDSPPTAEPKRKLAKGYXXXXXX 1149
            +N+D+S +  +  PL  V                   S    +   K+K+ +G+      
Sbjct: 1108 INRDVSTEFNSQSPLANVNITVTSPQSTSSQPPSSSASSESKSKSKKKKIGRGFVVLIGL 1167

Query: 1150 XXXXXXXXXXXXXXXXXXYAFGD-HNAYQPLKPRINEDEMLKTVPPEKLMKFI 1201
                              Y F D    Y+P+KPRI+E+EML TVPPEKLMKF+
Sbjct: 1168 ALALGTVSVLGIAGVILAYVFKDPEGDYKPIKPRIDENEMLDTVPPEKLMKFV 1220

>Suva_10.168 Chr10 complement(301631..305293) [3663 bp, 1220 aa] {ON}
            YLR084C (REAL)
          Length = 1220

 Score =  638 bits (1645), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 422/1259 (33%), Positives = 653/1259 (51%), Gaps = 97/1259 (7%)

Query: 1    MRLHMGLVAALAPLGDVVRGSHLESVAQHFDIKHWQTPRLDLSAARNERLLVFDDFQAFE 60
            M +H     AL  L    + S L+S+    DI+    P L++S   +  + +     A  
Sbjct: 1    MFVHRLWTLALPLLTLGSKASQLQSIKALLDIEDNVLPSLNISQDNDNAIQILGGVDALS 60

Query: 61   YYNYKGQQLFTGQEQHQGSS--LIYYSEGTYVQLAKLDDDTVVRRIVPFGSDSFILSGTG 118
            +Y Y GQQ FT +   + +S  L+YYS  TY+ L + D+DT + +I PFG+DSFILSG+G
Sbjct: 61   FYEYTGQQNFTKEIGSETNSRGLVYYSNNTYILLEEADEDTRIDKITPFGADSFILSGSG 120

Query: 119  KLQDQRLEHQLMYNLSTLEVTEILPQSLESVNDILVDGDMVYFGGQFTYSDGNKSGHSAV 178
             +    L +Q++YNLSTL +  I  QSL SV  +LV+   VYFGG F+Y++G+ +GH A+
Sbjct: 121  SINGVPLGNQVLYNLSTLSMARIFTQSLGSVEAVLVNDTSVYFGGNFSYNNGSMTGHGAL 180

Query: 179  QWNATSRTTSLLPFGGFGRGSSVNNILKLSGSGVLFVGRFSNLEAASYAETASVLASTEK 238
             W++TS TT LLPFGGFG  S+VN+I+KL+   +LF G+F  L+ +S   T+S   +   
Sbjct: 181  VWDSTSNTTQLLPFGGFGEDSNVNSIVKLNDDNILFAGKFYTLDDSSILTTSSTNTTNAS 240

Query: 239  PQLNVTTIETNALTSLRYSTITSDGH--LDKGKFICPTSNDDSWFVPHSGDGPARGELNI 296
              LN TT+E      LRY++  S G    +    +CP ++ D+W  P +      G L  
Sbjct: 241  STLNATTLELGQRIPLRYASWDSQGSTTFESSYLVCPDTSKDAWLYPGT-----SGSLVC 295

Query: 297  KVLHRIIPSKIRIYNSKKNGNEIKLFRIVTSPSQSIMNMTYIDPNTGELATCDAWCPLMP 356
             + + + P+KIR+YNS  + N+I LF+I+T+PS SIMN+TY+DP +GEL +CD +CPL  
Sbjct: 296  TLPYEVAPTKIRLYNSPNSDNDISLFQILTNPSGSIMNLTYLDPISGELQSCDEFCPLYS 355

Query: 357  RSNLTSKAAE-SGPADVARLVNDEKVLIKWTPDYQEFAFINQIHMEEIKFIALDSYGNNV 415
            R  L S +   S   D+   +++    +KW+ D+Q+FAF N++ +  +KF AL+SYGN V
Sbjct: 356  RDTLLSASQNVSSSLDMISFIDNNNTDVKWSSDFQDFAFANELSVTSLKFTALNSYGNKV 415

Query: 416  GLVGVELFQTEYDAYVNSTLNQPNCGEQQLSPFST--TANIWHQGATDASYLSANVV--- 470
            GL G+EL+Q  +  Y N++LN+  C        S+  + N W+ G T  SY++ + V   
Sbjct: 416  GLSGLELYQDTFSTYANNSLNEYGCSALANDSSSSILSDNKWYDGLTGQSYIAIDYVPNQ 475

Query: 471  -ESNPMVNVKPVIPHSGTYTLNLYTPGCEDDGTCDYRGIVNVTLLASNGTTLM-TRWIYQ 528
             +  P V   P I H G YT+N YTPGC  D TC  RGIVNVT+      T+M T  IYQ
Sbjct: 476  TKPTPTVTFYPSIIHPGHYTINTYTPGCVQDNTCSSRGIVNVTMWNPQNNTMMETYLIYQ 535

Query: 529  NNYRLKYDPLYTGHLDPNPTVRMEWVSPINSAVNRKIMVADRVSAII----DSLDGLDDI 584
            NN  LKYD +Y+G+LD +P + M++VS I ++    IMVAD+V+ I           +  
Sbjct: 536  NNNNLKYDKIYSGYLDFSPEIVMKYVSGIYASNTATIMVADQVNIITDSLDSFSSLSETT 595

Query: 585  RHPREKSLNGLFQY--------TPAGSSLDNGIQKYINKDPQTDMPEGVSLVGQVYDGKL 636
               R   LNG+ QY        T  G+ + N      + D   + P+  S+   VYD KL
Sbjct: 596  SVKRHTPLNGILQYQRSNFTATTSNGTKIANTTLNLFSVD---NYPKNSSMFADVYDKKL 652

Query: 637  ILGVKSTGHIAVVTPKGTDWND-VDVTRQD---VPGSLNGISPYSKGLVFTGKFNLSSGP 692
            ILG K   HI+V+     D+ND ++VT  +   + G + G++  ++GL+  G    S   
Sbjct: 653  ILGGKD-NHISVI-----DFNDNLEVTSSENKTIQGDVYGMTQTNQGLLIFGDVRSSDNK 706

Query: 693  SSALHYDGNFGSFFDLNSETSSIINMTIDGSELLLFNNKFIYNTST-SQMLTSSMFQXXX 751
            S+ L ++G+F S  + +    + IN+T+  ++L++FNN +I+N S+ SQ+  S+ F    
Sbjct: 707  STVLMFNGSFESVSNYSKAVENAINITLANNDLIVFNNDYIFNASSNSQISNSTSFSLSL 766

Query: 752  XXXXXXXXXXXXFTGSIADIKHGSAHGAVALDAEGNIFTSGTPSISGARVHRGVYLNDTA 811
                        F+G+++ ++     G+     E  +         G   + G YLN++ 
Sbjct: 767  WSAGNNDNDDVLFSGAVSQMQFSDLSGSARFLNESTV--EALNLNKGIVPYLGAYLNEST 824

Query: 812  TAYAYYSVSPNSSVATGGVVIETPGNNFNLSNNIATVREMIYVKKTNFLVISTNEVEGTP 871
             AYAY + S +    +  V   +P   +N SNNI    +M+Y      LVI +     T 
Sbjct: 825  IAYAYKTNSLSKIYFSNNV---SPS--WNWSNNIT---KMVYANNQTLLVIGSE--SSTT 874

Query: 872  GALILYDLRTLQEVAREKLNPGERINSIVLFGEDNTLLVGGSFE--KDGCHDLCLYNFVK 929
              L + +LR    +A E L    +IN+ V F ++++LLVGG F+  K  C  LC+YN+  
Sbjct: 875  AELSILNLRNFTTIANETLGSNAKINAFVNFEKNSSLLVGGDFQMSKPNCTGLCVYNYES 934

Query: 930  RSWSAFASGLISGEIKQLQFVNNRNLIAVGSMTVQSRPNILFLNFDLVRSRVVEQHEQPN 989
            +SWS F +  I GEI QL F N   LI  G    + + +I   +F+L  S +V       
Sbjct: 935  KSWSTFFNNTIVGEITQLAFNNESELIISGLFATEKQQSIRLGSFNLTNSTMVPLLTGSG 994

Query: 990  GRAFNSVLTIGDSGDEYVAEDGKQVWHYSGSEWKTVTPLSGGQIRIDGISLLMLN-NPRS 1048
            G+  NS     +S    VA +   +  Y   +W T T L G    +  ++ +  N +  +
Sbjct: 995  GK-LNSFTVTEES---IVAWNDTSLLIYKDQKWNT-TSLPGNGSSVSSVTTIDTNTDSYA 1049

Query: 1049 QNKRNRVGNE---LVVIHGQMNSSEYGEINAMHYNFENWEPYYFTIGSSAREEFNVPRGQ 1105
              KR     E   +++++G  +  +YG +  + ++ +NW PY+    +S   E +     
Sbjct: 1050 LRKRATTDAEKGSILLLNGNFSIPQYGNLQGLLFDSQNWTPYF----TSETLEASSYNPT 1105

Query: 1106 IFLNQDISRQTTTSLPLEVVVSDSPPTA----------------------EPKRKLAKGY 1143
            IF+N+D+S    + +PL    S+S  T                         K+ + +G+
Sbjct: 1106 IFINRDVSADFNSQIPL----SNSNMTVTSPQSTSPLSPSSSASSEPNKKSKKKNMDRGF 1161

Query: 1144 XXXXXXXXXXXXXXXXXXXXXXXXYAFGD-HNAYQPLKPRINEDEMLKTVPPEKLMKFI 1201
                                    Y F D    Y+P+KPRI+E+EML TVPPEKLMKF+
Sbjct: 1162 VVLIGLALALGTVSVLGIVGVILAYVFKDPEGDYRPIKPRIDENEMLDTVPPEKLMKFV 1220

>NDAI0B02380 Chr2 complement(595444..599103) [3660 bp, 1219 aa] {ON}
            Anc_8.256 YLR084C
          Length = 1219

 Score =  628 bits (1620), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 417/1236 (33%), Positives = 647/1236 (52%), Gaps = 82/1236 (6%)

Query: 17   VVRGSHLESVAQHFDIKHWQTPRLDLSAARNERLLVFDDFQAFEYYNYKGQQLFTGQ--E 74
            +++ S L ++    ++ +   P L+L+A+ ++   +  D     +Y YKGQQ FT     
Sbjct: 15   ILQASQLSNIKNILNVTNVNIPTLNLTASNDDTFQLLGDIDGLSFYRYKGQQNFTTGIIP 74

Query: 75   QHQGSSLIYYSEGTYVQLAKLDDDTVVRRIVPFGSDSFILSGTGKLQDQRLEHQLMYNLS 134
                + LIYYS  T +QL +  +DT + +I PFGSDSFILSGTG L    L +QL+YNL+
Sbjct: 75   GSNSNGLIYYSNNTLIQLEEPSNDTYIAKITPFGSDSFILSGTGSLSGYSLTNQLLYNLT 134

Query: 135  TLEVTEILPQSLESVNDILVDGDMVYFGGQFTYSDGNKSGHSAVQWNATSRTTSLLPFGG 194
            TL +  I   S+E V  IL+D  +VYFGG FT  +G  + HS + W++TS +T  L FGG
Sbjct: 135  TLSIEPIFNTSIEEVKTILIDDSLVYFGGNFTVLNGTSNIHSLIMWDSTSSSTEFLNFGG 194

Query: 195  FGRGSSVNNILKLSGSGVLFVGRFSNLEAASYAETASVLASTEKPQLNVTTIETNALTSL 254
            FG  S +N+I+KL+   +LF G F  L+   +    +   S++    N TT++   L  L
Sbjct: 195  FGENSIINSIVKLNDDNILFAGEFYTLDEPDFLIQNT--TSSQNNIFNSTTVDIGQLVPL 252

Query: 255  RYSTI-TSDGHLDKGKFICPTSNDDSWFVPHSGDGPARGELNIKVLHRIIPSKIRIYNSK 313
              ST  T +   D   F+CP + ++SW    SG     G L  K+   + P+KIRIYNS 
Sbjct: 253  SASTWDTGESTFDSDTFVCPDTTEESWI--QSG---TTGSLTCKLPFEVAPTKIRIYNSP 307

Query: 314  KNGNEIKLFRIVTSPSQSIMNMTYIDPNTGELATCDAWCPLMPRSNLTSKAAE-SGPADV 372
               N++ LFRI+T+ +Q IMN+TYIDP + EL  CDA+CPL  ++ L+   A  + P+D 
Sbjct: 308  NEDNQVSLFRILTNEAQGIMNLTYIDPISHELKHCDAFCPLYSKAILSQAYANTTSPSDT 367

Query: 373  ARLVNDEKVLIKWTPDYQEFAFINQIHMEEIKFIALDSYGNNVGLVGVELFQTEYDAYVN 432
              L+ D    IKWT ++QEFAFINQI +  ++F+ALDSYGNNV L   +L+Q  Y  + N
Sbjct: 368  IHLLADNTTDIKWTQEFQEFAFINQISVSSVQFVALDSYGNNVALSSFQLYQNAYAVFAN 427

Query: 433  STLNQPNCG-EQQLSPFSTTANIWHQGATDASYLSANVVESN---PMVNVKPVIPHSGTY 488
             TLN+PNC   +  S  S +AN W  G T  +Y+S     +    P V+  P I + G Y
Sbjct: 428  DTLNEPNCNSIESSSSSSLSANDWEMGLTGQTYISTTYTPNQDPVPYVSFSPQIKYPGQY 487

Query: 489  TLNLYTPGCEDDGTCDYRGIVNVTLLASNGTTLM-TRWIYQNNYRLKYDPLYTGHLDPNP 547
            ++N+YTPGC  D TC  R IVNVT+  S+GT+++ T  IYQNN  LKYD LY+G+L  +P
Sbjct: 488  SINIYTPGCTQDDTCSSRAIVNVTVWDSDGTSILATELIYQNNKELKYDELYSGYLSSSP 547

Query: 548  TVRMEWVSPINSAVNRKIMVADRVSAIIDSLD--GL--DDIRHPREKSLNGLFQY----- 598
             V +E+VS + ++     +VADR++ +IDSL+  GL  +   +    +LNGL QY     
Sbjct: 548  RVTIEYVSGLYASNTVATVVADRLNVLIDSLEVPGLTSNGTNNTEIMNLNGLLQYQISNF 607

Query: 599  -TPAGSSLDNGIQKY-INKDPQTDMPEGVSLVGQVYDGKLILGVKSTGHIAVVTPKGTDW 656
             T +  + D  I    +N+       +  S+   +YD   +L   S G I VV  K  + 
Sbjct: 608  STSSSETTDVKITNTSLNQLSLEQFSKNTSMYADLYDDNTLLLGNSNGGIKVV--KLNEN 665

Query: 657  NDVDVTRQ-DVPGSLNGISPYSKGLVFTGKFNLSSGPSSALHYDGNFGSF--FDLNSETS 713
             D++ + +  + G+  G S YS G++  G++NLSS  +  ++Y+G F     F+ NS  +
Sbjct: 666  MDIESSNEASLTGNTAGFSSYSGGILAYGEYNLSSKITYLVNYNGTFNEIPNFNKNSSIT 725

Query: 714  SIINMTIDGSELLLFNNKFIYNTSTSQMLTSSM-FQXXXXXXXXXXXXXXXFTGSIADIK 772
            +++N+TI  +ELL+ +N+ IYN S+S  +T+S   Q               F+G+IA + 
Sbjct: 726  NVVNLTIHDTELLVIDNQAIYNVSSSSTITNSSALQLSLWSSGSNLNRDTVFSGAIALLD 785

Query: 773  HGSAHGAVALDAEGNIF--TSGTPSISGAR-VHRGVYLNDTATAYAYYSVSPNSSVATGG 829
            +   +G++A+   GN F  T+ T ++S    ++ G++LND+ + YA  + S +  + + G
Sbjct: 786  YTDLNGSIAI---GNNFTVTNITNNVSSTNSLYTGLFLNDSLSIYASKTDSYSELLFSNG 842

Query: 830  VVIETPGNNFNLSNNIATVREMIYVKKTNFLVISTNEVEGTPGALILYDLRTLQEVAREK 889
                 P + F        +  M+Y      L +++++        IL +L T + +A E 
Sbjct: 843  Y--SAPWSFF------EGINYMVYSSHQTMLAVASSDFNKNSELSIL-NLTTFETIANET 893

Query: 890  LNPGERINSIVLFGEDNTLLVGGSFE--KDGCHDLCLYNFVKRSWSAFASGLISGEIKQL 947
            LN   +IN ++ F  ++TL+VGG+F   +  C  LCLYN+    W  FA+  I+G I Q+
Sbjct: 894  LNVNSKINGLINFEHNSTLIVGGNFTILQSNCSGLCLYNYDSNEWLTFANHSINGTIAQM 953

Query: 948  QFVNNRNLIAVGSMTVQSRPNILFLNFDLVRSRVVEQHEQPNGRAFNSVLTIGDSGDEYV 1007
            + +N   L+  G    Q+  ++     DL  +  V   +  +     S  TI   GD+ +
Sbjct: 954  ELINGTQLLLSGLFNAQNISSVNLAIMDL-STYAVSSIKMGDANILQSFATI---GDKII 1009

Query: 1008 AEDGKQVWHYSGSEWKTVTPLSGGQIRIDGISLLMLNNPRSQNKRNRVGNELVVIHGQMN 1067
              +G  +  Y    W T+         I  I  +    P  Q +      +  +I+G + 
Sbjct: 1010 TWNGIMLESYENGAWSTIQSNFNSSTTIRSIEPIGF-GPTLQKRDGTGSADGFIINGNIY 1068

Query: 1068 SSEYGEINAMHYNFENWEPYYFTIGSSAREEFNVPRGQIFLNQDISRQTTTSLPLE---- 1123
             +EYG I AM YNF+ W PYY  I SS   +     GQIF+N+D S    +   L+    
Sbjct: 1069 DTEYGTIQAMIYNFKEWRPYY--IISSTNSQI---AGQIFMNRDDSALYNSQSVLQNPNN 1123

Query: 1124 ----------VVVSDSPPTAEP-------KRKLAKGYXXXXXXXXXXXXXXXXXXXXXXX 1166
                           +  +++P       ++K+ +G+                       
Sbjct: 1124 ATVTTPSSTSSGTPSATHSSQPHHQKQVGRKKIDRGFVVLIGLALALGTVSLLGIIGLVL 1183

Query: 1167 XYAFGDHN-AYQPLKPRINEDEMLKTVPPEKLMKFI 1201
             Y F D + ++  L PR NEDEML+TVPPEKLMKF+
Sbjct: 1184 AYIFKDGDGSHDALNPRTNEDEMLETVPPEKLMKFL 1219

>Skud_12.152 Chr12 complement(279947..283609) [3663 bp, 1220 aa] {ON}
            YLR084C (REAL)
          Length = 1220

 Score =  624 bits (1610), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 401/1254 (31%), Positives = 662/1254 (52%), Gaps = 87/1254 (6%)

Query: 1    MRLHMGLVAALAPLGDVVRGSHLESVAQHFDIKHWQTPRLDLSAARNERLLVFDDFQAFE 60
            M +H         L    + S L+++    DI+    P L++S   +  + +     A  
Sbjct: 1    MFVHRLWTLIFPFLAQASKASQLQNIKSLLDIEDNVLPNLNISQDNSNAVQILGGVDALS 60

Query: 61   YYNYKGQQLFTGQEQHQGSS---LIYYSEGTYVQLAKLDDDTVVRRIVPFGSDSFILSGT 117
             Y Y GQQ FT +E   G++   L+YYS  TY+Q+    DDT + +I PFG+DSFILSG+
Sbjct: 61   LYEYTGQQNFT-KEISPGTNSRGLVYYSNNTYIQVEDASDDTRIDKITPFGADSFILSGS 119

Query: 118  GKLQDQRLEHQLMYNLSTLEVTEILPQSLESVNDILVDGDMVYFGGQFTYSDGNKSGHSA 177
            G + +  + +Q++YNLSTL +  I  Q L SV  +L++G  VYFGG F+Y++G+ +GHSA
Sbjct: 120  GTINNMPIGNQILYNLSTLSMAPIFDQPLGSVESVLINGTSVYFGGNFSYNNGSMTGHSA 179

Query: 178  VQWNATSRTTSLLPFGGFGRGSSVNNILKLSGSGVLFVGRFSNLEAASYAETASVLASTE 237
            + W++ S  T LLPFGGFG  S+VN+I+KL+   +LF G+F  L+ +S   TA    +T 
Sbjct: 180  LIWDSISNKTQLLPFGGFGENSNVNSIIKLNDDNILFAGKFYTLDDSSALITAGSNNTTN 239

Query: 238  KPQ-LNVTTIETNALTSLRYSTITSDGH--LDKGKFICPTSNDDSWFVPHSGDGPARGEL 294
                LN T +E      LRY+T    G    +    +CP +N+D+W  P +      G L
Sbjct: 240  STSLLNATKLELGQRIPLRYATWDFQGSTTFESNSLVCPNANEDAWVYPAT-----SGTL 294

Query: 295  NIKVLHRIIPSKIRIYNSKKNGNEIKLFRIVTSPSQSIMNMTYIDPNTGELATCDAWCPL 354
              K+ + + P+K+R+YNS+ +  EI +F+I+T+PS SIMN+TY+DP +G+L  CD +CPL
Sbjct: 295  VCKLPYEVSPTKVRLYNSQDSDGEISVFQILTNPSNSIMNLTYLDPLSGKLKNCDEFCPL 354

Query: 355  MPRSNLTSKAAE-SGPADVARLVNDEKVLIKWTPDYQEFAFINQIHMEEIKFIALDSYGN 413
              R+ L S +   S P D+   +++    +KW+ D+Q+FAF N++ +  +KF A++SYG 
Sbjct: 355  YSRATLLSASQNVSSPMDMISFLDNNNTDVKWSSDFQDFAFANELPVTLLKFTAINSYGK 414

Query: 414  NVGLVGVELFQTEYDAYVNSTLNQPNCG--EQQLSPFSTTANIWHQGATDASYLSANVV- 470
            +VGL G+EL+Q  +  Y N++LN+  C       S  + ++N W+ G    SY++   V 
Sbjct: 415  SVGLSGLELYQDTFSTYANNSLNEYGCSALANDSSSSTLSSNSWYNGLGGESYIATEYVP 474

Query: 471  ---ESNPMVNVKPVIPHSGTYTLNLYTPGCEDDGTCDYRGIVNVTLLASNGTTLMTRW-I 526
               E  P VN  P I H G Y +N YTPGC  D TC  RGIVNVT+      T+M  + I
Sbjct: 475  NQDEPTPRVNFYPNIVHPGHYIINTYTPGCVQDHTCSSRGIVNVTMWNPQNKTMMKTYTI 534

Query: 527  YQNNYRLKYDPLYTGHLDPNPTVRMEWVSPINSAVNRKIMVADRVSAI---IDSLDGLDD 583
            YQNN  LKYD +Y+G+LD +P + +E+VS I+++    ++VAD+V+ I   +D+   L +
Sbjct: 535  YQNNDNLKYDQIYSGYLDFSPEIILEYVSGIHTSNTATVVVADQVNVITVLLDAFSTLSE 594

Query: 584  IRHPREK-SLNGLFQYTPAG--SSLDNGIQ---KYINKDPQTDMPEGVSLVGQVYDGKLI 637
              + +E   LNG+ QY  +   S+  N  +     +N     + P   SL       +LI
Sbjct: 595  SANTKEYIPLNGVLQYQKSNFTSTTSNETKIGNTTLNVFAVDNYPNNSSLFADTNGDRLI 654

Query: 638  LGVKSTGHIAVVTPKGTDWND----VDVTRQDVPGSLNGISPYSKGLVFTGKFNLSSGPS 693
            LG  +  HI+++       ND    V   +Q + G ++G++  S+GL+  G    S+  S
Sbjct: 655  LG-GTNNHISII-----GLNDNLEVVLSEKQIIQGDVHGMTQTSQGLLIFGDLLSSNNQS 708

Query: 694  SALHYDGNFGSFFDLNSETSSIINMTIDGSELLLFNNKFIYNTSTS-QMLTSSMFQXXXX 752
            S L ++G+F + F+ +   +S IN+++  ++L++F+N +I NTS+S Q+L S+ F     
Sbjct: 709  SVLLFNGSFENVFNYSRTVNSAINISLANNDLIVFDNDYIVNTSSSAQILNSTSFSLSLW 768

Query: 753  XXXXXXXXXXXFTGSIADIKHGSAHGAVALDAEGNIFTSGTPSISGARV-HRGVYLNDTA 811
                       F+G+++ ++ G  +G+    +E  +      ++  A V +   YLN++ 
Sbjct: 769  SAGSNGNDDVLFSGAVSRMQFGGLNGSARFLSEDKV---QALNLDNAVVPYLAAYLNEST 825

Query: 812  TAYAYYSVSPNSSVATGGVVIETPGNNFNLSNNIATVREMIYVKKTNFLVISTNEVEGTP 871
            TAYAY +   N    +  V    P  N++ S     +  M+Y    + L + +     T 
Sbjct: 826  TAYAYETNLLNKIYFSNNV---DPSWNWSTS-----ITRMLYANNQSLLTVGSE--SSTT 875

Query: 872  GALILYDLRTLQEVAREKLNPGERINSIVLFGEDNTLLVGGSFE--KDGCHDLCLYNFVK 929
              L +++L+    +A E +    +IN++V F ++++LLVGG+F+  K  C  LCLYN+  
Sbjct: 876  AELSIFNLKNFTMIANETMGSNAKINALVNFEKNSSLLVGGNFQMSKPNCSGLCLYNYES 935

Query: 930  RSWSAFASGLISGEIKQLQFVNNRNLIAVGSMTVQSRPNILFLNFDLVRSRVVEQHEQPN 989
            +SWS F +    GEI QL F     L+  G    +   ++   +F+L  S ++       
Sbjct: 936  KSWSTFFNNTFFGEITQLSFSAASQLVISGLFDTEEYQSVRLASFNLTNSTMIPLLTGAE 995

Query: 990  GRAFNSVLTIGDSGDEYVAEDGKQVWHYSGSEWKTVTPLSGGQIRIDGISLLMLN-NPRS 1048
            G+  + V+T     +  VA +   +  Y   EW  +T + G    I  +S +  N  P +
Sbjct: 996  GKINSFVVT----EESIVAWNDTSLLIYRDQEWN-ITSVPGNDSSIGSVSTINTNAGPGT 1050

Query: 1049 QNKR---NRVGNELVVIHGQMNSSEYGEINAMHYNFENWEPYYFTIGSSAREEFNVPRGQ 1105
             N+R   N     ++++ G  +  +YG +  + ++FE W PY+ +  S+           
Sbjct: 1051 LNRRATNNAENGTILLLSGNFSIPDYGNLQGLLFDFETWSPYFVSESSNTSNR----NPT 1106

Query: 1106 IFLNQDISRQTTTSLPLE-VVVSDSPPTA----------------EPKRKLAKGYXXXXX 1148
            IF+N+D+S +  + +PL  + V+++ P +                + K+++ +G+     
Sbjct: 1107 IFINRDVSTEFNSQIPLSNLNVTETGPQSASSQFPSSSASSELKPKSKKRIDRGFVVLIG 1166

Query: 1149 XXXXXXXXXXXXXXXXXXXYAFGD-HNAYQPLKPRINEDEMLKTVPPEKLMKFI 1201
                               Y F D    Y+P+KPRI+E+EML TVPPEKLMKF+
Sbjct: 1167 LALALGTVSVLGIAGVILAYVFKDPEGDYKPIKPRIDENEMLDTVPPEKLMKFV 1220

>Smik_12.143 Chr12 complement(276428..280090) [3663 bp, 1220 aa] {ON}
            YLR084C (REAL)
          Length = 1220

 Score =  620 bits (1599), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 403/1251 (32%), Positives = 652/1251 (52%), Gaps = 81/1251 (6%)

Query: 1    MRLHMGLVAALAPLGDVVRGSHLESVAQHFDIKHWQTPRLDLSAARNERLLVFDDFQAFE 60
            M +H     A   L    + S L+++    DI+    P L++S   +  + +     A  
Sbjct: 1    MFVHRLWTLAFLFLAQASKASQLQNIKSLLDIEDNVLPNLNISQNNSNAVQILGGVDAIS 60

Query: 61   YYNYKGQQLFT-----GQEQHQGSSLIYYSEGTYVQLAKLDDDTVVRRIVPFGSDSFILS 115
            +Y Y GQQ FT     G   H    L+YYS  TY+QL    DDT + +I PFG DSFILS
Sbjct: 61   FYKYTGQQNFTKGISPGTNSH---GLVYYSNNTYIQLEDASDDTRIDKITPFGDDSFILS 117

Query: 116  GTGKLQDQRLEHQLMYNLSTLEVTEILPQSLESVNDILVDGDMVYFGGQFTYSDGNKSGH 175
            G+G + +  + +Q++YNLSTL +  I  QSL  V  +LV+   VYFGG F+Y++G+  GH
Sbjct: 118  GSGTINNISVGNQILYNLSTLSMAPIFNQSLGDVETVLVNDTSVYFGGNFSYNNGSMIGH 177

Query: 176  SAVQWNATSRTTSLLPFGGFGRGSSVNNILKLSGSGVLFVGRFSNLEAASYAETASVLAS 235
            SA+ W+A S T  LLPFGGFG  S+VN+ILKL+   ++F G+F  L+ +S   T+S   +
Sbjct: 178  SALVWDAMSDTAQLLPFGGFGENSNVNSILKLNDDNIVFAGKFYTLDDSSVLITSSNNGT 237

Query: 236  TEKPQLNVTTIETNALTSLRYSTITSDGH--LDKGKFICPTSNDDSWFVPHSGDGPARGE 293
                 LN T +E     SLRY++  S G   L     +CP  N ++W  P +      G 
Sbjct: 238  NSTFSLNATKLELGQRISLRYASWDSQGSTTLASNSLVCPNDNGNAWLYPAT-----SGS 292

Query: 294  LNIKVLHRIIPSKIRIYNSKKNGNEIKLFRIVTSPSQSIMNMTYIDPNTGELATCDAWCP 353
            L   + + + P+KIR+YNS+  G+EI LF+I+T+PS SIMN+TY+DP +GEL  CD +CP
Sbjct: 293  LVCNLPYEVSPTKIRLYNSQDAGSEIALFQILTNPSSSIMNLTYLDPLSGELKNCDEFCP 352

Query: 354  LMPRSNLTSKAAE-SGPADVARLVNDEKVLIKWTPDYQEFAFINQIHMEEIKFIALDSYG 412
            L  R+ L + +   S   D+   ++     +KW+ D+Q+FAF N++ +  +K IAL+SYG
Sbjct: 353  LYSRATLLAASQNASSSMDMITFIDGNNTDVKWSSDFQDFAFANELPVTSLKLIALNSYG 412

Query: 413  NNVGLVGVELFQTEYDAYVNSTLNQPNCGE--QQLSPFSTTANIWHQGATDASYLSANVV 470
            +++GL G+EL+Q  +  Y N++LN+  C       S    + N W+ G T  SY++ N +
Sbjct: 413  DSIGLSGLELYQNTFSTYANNSLNEYGCSALVNDSSSSILSNNSWYNGLTGESYIATNYI 472

Query: 471  ----ESNPMVNVKPVIPHSGTYTLNLYTPGCEDDGTCDYRGIVNVTLLASNGTTLMTRW- 525
                E  P V   P I HSG YT+N YTPGC  D TC  RGIVNVT+      T+M  + 
Sbjct: 473  PDQNEPIPRVKFYPNIIHSGHYTINTYTPGCVQDNTCSSRGIVNVTVWNPQNNTMMKTYT 532

Query: 526  IYQNNYRLKYDPLYTGHLDPNPTVRMEWVSPINSAVNRKIMVADRVSAI---IDSLDGLD 582
            IYQNN  LKYD +++G+LD +P + +E++S I S+    ++VADRV+ I   +D+ + L 
Sbjct: 533  IYQNNDNLKYDQIFSGYLDFSPEIVLEYISGIYSSNTATVVVADRVNVITVSLDTFNALS 592

Query: 583  DIRH-PREKSLNGLFQY-----TPAGSSLDNGIQKYINKDPQTDMPEGVSLVGQVYDGKL 636
            +I +  R+  LNG+FQY     T   S+        +N  P  + P+  SL+ ++Y+ KL
Sbjct: 593  EINNVKRQTPLNGIFQYQKSNFTGTTSNKTKVGNTTLNLFPVNNYPKNASLLVEIYNDKL 652

Query: 637  ILGVKSTGHIAVVTPKGTDWNDVDVTRQDVPGSLNGISPYSKGLVFTGKFNLSSGPSSAL 696
            I+G  S   I+ +     ++       + + G + GI+   +GL+  G    S   S+ L
Sbjct: 653  IVGGVS-NRISTI-DLNENFEIKSSENRTIQGDVYGITKTGQGLLIYGDLRSSDNQSTVL 710

Query: 697  HYDGNFGSFFDLNSETSSIINMTIDGSELLLFNNKFIYNTST-SQMLTSSMFQXXXXXXX 755
             ++ +FG   + +   +S  N++I  +EL +F+N +I N S+ +Q+  S+ F        
Sbjct: 711  LFNESFGKVPNYSKRVNSATNISIADNELFVFDNNYIINASSNAQISNSTSFSLSLWAAG 770

Query: 756  XXXXXXXXFTGSIADIKHGSAHGAVALDAEGNIFTSGTPSISGARVHRGVYLNDTATAYA 815
                    F+G+++ ++  + +G+ +   E  +         G   + G YLN++ +AYA
Sbjct: 771  NNGNGDVLFSGTVSHMEFSNLNGSASFKNEDQVQALNIG--RGIVPYFGAYLNESVSAYA 828

Query: 816  YYSVSPNSSVATGGVVIETPGNNFNLSNNIATVREMIYVKKTNFLVISTNEVEGTPGALI 875
            Y + + N    +  V    P   +N SN   T+  M+Y      LV+S+     +   L 
Sbjct: 829  YETDALNKIYFSNKV---NPS--WNWSN---TITRMLYANNQTMLVVSSE--SSSTADLT 878

Query: 876  LYDLRTLQEVAREKLNPGERINSIVLFGEDNTLLVGGSFE--KDGCHDLCLYNFVKRSWS 933
            +++LR +  +A E L    +++++V F +++++LVGG F+  K  C  LCLYN+  +SWS
Sbjct: 879  IFNLRNMTTIANETLGSNAKVSALVNFEKNSSILVGGDFQITKPNCSGLCLYNYETKSWS 938

Query: 934  AFASGLISGEIKQLQFVNNRNLIAVGSMTVQSRPNILFLNFDLVRSRVVEQHEQPNGRAF 993
             F +  I GE+ QL   N+  LI  G    +   +I   +F+L    +V       G+  
Sbjct: 939  TFFNNTIFGEVTQLSLANSSELIISGLFNTREHQSIRLGSFNLNNFTMVPLLSGSEGKLN 998

Query: 994  NSVLTIGDSGDEYVAEDGKQVWHYSGSEWKTVTPLSGGQIRIDGISLLMLNNPR-SQNKR 1052
            + V+T     +  VA +   ++ Y   +W  +T L      I  +S +  N    + NKR
Sbjct: 999  SFVVT----DNSLVAWNDTSLFIYGNQKWN-ITSLPSDDSLIGSVSTISTNTKSDTLNKR 1053

Query: 1053 ---NRVGNELVVIHGQMNSSEYGEINAMHYNFENWEPYYFTIGSSAREEFNVPRGQIFLN 1109
               N     +++++G     +YG + ++ ++F+ W PY+ +  S++           F+N
Sbjct: 1054 ATNNAHDGSILLLNGNFTMPQYGNLQSLLFDFQAWTPYFISEISNSSNY----NPTFFIN 1109

Query: 1110 QDISRQ--TTTSLP-LEVVVSD---------------SPPTAEPKRKLAKGYXXXXXXXX 1151
            +D+S +  +  +LP L + V++                  +   K+K+ +G+        
Sbjct: 1110 RDVSTEFNSQITLPNLNITVTNPQSTSSQSPSTSATSESKSKSEKKKIDRGFVVLIGLAL 1169

Query: 1152 XXXXXXXXXXXXXXXXYAFGD-HNAYQPLKPRINEDEMLKTVPPEKLMKFI 1201
                            Y F D    Y+P+KPRI+E+EML TVPPEKLMKF+
Sbjct: 1170 ALGTVSVLGIVGVILAYVFKDPEGDYKPIKPRIDENEMLDTVPPEKLMKFV 1220

>KLLA0F18975g Chr6 complement(1739543..1743145) [3603 bp, 1200 aa]
            {ON} similar to uniprot|Q12465 Saccharomyces cerevisiae
            YLR084C RAX2 N-glycosylated protein involved in the
            maintenance of bud site selection during bipolar budding
            localization requires Rax1p
          Length = 1200

 Score =  608 bits (1567), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 394/1232 (31%), Positives = 627/1232 (50%), Gaps = 75/1232 (6%)

Query: 7    LVAALAPLGDVVRGSHLESVAQHFDIKHWQTPRLDLSAARNERLLVFDDFQAFEYYNYKG 66
            L+  L  L  +VRGS L ++ +  +I  ++ P  D     +  L   ++F+     +Y G
Sbjct: 7    LIYVLLVLAGMVRGSQLSNIEKLLNISRYEAPNWD-----SPDLTYMNNFEELTVISYTG 61

Query: 67   QQLFTGQEQHQGSSLIYYSEGTYVQLAKLDDDTVVRRIVPFGSDSFILSGTGKLQDQRLE 126
            QQ FT Q     SSL+YYS  T+V+L +   +T V  IVP   DSFILSGTG++    LE
Sbjct: 62   QQNFTVQANE--SSLLYYSNDTFVKLFETSPETTVTMIVPLFEDSFILSGTGQINGVALE 119

Query: 127  HQLMYNLSTLEVTEILPQSLESVNDILVDGDMVYFGGQFTYSDGNKSGHSAVQWNATSRT 186
             Q++ NL++L  + I P ++E+V DIL   + V F G F+ S  N++GH AV W+  + T
Sbjct: 120  QQILLNLTSLTTSPIFPSAVENVMDILTVNETVIFVGNFSMSVSNETGHGAVLWDVVANT 179

Query: 187  TSLLPFGGFGRGSSVNNILKLSGSGVLFVGRFSNLEAASYAETASVLASTEKPQLNVTTI 246
            T L PF GFG  S VN+++KL+   +LF G F  ++ AS  +      +T     ++T++
Sbjct: 180  TELFPFKGFGENSIVNSVVKLNSDNILFAGSFQEIQNASLLQEFG--NATNSSHEDLTSL 237

Query: 247  ETNALTSLRYSTITSDGHLDKGKFICPTSNDDSWFVPHSGDGPARGELNIKVLHRIIPSK 306
            + +    L+ S+IT + ++     +CP+   + W    S     +  L   + + I PSK
Sbjct: 238  QFDQSVPLKLSSITGE-NVQSDILLCPSGGQNGW----SASEAVQSTLQFDLKNEIHPSK 292

Query: 307  IRIYNSKKNGNEIKLFRIVTSPSQSIMNMTYIDPNTGELATCDAWCPLMPRSNLTSKAAE 366
            +RIYNS +  +EI LFRI+T PS  IMN+TY+DP +GEL  CDAWCPL+   +LT  +  
Sbjct: 293  VRIYNSVEENSEISLFRIITGPSNGIMNLTYLDPASGELKQCDAWCPLLSIEDLTQISQN 352

Query: 367  SGPADVARLVNDEKVLIKWTPDYQEFAFINQIHMEEIKFIALDSYGNNVGLVGVELFQTE 426
            S  A  +  +N+    +KW+  YQEFAF+N I +  ++F+AL SYG+N  L  +E+F+TE
Sbjct: 353  STAAPKSVGINNNSTNLKWSESYQEFAFVNDIPVTMLQFVALASYGSNAALHSIEIFETE 412

Query: 427  YDAYVNSTLNQPNCGE-QQLSPFSTTANIWHQGATDASYLSANVVESNPMVNVKPVIPHS 485
            +  Y N++ N+PNC    + S    +++ W+      +Y+S N+ ++ P V   P I + 
Sbjct: 413  FMVYANNSYNEPNCESVTEYSKAELSSDNWYTTDESDTYISTNIDDNIPYVTFHPNITYP 472

Query: 486  GTYTLNLYTPGCEDDGTCDYRGIVNVTLL-ASNGTTLMTRWIYQNNYRLKYDPLYTGHLD 544
            G YT N+YTPGC  D +C  RGIVNVT++  S    L +  IYQ N   K+DPLYTG L 
Sbjct: 473  GRYTFNIYTPGCLQDNSCSKRGIVNVTMIDRSINEVLASVLIYQTNNEDKFDPLYTGSLG 532

Query: 545  PNPTVRMEWVSPINSAVNRKIMVADRVSAIIDSLDGLDDIRHPREKSLNGLFQYTPAGSS 604
              P + + W   I  +    +MV DR+  I + +D +    +     LNGLFQY  A  +
Sbjct: 533  SAPEIIVTWDKAIGES--DSVMVVDRLGVITEYIDTISISSNDTTFHLNGLFQYNTANVT 590

Query: 605  LD-NGIQKYINKDPQTDMPEGVSLVGQVYDGKLILGVKSTGHIAVVTPKGTDWNDVDVT- 662
                      N     + P   +L     +  +++G    G IA V     + ND  +  
Sbjct: 591  ASIFSTNDTFNDYALYNFPLDANLYAASLNNDILIGGNFNG-IAKV-----ELNDEALIS 644

Query: 663  ---RQDVPGSLNGISPYSKGLVFTGKFNLSSGPS-SALHYDGN-FGSFFDLNSETSSIIN 717
               +    G   GI  YS GL+ +G + + +      L YDGN F SF  L+     I+N
Sbjct: 645  SSQKLGTSGYTTGIFEYSNGLLLSGTYQVENDSRHEILSYDGNAFNSFGQLDEPIDRIVN 704

Query: 718  MTIDGSELLLFNNKFIYNTSTSQMLT-SSMFQXXXXXXXXXXXXXXXFTGSIADIKHGSA 776
             TIDG ELLLF+N +I+N S +  ++ SS F+                 GS      G  
Sbjct: 705  FTIDGHELLLFDNAYIFNVSANMYVSNSSTFEITGQSAGINSGNDSLLFGSFLKRSVGEL 764

Query: 777  HGAVALDAEGNIFTSGTPSI-SGARVHRGVYLNDTATAYAYYSVSPNSSVATGGVVIETP 835
            +G  +L ++G + +   P + +  + ++  Y+NDT+ AYA    S      T  V     
Sbjct: 765  NGLASLSSDGQVSSPTLPELPTDVQPYKAAYINDTSAAYALQEGS------TDNVQHRVL 818

Query: 836  GNNFNLSNNI------ATVREMIYVKKTNFLVISTNEVEGTPGALILYDLRTL---QEVA 886
              N N S+++      A +   +Y    N L I TN    +    + + +  L   + VA
Sbjct: 819  ITNTNSSSHMLQIQWSAPINAFLYDNVPNILAIGTNGSNSSSQYDVQFSILNLTGYENVA 878

Query: 887  REKLNPGERINSIVLFGEDNTLLVGGSFEKDGCHDLCLYNFVKRSWSAFASGLISGEIKQ 946
            R   +  ER+NS+V F  +N++LVGGS+E D C+DLCLYN+  + W++F +  I+G+I+Q
Sbjct: 879  RVNFSTNERVNSMVSFSSNNSILVGGSYEIDNCNDLCLYNYQTKEWTSFLNDSITGDIRQ 938

Query: 947  LQFVNN-RNLIAVGSMTVQSRPNILFLNFDLVRS--RVVEQHEQPNGRAFNSVLTIGDSG 1003
            +QF +  + L+  G +   +  NI  L+ ++  +    V+   +P      S + I DS 
Sbjct: 939  MQFADEGKTLLVGGLIKTNNESNIQLLSVEVGSNIFSTVKSGTEP----LLSFVPIDDST 994

Query: 1004 DEYVAEDGKQVWHYSGSEWKTVTPLSGGQIRIDGISLLMLNNPRSQNKRNRVGNELVVIH 1063
            D  +A+   ++       W +  P       + G  +L      +++K+   G+ +V++ 
Sbjct: 995  DNIIAQMNSEILRLESGTWSSFGPQLNNDSIVSGFKVL----SGTESKKRDEGSHIVLLE 1050

Query: 1064 GQMNSSEYGEINAMHYN--FENWEPYYFTIGSSAREEFNVPRGQIFLNQDISRQTTTSLP 1121
            G +NSSE+G + ++ Y+   + W+PY+  + S  +E+ ++P    F N +    +++   
Sbjct: 1051 GTLNSSEWGNLTSVVYDGSTQKWQPYF--VISDPKEQESLPSSSFFQNVNDLYLSSSQTV 1108

Query: 1122 LEVVVSD------------SPPTAEPKRKLAKGYXXXXXXXXXXXXXXXXXXXXXXXXYA 1169
            L+   SD            S   +   +K+ +G+                        Y 
Sbjct: 1109 LQSNNSDTSASSTPTPSTTSSSHSTKDKKIDRGFIVLIGLALALATVAVIGLIGALICYF 1168

Query: 1170 FGDHNAYQPLKPRINEDEMLKTVPPEKLMKFI 1201
            F ++N Y+ LKPRIN+DEML TVPPEKLMKFI
Sbjct: 1169 FINNNGYESLKPRINQDEMLDTVPPEKLMKFI 1200

>NCAS0B04980 Chr2 complement(912114..915728) [3615 bp, 1204 aa] {ON}
            Anc_8.256 YLR084C
          Length = 1204

 Score =  593 bits (1528), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 401/1227 (32%), Positives = 639/1227 (52%), Gaps = 81/1227 (6%)

Query: 18   VRGSHLESVAQHFDIKHWQTPRLDLSAARNERLLVFDDFQAFEYYNYKGQQLFTG--QEQ 75
            +  S L S+ ++ +I H   P L+L+   N   L+     +  +Y Y GQQ FT      
Sbjct: 16   IYASQLSSLQENLNITHINIPNLNLTTDDNSFELL-GGIDSLSFYRYTGQQNFTSGILPN 74

Query: 76   HQGSSLIYYSEGTYVQLAKLDDDTVVRRIVPFGSDSFILSGTGKLQDQRLEHQLMYNLST 135
               + L YYS  T++QL +   D+ + RI+PFGSDSFILSG G L    L +QL++NLS+
Sbjct: 75   SNSNGLTYYSNNTFIQLYEPSLDSRIERIIPFGSDSFILSGKGSLGGYSLSNQLLFNLSS 134

Query: 136  LEVTEILPQSLESVNDILVDGDMVYFGGQFTYSDGNKSGHSAVQWNATSRTTSLLPFGGF 195
              + +I  Q+L+SVN ILVDG +V FGG FT S  + +GHS   WN T+ +TSLLPF GF
Sbjct: 135  FSLKQIFNQTLDSVNSILVDGTVVCFGGNFTLSTNSLNGHSVALWNYTANSTSLLPFVGF 194

Query: 196  GRGSSVNNILKLSGSGVLFVGRFSNLEAASYAETASVLASTEKPQLNVTTIETNALTSLR 255
            G  S +N+I KL+   +LF G+F  L      + +++L        N++ I    L  L 
Sbjct: 195  GENSLINSITKLNDDNILFAGKFYTL------DNSTLLNVVNDTMRNISDINLGQLIPLS 248

Query: 256  YSTITSDG-HLDKGKFICPTSNDDSWFVPHSGDGPARGELNIKVLHRIIPSKIRIYNSKK 314
             +T +S G   D+  F+CP    ++WF          G LN  +   + P+KIRIYNS  
Sbjct: 249  AATWSSTGSFFDEETFVCPDPTIEAWF-----QNGTSGTLNCNLPFDVAPTKIRIYNSPD 303

Query: 315  NGNEIKLFRIVTSPSQSIMNMTYIDPNTGELATCDAWCPLMPRSNLTSKAAE-SGPADVA 373
              NEI LFRI + PS+SIMN+TYIDP  G+L  CDA+CPL  +  L S +   +  +++ 
Sbjct: 304  PDNEISLFRIFSDPSESIMNLTYIDPVLGQLKHCDAFCPLYTKQVLKSASENVTLSSEMI 363

Query: 374  RLVNDEKVLIKWTPDYQEFAFINQIHMEEIKFIALDSYGNNVGLVGVELFQTEYDAYVNS 433
             L+ND    I+W+ D+QEFAF+NQ+    ++F+AL+SYG NVGL   +++Q  Y  + N+
Sbjct: 364  ELLNDNTSDIRWSQDFQEFAFVNQLSASSLRFLALNSYGTNVGLSSFQIYQDAYAIFANN 423

Query: 434  TLNQPNCGE-QQLSPFSTTANIWHQGATDASYLSANVVESN---PMVNVKPVIPHSGTYT 489
            +LN+P+C   +  S    + N W +G  D +Y+    +      P V   P + +SG Y+
Sbjct: 424  SLNEPSCNSLESFSSSDLSNNTWTRGMDDQNYVKTTYIPHQGVLPEVTFHPDLKYSGQYS 483

Query: 490  LNLYTPGCEDDGTCDYRGIVNVTLLASNGTTLM-TRWIYQNNYRLKYDPLYTGHLDPNPT 548
            + LYTPGC+ D TC  RGIVNVT+  +N  +++ T  IYQNN +LKYD LY+G+L+ +P 
Sbjct: 484  IELYTPGCQQDNTCSSRGIVNVTVWNTNNNSILSTTLIYQNNDQLKYDELYSGYLNYSPK 543

Query: 549  VRMEWVSPINSAVNRKIMVADRVSAIIDSLDGLDDIRHPREK-SLNGLFQYTPAG---SS 604
            + + + S I S      +V DR++ +I+SLD L++I +      LNGLFQY  +    SS
Sbjct: 544  ITVTYHSGIYSGTTAGTVVVDRLNIMINSLDILNEIHNSTNSLELNGLFQYQLSNFSTSS 603

Query: 605  LDNGIQKY----INKDPQTDMPEGVSLVGQVYDGKLILGVKSTGHIAVVTPKGTDWNDVD 660
             D+ I +     IN+   T     VSL   +Y+  L++G    G    +     D     
Sbjct: 604  KDSSIARVANTSINQLTLTGFSSNVSLSASLYNDTLLVGAGDDG--LSIYELNKDLAIQS 661

Query: 661  VTRQDVPGSLNGISPYSKGLVFTGKFNLSSGPSSALHYDGNFGSFFDLNSETSSIINMTI 720
             ++Q + G + G+  YS G++  G FN S   S+ L ++G+F S  ++ S  ++  N+TI
Sbjct: 662  SSQQGIEGKITGLKSYSNGVLVYGDFNSSKESSNVLSFNGSFDSIGNITSPITNFANITI 721

Query: 721  DGSELLLFNNKFIYNTSTSQMLTSSMFQXXXXXXXXXXXX-XXXFTGSIADIKHGSAHGA 779
            D SELL+F+N  I+N S+S  ++++                   F+G+++ ++  +  G+
Sbjct: 722  DDSELLVFDNNLIFNVSSSSQISNTSSFSLSLWSSGSNSNGDTLFSGALSQVQFTNLSGS 781

Query: 780  VALDAEGNIFTSGTPSISGARVHRGVYLNDTATAYAYYSVSPNSSVATGGVVIETPGNNF 839
            V++    N+  +   SI     +  ++LND+ T Y    V  N S  +  +  +     +
Sbjct: 782  VSI--ANNLSATSLRSIGSP--YAAIFLNDSVTGY----VLKNDSSTSEMIFSDGSKAPW 833

Query: 840  NLSNNIATVREMIYVKKTNFLVISTNEVEGTPGALILYDLRTLQEVAREKLNPGERINSI 899
              +     V  M+Y+   + L + ++      G L + +L + + +A E LN    + ++
Sbjct: 834  RWT---GYVDSMLYLTNQSMLAVGSS--SSVNGELSILNLDSFKVLANETLNQNSSVKTM 888

Query: 900  VLFGEDNTLLVGGSFEKDG--CHDLCLYNFVKRSWSAFASGLISGEIKQLQFVNNRNLIA 957
            V F  ++++LVGG+F      C  LCLYN+    W  F +G I+G I +LQ  N+  LI 
Sbjct: 889  VHFERNSSILVGGNFSISNTECFGLCLYNYTGNQWYTFLNGTINGTITKLQIFNDSQLII 948

Query: 958  VGSMTVQSRPNILFLNFDLVRSRVVEQH---EQPNGRAFNSVLTIGDSGDEYVAEDGKQV 1014
             G    +S+ ++     +L  +++V      ++P        +TI D+     A +   +
Sbjct: 949  AGVFDTKSQSSVNLALMNLTDNKLVLIRWGFKEP----VKDFITIDDN---IFAWNETSL 1001

Query: 1015 WHYSGSEWKTVTPLSGGQ--IRIDGISLLMLNNPRSQNKRN-RVGNELVVIHGQMNSSEY 1071
            + Y+ + W  + P+S       ID I      +   + + N    N ++++ GQ+  + Y
Sbjct: 1002 FEYTSNSWVDI-PISNSNSSTTIDSIGWTTTTDNNLKKRDNSETSNNVLIVKGQIYDNVY 1060

Query: 1072 GEINAMHYNFENWEPYYFTIGSSAREEFNVPRGQIFLNQDISRQTTTSLPLEVVVSDSPP 1131
            G I AM YNFE W P Y +I S      N P  ++F+++D+S+   + L L+V  + +  
Sbjct: 1061 GHIQAMIYNFEEWIP-YLSINSLVSSA-NQP-AELFIDRDVSKLFDSQLALQVSNTTASI 1117

Query: 1132 TA----------------EPKRKLAKGYXXXXXXXXXXXXXXXXXXXXXXXXYAFGDHNA 1175
            TA                + K+K+ +G+                        YAF D + 
Sbjct: 1118 TASSSTPTPTSSPKKKLHQSKKKIDRGFVVLIGLALALGTMTVLGIVGVILAYAFRDDDG 1177

Query: 1176 -YQPLKPRINEDEMLKTVPPEKLMKFI 1201
             Y  + PR+NEDEMLKTVPPEKLM+FI
Sbjct: 1178 DYDVITPRVNEDEMLKTVPPEKLMEFI 1204

>KAFR0B02690 Chr2 complement(539470..543102) [3633 bp, 1210 aa] {ON}
            Anc_8.256 YLR084C
          Length = 1210

 Score =  593 bits (1529), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 410/1250 (32%), Positives = 632/1250 (50%), Gaps = 89/1250 (7%)

Query: 1    MRLHMGLVAALAPLGDVVRGSHLESVAQHFDIKHWQTPRLDLSAARNERLLVFDDFQAFE 60
            MR H  L+ +L+    +   S L  +     I+ +  P L  S+  +  L +   + A  
Sbjct: 1    MRTHHKLIKSLSLFTTLSLASQLSQLENSLGIQTFAPPALIFSSNNDSSLQLLGSYDALS 60

Query: 61   YYNYKGQQLFTGQEQHQGSS--LIYYSEGTYVQLAKLDDDTVVRRIVPFGSDSFILSGTG 118
             Y Y GQQ F+ Q     +S  L+YYS  T +QL +  DDT +  IVP GSDSFILSG+G
Sbjct: 61   LYTYTGQQNFSYQITPDTNSNGLVYYSNNTLIQLNQGLDDTRINNIVPIGSDSFILSGSG 120

Query: 119  KLQDQRLEHQLMYNLSTLEVTEILPQSLESVNDILVDGDMVYFGGQFTYSDGNKSGHSAV 178
             L +  LE+QL YNLS+L V  I   +LE V  ILVD D+VYFGG FT+S+G   GHS  
Sbjct: 121  SLNEYSLENQLFYNLSSLSVYPIFNTTLEQVESILVDEDLVYFGGNFTFSNGTDDGHSVA 180

Query: 179  QWNATSRTTSLLPFGGFGRGSSVNNILKLSGSGVLFVGRFSNLEAASYAETASVLASTEK 238
             WN TS +T LLPF GFG  SS+NNIL+L+   +LF G F  L+ AS      + ++T  
Sbjct: 181  VWNITSNSTGLLPFLGFGENSSINNILRLNDDNILFAGEFYTLDDASL-----LTSNTSN 235

Query: 239  PQLNVTTIETNALTSLRYSTITSD-GHLDKGKFICPTSNDDSWFVPHSGDGPARGELNIK 297
               N+  +E + L  L  +T +SD    D   FIC   + D+WFV  +      G L   
Sbjct: 236  ATTNIYDLELSPLLPLNEATWSSDVSDFDASSFICVNPDSDAWFVSGT-----TGTLACS 290

Query: 298  VLHRIIPSKIRIYNSKKNGNEIKLFRIVTSPSQSIMNMTYIDPNTGELATCDAWCPLMPR 357
            + +    +KIRIYNS  + N+I  FR+++ PS SIMNMTYIDP TG L  CD++CPL+ R
Sbjct: 291  LPYDSALTKIRIYNSPDSQNQISEFRLISDPSGSIMNMTYIDPRTGNLEHCDSYCPLLSR 350

Query: 358  SNLTSKAAESGPADVARLVNDEKVLIKWTPDYQEFAFINQIHMEEIKFIALDSYGNNVGL 417
              L+S +  +  +++ARL++D   +IKW+ +YQEF F+N +    ++F+AL+SYG+NV L
Sbjct: 351  DTLSSASDAASVSEMARLLSDNATVIKWSAEYQEFGFVNVVSTTLLQFLALNSYGSNVAL 410

Query: 418  VGVELFQTEYDAYVNSTLNQPNCGEQQLSPFSTTA--NIWHQGATDASYLSANVVESN-- 473
             G  L+Q EY  + N++LN  +C        S+T   N W  GA+  +Y++    E +  
Sbjct: 411  AGYSLYQDEYAVFANNSLNGASCTSNNSDYTSSTLSDNDWVFGASGQTYVTTFYTEGDDP 470

Query: 474  -PMVNVKPVIPHSGTYTLNLYTPGCEDDGTCDYRGIVNVTLL-ASNGTTLMTRWIYQNNY 531
             P V     +P+SG Y +NLYTPGC DDGTC  RG+VNVT+   S+ + L T  IYQNN 
Sbjct: 471  IPQVTFNANLPYSGDYVINLYTPGCSDDGTCSTRGLVNVTVYDESDDSILSTVEIYQNNE 530

Query: 532  RLKYDPLYTGHLDPNPTVRMEWVSPINSAVNRKIMVADRVSAIIDSLDGLDDIRHPREKS 591
             LKYD L++G+L  +  + +E+VS I+S      +VADR +  + SLD L  I   +  S
Sbjct: 531  ALKYDELFSGYLKNSVRIVLEYVSGISSDSTGTTVVADRSNIYVTSLDILGQISSSKNGS 590

Query: 592  ---LNGLFQYTPAGSSLDNGI------QKYINKDPQTDMPEGVSLVGQVYDGKLILGVKS 642
               LNGLFQY  +  S           + ++N+ P        SL    YD  L++G   
Sbjct: 591  TVALNGLFQYQLSNFSSTFNSSSAKVGKTFLNQYPLDIFNTNSSLFASTYDNYLLVGGAE 650

Query: 643  TGHIAVVTPKGTDWNDVDVTRQD---VPGSLNGISPYSKGLVFTGKFNLSSGPSSALHYD 699
                A+ +      ND++ +  D   V G    + P+S+G+   G FNLS     A+ Y+
Sbjct: 651  QSVYALESS-----NDLNFSTSDNSGVEGQFKNMQPFSEGIFLYGNFNLSGVTEGAVTYN 705

Query: 700  GNFGSFFDL-NSETSSIINMTIDGSELLLFNNKFIYNTSTSQMLTSSMFQXXXXXXX-XX 757
            G+F  F    NS   +  N+T   SE+L+FNN ++YN S+S ++++S             
Sbjct: 706  GSFNPFTQYGNSSIDTFKNVTFGNSEILVFNNAYLYNVSSSTLMSNSSSLSLSLWSAGAN 765

Query: 758  XXXXXXFTGSIADIKHGSAHGAVALDAEGNIFTSGTPSISGARVHRGVYLNDTATAYAYY 817
                  F G+ + + +   + ++ + A  N    G         + G+Y+N +  AY Y 
Sbjct: 766  ANGDLLFNGASSQMSYSFNNESINIGA--NNIVQGLNFNESIDPYLGLYMNTSHGAYFYQ 823

Query: 818  SVSPNSSVATGGVVIETPGNNFNLSNNIATVREMIYVKKTNFLVISTNEVEGTPGALILY 877
                     T G     P   +   N++      IY    + L+  T+    +   L + 
Sbjct: 824  DDDNTRVYFTNG---SQPS--WQWPNDVVAA---IYSDNQSLLIAGTSSSLESSSFLTVL 875

Query: 878  DLRTLQEVAREKLNPGERINS-IVLFGEDNTLLVGGSFEKD--GCHDLCLYNFVKRSWSA 934
            +  T   +A E L+  +   S IV F  + T ++GG+F      C  LCL+N+   +WS+
Sbjct: 876  NTTTYDVIANESLSSQQSQISGIVNFASNATAIIGGNFSMPNVNCFGLCLFNYGNSTWSS 935

Query: 935  FASGLISGEIKQLQFVNNRNLIAVGSMTVQSRPNILFLNFDLVRSRV--VEQHEQPNGRA 992
            FA   I+G +  +Q  N   LI  G  + ++  +I   + +L  +++  ++  E    ++
Sbjct: 936  FADASINGTVDHMQLFNESELIVSGLFSTKNISSITMASLNLKNNKITALKSGESNTFKS 995

Query: 993  FNSVLTIGDSGDEYVAEDGKQVWHYSGSEW--KTVTPLSGGQIRIDGISLLMLNNPRSQN 1050
            F    T+ D   + VA +   +  Y  + W  + ++ ++   + +D ++ + L +  S  
Sbjct: 996  F----TVAD--QKIVAWNNTALSIYEDNVWTVERISNINSSSV-VDNLNYVTLASALS-- 1046

Query: 1051 KRNRVGNELVVIHGQMNSSEYGEINAMHYNFENWEPYYFTIGSSAREEFNVPRGQIFLNQ 1110
            KR+   ++ +++ GQ+  + YG I AM Y+F +W PY   I S +    N      F+++
Sbjct: 1047 KRDTSSSDAILVSGQLYDNSYGHIQAMVYDFSSWVPYLL-INSESDSSINA-----FIDR 1100

Query: 1111 DISRQTTTSLPL------------------EVVVSDSPPTAEPKRKLAKGYXXXXXXXXX 1152
            D+S  T T + L                      + S P    KRK+ +G+         
Sbjct: 1101 DMSSFTNTQVALLTNSGTVSNSSSSTTSPGASASATSIPNKTHKRKIDRGFVVLLGLALA 1160

Query: 1153 XXXXXXXXXXXXXXXYAFGDHN-AYQPLKPRINEDEMLKTVPPEKLMKFI 1201
                           Y F D N AY+P+ PRI+E+EM++TVPPEKLMK+I
Sbjct: 1161 LGTVAVLGIAGVIMAYVFRDDNGAYEPINPRIDENEMIETVPPEKLMKYI 1210

>TPHA0B03250 Chr2 (745716..749363) [3648 bp, 1215 aa] {ON} Anc_8.256
            YLR084C
          Length = 1215

 Score =  587 bits (1513), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 402/1246 (32%), Positives = 623/1246 (50%), Gaps = 92/1246 (7%)

Query: 8    VAALAPLGDVVRGSHLESVAQHFDIKHWQTPRLDLSAARNERLLVFDDFQAFEYYNYKGQ 67
            +  L  L +    S L ++ +  +I+ ++ P L+ +   N   L+  D +  ++Y+Y+GQ
Sbjct: 10   LVVLFSLANNATASSLSNILKLLNIQEFELPNLNFNNTSNSIQLL-GDVENLQFYHYEGQ 68

Query: 68   QLFTGQEQHQGSS---LIYYSEGTYVQLAKLDDDTVVRRIVPFGSDSFILSGTGKLQDQR 124
            Q FT       SS   LIYYS+   +QL    +DT +++I+P G DSF+LSG+G L    
Sbjct: 69   QNFTDDGNSGISSTNNLIYYSDDVLIQLEVGSNDTDIQKIIPVGDDSFVLSGSGHLNGYA 128

Query: 125  LEHQLMYNLSTLEVTEILPQSLESVNDILVDGDMVYFGGQFTYSDGNKSGHSAVQWNATS 184
            L  QL+YNL+TL +  I  Q L ++  ILVD ++VYFGG+FTY   +++  S + WN TS
Sbjct: 129  LGRQLLYNLTTLSIKPIFDQDLGNITSILVDEEIVYFGGEFTYQTRSQNSSSVISWNMTS 188

Query: 185  RTTSLLPFGGFGRGSSVNNILKLSGSGVLFVGRFSNLEAASYA--ETASVLASTEKPQLN 242
                 LPF GFG  S VN+ILKL+   +LFVG F  L  +S     T S  ++      N
Sbjct: 189  DEVIELPFQGFGSDSKVNSILKLNDDNILFVGMFDTLGNSSLLTYNTTSNFSNFTNSTEN 248

Query: 243  VTTIETNALTSLRYSTITS-DGHLDKGKFICPTSNDDSWFVPHSGDGPARGELNIKVLHR 301
             +TI+     SL+Y+T  +   + D+  F+C   + ++W V    +G + G L +   + 
Sbjct: 249  SSTIQLEQQISLKYATWDAGTAYFDQNNFVCEAGSSEAWIV----EGRS-GNLQLNFPNT 303

Query: 302  IIPSKIRIYNSKKNGNEIKLFRIVTSPSQSIMNMTYIDPNTGELATCDAWCPLMPRSNLT 361
            + PSKIRIYN+    + + LFRIVTSPS  IMN+TY+DP TG+L  CDA+CPL+  S L 
Sbjct: 304  VSPSKIRIYNANTAEDGVSLFRIVTSPSNGIMNLTYVDPLTGQLKYCDAFCPLLNSSGLE 363

Query: 362  SKAAESGPADVARL-VNDEKVLIKWTPDYQEFAFINQIHMEEIKFIALDSYGNNVGLVGV 420
            + ++ S      R+ +N+    + W+  YQEFAFIN I +  +  IA DSYG+   L G+
Sbjct: 364  TASSNSTSETRQRVFINNNTTSVTWSESYQEFAFINNIDVSALTLIAQDSYGSKTALSGI 423

Query: 421  ELFQTEYDAYVNSTLNQPNCGEQQLSPFSTTA---NIWHQGATDASYLSANVVESN---P 474
            ELFQ  + AY N+TLNQP C  +  S FS++    N W++G    SY++AN    +   P
Sbjct: 424  ELFQDSHTAYANNTLNQPGCDTESTSLFSSSVLSDNGWYKGLDSDSYIAANYQSDSSPLP 483

Query: 475  MVNVKPVIPHSGTYTLNLYTPGCEDDGTCDYRGIVNVTLL-ASNGTTLMTRWIYQNNYRL 533
             V   P I   G +++ +YTPGC  DGTC+ R IVNVT+L  ++GT L T+ IYQNN  +
Sbjct: 484  TVQFYPNIQAVGDFSIKMYTPGCLADGTCESRSIVNVTVLDPTDGTVLSTQLIYQNNNEM 543

Query: 534  KYDPLYTGHLDPNPTVRMEWVSPINSAVNRKIMVADRVSAIIDSLDGLDDIRHPREKS-- 591
            KYD ++ G L  +P + + + S I   ++  I+VADRV      ++  D +     KS  
Sbjct: 544  KYDEIFNGKLTVSPEITLTFYSTILPDLDSAIIVADRVDLTPTYINVDDILLDSNLKSTS 603

Query: 592  --LNGLFQYTPAGSSLDNGIQ---KYINKDPQTDMPEGVSLVGQVYDGKLILGVKSTGHI 646
              LNGLFQY  +  + D   +     I++   +  P  VSL+G  ++  + L   ST +I
Sbjct: 604  LKLNGLFQYQLSNFTSDTKTKVGNNSIHQLALSQFPSSVSLIGNTFNNSIFLA-GSTSNI 662

Query: 647  AVVTPKGTDWNDVDVTRQDVPGSLNGISPYSKGLVFTGKFNLSS-GPSSALHYDGNFGSF 705
             V     +D    +    D  G    I  YS+GL+F G++N+SS      L ++G F SF
Sbjct: 663  -VQLQLNSDLELRNTVVVDNGGETTRIENYSQGLLFFGQYNISSTNVVDNLSFNGTFSSF 721

Query: 706  FDLNSETSSIINMTIDGSELLLFNNKFIYNTST-SQMLTSSMFQXXXXXXXXXXXXXXXF 764
              L    ++  N T +GSELL FNN ++YN S+ S +  ++MF                 
Sbjct: 722  SQLGDNVTTFANFTYEGSELLFFNNDYLYNVSSESYIYNNTMFTASVLATGANSNNDTLL 781

Query: 765  TGSIADIKHGSAHGAVALDAEGNIFTSGTPSISGARVHRGVYLNDTATAYAYYSVSPNSS 824
             G+I   ++ + +  + L   GN         S    +  V+LNDTA  YAY     NS 
Sbjct: 782  LGNIVRSEYSNFNEPLKL--YGNSSLESLTFSSSIVPYAAVFLNDTANLYAYKD-GENSK 838

Query: 825  VATGGVVIETPGNNFNLSNNIATVREMIYVKKTNFLVISTNEVEGTPGALILYDLRTLQE 884
            +          GNN   S + +     +     + L+ +         +L++ ++     
Sbjct: 839  IIY--------GNNMTTSLDFSGTLNKLSFSNNSSLLFANAITNNGSSSLVISNISDGMS 890

Query: 885  VAREKLNPGERINSIVLFGEDNTLLVGGSFEKD--GCHDLCLYNFVKRSWSAFASGLISG 942
            +A E LN    I S++ F  +NT+LV G+F  D   CH +CLYN+  + WSAFA+  I G
Sbjct: 891  LASENLNNYGYITSMIDFNSNNTILVSGNFTLDDVDCHGICLYNYFTKKWSAFANSTIKG 950

Query: 943  EIKQLQFVNNRNLIAVGSMTVQSRPNILFLNFDLVRSRVVEQHEQPNGRAFNSVLTIGDS 1002
             I ++Q  N+  ++  G  + Q+  +I   + D+              + +N  +   DS
Sbjct: 951  SIVEMQLWNSDQILISGLFSAQNYSSITLASLDI--------------KGYNISVLSDDS 996

Query: 1003 GDEYVA--EDGKQ--VW------HYSGSEWKTVTPLSGGQIRIDGISLLMLNNPRSQNKR 1052
              E  +   DG+   VW       Y   +W  ++  +     I+ +  + ++    QN  
Sbjct: 997  KIEISSFIHDGQSITVWSNDTIMEYKSEKWNEISFPNTTSKYIESVEAVSID---LQNST 1053

Query: 1053 NRVGNELVVIHGQMNSSEYGEINAMHYNFENWEPYYFTIGSSAREEFNVPRGQIFLNQDI 1112
            + V  +++  +G+ NS+ YG +NAM +   +W+PY+        E+   P   +F N+D+
Sbjct: 1054 SNVS-KILFAYGEFNSTLYGRLNAMLFRAGDWKPYFSINNFQVNED---PAITLFENRDL 1109

Query: 1113 SR--QTTTSLPLEV---------VVSDSPPTAEPKR------KLAKGYXXXXXXXXXXXX 1155
            S    +  SLP  +          VS +  T    +      K+ +G+            
Sbjct: 1110 SSLFNSKNSLPANITSAETSSRSTVSSATATTVVNKIEGKHSKIDRGFVVLIALALAVGT 1169

Query: 1156 XXXXXXXXXXXXYAFGDHNAYQPLKPRINEDEMLKTVPPEKLMKFI 1201
                        Y F D   Y+ +KPRI+  EML TVPPEKLMKFI
Sbjct: 1170 VALLGLFGVTIAYIFRDEQKYESIKPRIDGQEMLDTVPPEKLMKFI 1215

>ZYRO0C01804g Chr3 (140029..143658) [3630 bp, 1209 aa] {ON} similar to
            uniprot|Q12465 Saccharomyces cerevisiae YLR084C RAX2
            N-glycosylated protein involved in the maintenance of bud
            site selection during bipolar budding localization
            requires Rax1p
          Length = 1209

 Score =  583 bits (1503), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 400/1230 (32%), Positives = 615/1230 (50%), Gaps = 80/1230 (6%)

Query: 17   VVRGSHLESVAQHFDIKHWQTPRLDLSAARNERLLVFDDFQAFEYYNYKGQQLFTGQEQH 76
            +  GS L  + Q  +  + Q P+LDL+++RN+ L +  DFQ   +Y Y GQ+ FT     
Sbjct: 15   ITNGSQLSHLQQLLNASNIQVPKLDLTSSRNQALELLGDFQDLTFYKYTGQENFTSPLNS 74

Query: 77   QGSS--LIYYSEGTYVQLAKLDDDTVVRRIVPFGSDSFILSGTGKLQDQRLEHQLMYNLS 134
               S  LIYYS  T++QLA   +DT +++IVP G DSFILSG+G +    L+ QL YNL+
Sbjct: 75   STDSHGLIYYSNDTFLQLANGSNDTDIKQIVPLGEDSFILSGSGHIDGYNLQRQLHYNLT 134

Query: 135  TLEVTEILPQSLESVNDILVDGDMVYFGGQFTYSDGNKSGHSAVQWNATSRTTSLLPFGG 194
             L    I  + L  VN ILVD  +VYFGG FT+S+G+++GHS V WN+   +TSLLPF G
Sbjct: 135  DLSFKPIFQEGLTEVNSILVDQPLVYFGGNFTFSNGSQTGHSVVLWNSEKNSTSLLPFIG 194

Query: 195  FGRGSSVNNILKLSGSGVLFVGRFSNLEAASYAETASVLASTEKPQLNVTTIETNALTSL 254
            FG+ S+VN+I++L    +LF G F  L+     E   + ++    + N T +E      L
Sbjct: 195  FGQNSTVNSIIRLDRDNILFAGNFYELDDVKLLENHILGSNNSSSKSNWTDVELGLAIPL 254

Query: 255  RYSTIT-SDGHLDKGKFICPTSNDDSWFVPHSGDGPARGELNIKVLHRIIPSKIRIYNSK 313
            + +  T S    D   FICP    +SW    SG     G L   +     P KIRIYNS 
Sbjct: 255  QNANWTSSSSQFDADDFICPDPERESWL--QSG---TSGSLACSLPQETTPYKIRIYNSP 309

Query: 314  KNGNEIKLFRIVTSPSQSIMNMTYIDPNTGELATCDAWCPLMPRSNLTSKAAESGPADVA 373
               NE+ LFRI+  P++ I+N++Y+DP  GEL  CDA+CPL  R  L   ++ S   +  
Sbjct: 310  VEDNEVSLFRILAEPTKGILNLSYVDPEEGELRYCDAFCPLYNRQRLEEASSNSSSVENM 369

Query: 374  RLVNDEKVL-IKWTPDYQEFAFINQIHMEEIKFIALDSYGNNVGLVGVELFQTEYDAYVN 432
               +D     IKW  D+QEFAF+N + +  ++F+AL SYG+NVGL   + FQ+    Y N
Sbjct: 370  TTFSDNNTTDIKWGRDFQEFAFVNNVPISSVEFVALSSYGSNVGLSSWQFFQSRASIYAN 429

Query: 433  STLNQPNCGE-QQLSPFSTTANIWHQGATDASYLSANVVESN---PMVNVKPVIPHSGTY 488
            ++LNQP CG+ Q  S  + + N W QG    +YLS + VE     P V   P I + G Y
Sbjct: 430  NSLNQPACGKMQSYSNATISNNDWRQGLNGQTYLSTSYVEDQGNIPRVTFHPQIQYPGNY 489

Query: 489  TLNLYTPGCEDDGTCDYRGIVNVTLLASNGTT-LMTRWIYQNNYRLKYDPLYTGHLDPNP 547
            ++ LYTPGC  DGTC+ R IVNVTL   +    L +  IY+NN  LKYD L+ GHL  +P
Sbjct: 490  SIKLYTPGCLGDGTCNQRAIVNVTLWDGDSNEPLSSEVIYENNNELKYDELWDGHLKSSP 549

Query: 548  TVRMEWVSPINSAVNRKIMVADRVSAIIDSLDGLDDIRHPREKSLNGLFQYTPAGSSLDN 607
             V +E+ SPI       ++VAD +S    S D  +  +H ++ +LNG+FQY  +      
Sbjct: 550  KVTLEYHSPIYPNNPTSVVVADYISLEAKSFDHFE--KHKKDITLNGIFQYQIS------ 601

Query: 608  GIQKYINKD----------PQTDMPEGVSLVGQVYDGKLILGVKSTGHIAVVTPKGTDWN 657
               K I K+          P +      SL   +Y+   +L   S    A +     +W+
Sbjct: 602  NFTKNITKESIGNTSLDVFPLSYFSNNSSLFASLYENDTLLLADSKSKAAEIKLD-KNWS 660

Query: 658  DVDVTRQ-DVPGSLNGISPYSKGLVFTGKFNLSSGPSSALHYDGNFGSFFDLNSETSSII 716
             VD ++  ++   + GI  YS GL+  G +N S     AL ++G+F S+  +N       
Sbjct: 661  -VDSSKSFNLASQVRGIGSYSDGLILFGDYNSSQRQPLALSFNGSFNSYDKINRSVERFT 719

Query: 717  NMTIDGSELLLFNNKFIYNTSTSQMLT-SSMFQXXXXXXXXXXXXXXXFTGSIADIKHGS 775
            N+ + G+ELL+F+N+F YN S+   ++ ++ F                F+G+++D  + +
Sbjct: 720  NIDLKGTELLVFDNEFFYNVSSQSYVSNTTRFSLSVWSAGQNTNGDLIFSGAVSDNDYEN 779

Query: 776  AHGAVALDAEGNIFTSGTPSISGARVHRGVYLNDTATAYAYYSVSPNSSVATGGVVIETP 835
              G V+L   G+  +S          + G YLNDT TAYAY   S +  V + G   E P
Sbjct: 780  LQGPVSLFQNGSAVSSNIK--DNINPYMGAYLNDTLTAYAYKDGSDSRIVFSNG--DEGP 835

Query: 836  GNNFNLSNNIATVREMIYVKKTNFLVISTNEVEGTPGALILYDLRTLQEVAREKLNPGER 895
               +  +N+I T   MIY  +   L + T+     P   +L +L T + +A E L+ G  
Sbjct: 836  ---WRWTNSIET---MIYRNRDALLALGTSSSPSLPQLSVL-NLTTSEVLANETLDKGAE 888

Query: 896  INSIVLFGEDNTLLVGG--SFEKDGCHDLCLYNFVKRSWSAFASGLISGEIKQLQFVNNR 953
            +NS++LFG+++TLL+GG  SF    C+ LCLYN+  + WS FA+  I+G++ Q+Q  N+ 
Sbjct: 889  VNSMILFGKNSTLLIGGNFSFSDAHCNGLCLYNYKNKRWSTFANDSITGQVTQVQLRNSS 948

Query: 954  NLIAVGSMTVQSRPNILFLNFDLVRSRVVEQHEQPNGRAFNSVL-TIGDSGDEYVAEDGK 1012
             L+  GS+ V    ++     +LV   +  Q  +   R +   L +   S D  V  +  
Sbjct: 949  ELLIAGSLRVNGTSDV-----NLVSVNITGQGMKTLLRGWEGPLRSFVVSEDRLVVWNDT 1003

Query: 1013 QVWHYSGSEWKTV-TPLSGGQIRIDGISLLMLNNPRSQNKRNRVGNEL--VVIHGQMNSS 1069
             +  Y  + W+ + T  S    ++  I  + L +   +   +   + L  ++++G  + +
Sbjct: 1004 SLMAYDNTSWRHISTSNSTSFTKLQDIHQVSLEHSLEKRANSSSNSNLDGLLVYGN-DKT 1062

Query: 1070 EYGEINAMHYNFENWEPYYFTIGSSAREEFNVPRGQIFLNQDIS-------------RQT 1116
            +     A  Y++ +W P +  I +S  E  N     IF+NQD+S               T
Sbjct: 1063 QGDSYQASIYDYYSWTPLF--IANSKSENSN-SGPNIFMNQDVSDFFISEQMLPNPTNHT 1119

Query: 1117 TTSLPLEVVVSDSPPTAEPK----RKLAKGYXXXXXXXXXXXXXXXXXXXXXXXXYAFG- 1171
            ++        + +  + + K     K+ +GY                        Y FG 
Sbjct: 1120 SSRSSSSSSSAVTSNSGDKKHRASHKVDRGYVVLIGLALAIGTVVVIGVFGILIAYMFGE 1179

Query: 1172 DHNAYQPLKPRINEDEMLKTVPPEKLMKFI 1201
            D   Y+ L P     +  +T PP K  KF+
Sbjct: 1180 DIGGYEFLSPPAEGTKAAETAPPAKSSKFL 1209

>TDEL0F03830 Chr6 complement(701362..704949) [3588 bp, 1195 aa] {ON}
            Anc_8.256 YLR084C
          Length = 1195

 Score =  581 bits (1497), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 399/1225 (32%), Positives = 622/1225 (50%), Gaps = 89/1225 (7%)

Query: 20   GSHLESVAQHFDIKHWQTPRLDLSAARNERLLVFDDFQAFEYYNYKGQQLFTGQEQHQGS 79
             S LE++     I +  TPRLD      E L +F  F A  +  Y+GQ+ FTG   +   
Sbjct: 17   ASQLENLKNKHGIVNIGTPRLDFPG---EALQLFGGFNALTFPQYEGQENFTGTINNNTD 73

Query: 80   S--LIYYSEGTYVQLAKLDDDTVVRRIVPFGSDSFILSGTGKLQDQRLEHQLMYNLSTLE 137
            S  ++YYS  T+++L     D+ V +IVPFGS+SFIL G+G L    L  QL+YNLS L 
Sbjct: 74   SRGIVYYSNDTFIKLINGSSDSYVEKIVPFGSESFILGGSGSLLGYELGRQLLYNLSDLS 133

Query: 138  VTEILPQSLESVNDILVDGDMVYFGGQFTYSDGNKSGHSAVQWNATSRTTSLLPFGGFGR 197
            +  I   SL  V  IL D  + YFGG F++ +G+  GHS   WN++S TTSLLPFGGFG 
Sbjct: 134  LRPIFENSLTDVRVILEDYPVAYFGGNFSFDNGSTVGHSVATWNSSSNTTSLLPFGGFGE 193

Query: 198  GSSVNNILKLSGSGVLFVGRFSNLEAASYAETASVLASTEKPQLNVTTIETNALTSLRYS 257
             S VN+I+KL    +LF G F  L+  +   T    + T   Q    +IE N L  LR +
Sbjct: 194  ESIVNSIIKLDSDNILFTGEFYTLDDQTLLITNENTSKTNHSQ----SIEINELLPLRAA 249

Query: 258  TITS--DGHLDKGKFICPTSNDDSWFVPHSGDGPARGELNIKVLHRIIPSKIRIYNSKKN 315
            T  +  D   D   FICP S  ++W VP +      G L   + +   P K+RIYNS + 
Sbjct: 250  TWNTDSDSSFDSSAFICPNSQKEAWSVPST-----SGSLEASLPYESYPKKVRIYNSPEE 304

Query: 316  GNEIKLFRIVTSPSQSIMNMTYIDPNTGELATCDAWCPLMPRSNLTSKAAESGPADVARL 375
             N + LFRI+T PS  IMN+TY+DP +GEL  CDA+CPLM + +L +  A    + V RL
Sbjct: 305  HNAVSLFRIITKPSNGIMNLTYVDPLSGELLNCDAFCPLMLQDSLKAAVANGNTSQVVRL 364

Query: 376  VNDEKVLIKWTPDYQEFAFINQIHMEEIKFIALDSYGNNVGLVGVELFQTEYDAYVNSTL 435
             N+    I+W+ DYQ+FAF+N+I + +++F+AL SYG+ VGL   +L+Q     Y N++L
Sbjct: 365  DNN-LTDIQWSYDYQDFAFVNKIAVTDLQFLALSSYGDAVGLSSFQLYQDTLTTYANNSL 423

Query: 436  NQPNCGEQQLSPFSTTANI-WHQGATDASYLSANV---VESNPMVNVKPVIPHSGTYTLN 491
            N+  C    ++  S  ++  W QG    SYL A+     E+ P V   P I ++G YT+N
Sbjct: 424  NEVGCESNDIASTSALSDSEWQQGLFGQSYLVADFRTGQETLPKVTFYPAINYAGQYTMN 483

Query: 492  LYTPGCEDDGTCDYRGIVNVTLLAS-NGTTLMTRWIYQNNYRLKYDPLYTGHLDPNPTVR 550
            LYTPGC  D TC  R IVNVT+ +   G+ L +  ++QNN  +KYD +Y+GHL+  P + 
Sbjct: 484  LYTPGCSSDQTCTSRSIVNVTMWSEVGGSILSSILLHQNNEAMKYDQVYSGHLETAPVLT 543

Query: 551  MEWVSPINSAVNRKIMVADRVSAIIDSLDGLDDIRHPREKSLNGLFQY-----TPAGSSL 605
            +E+ SPI+      ++VADR+  I++S+D L + +      LNG+FQY     T +  S 
Sbjct: 544  LEYYSPISPNNPSNVVVADRLEVIVESVDILKN-QTDETIPLNGMFQYQLSNFTNSTDSK 602

Query: 606  DNGIQKYINKDPQTDMPEGVSLVGQVYDGKLILGVKSTGHIAVVTPKGTDWNDVDVTRQD 665
             +     +N     + P+  SL   +Y+  L +G   +G  AV   +  D +     +  
Sbjct: 603  PSIANTTLNSYTVQNFPKNASLFSSMYNNTLWVGGSVSGVAAVELDE--DLHVSSTAKYA 660

Query: 666  VPGSLNGISPYSKGLVFTGKFNLSSGPSSALHYDGNFGSFFDLNSETSSIINMTIDGSEL 725
              G++ GIS YS G++  G FNLSS P S L ++G FGSF +L +   +  N++    EL
Sbjct: 661  TGGTVEGISSYSDGIILFGTFNLSSQPVSTLTFNGVFGSFGNLETTLRTYTNVSFQQDEL 720

Query: 726  LLFNNKFIY-NTSTSQMLTSSMFQXXXXXXXXXXXXXXXFTGSIADIKHGSAHGAVALDA 784
            L+FNN++++  +S S +  SS F                F+G++   +    +G+ ++ +
Sbjct: 721  LVFNNEYVFNLSSNSYISNSSTFGLSLWSAGRNQFDDTLFSGAVTKNQFPGLYGSASIYS 780

Query: 785  EGNIFTSGTPSISGARVHRGVYLNDTATAYAYYSVSPNSSVATGGVVIETPGNNFNLSNN 844
              ++  +     +GA+ +   +LND+ TAYAY   S +      G   E P   F     
Sbjct: 781  NSSV--AHFSLQNGAQPYAACHLNDSVTAYAYRYGSVSQLYFDNGK--EGPWTWF----- 831

Query: 845  IATVREMIYVKKTNFLVISTNEVEGTPGALILYDLRTLQEVAREKLNPGERINSIVLFGE 904
              T+  M Y K +  L I T+     P  L L++L +   +A   ++    I+S+V F  
Sbjct: 832  -GTINSMRYSKNSTILAIGTDGSTDEP-ILSLFNLTSFDVLANTTISENGTISSMVFFDR 889

Query: 905  DNTLLVGGSFE--KDGCHDLCLYNFVKRSWSAFASGLISGEIKQLQFVNNRNLIAVGSMT 962
            +++LLVGG +      C  LCLYN+ ++ W+ FA+  I+G I ++Q   + +L+  G+M 
Sbjct: 890  NSSLLVGGDYHISDADCSGLCLYNYDQKQWTKFANNSITGNITEMQLSESYDLLISGAMN 949

Query: 963  VQSRPNILFLNFDLVRSRVVEQHEQPNGRAFNSVLTIGDSGDEYVAEDGKQV-WH----- 1016
            V ++ ++  L+F++    V       NG               ++AED   + W+     
Sbjct: 950  VANKTSVNLLSFNMSNYEVNPLVWDSNGPI-----------KSFIAEDNDIITWNETSLS 998

Query: 1017 -YSGSEWKTVTPLSGGQIRIDGISLLMLNNPRSQNKRNRVGN--ELVVIHGQMNSSEYGE 1073
             YS  +W+ +   +   I I  + ++ +    + +KR    +  + +++ GQ N +EY +
Sbjct: 999  GYSDGDWQNLEFDNSSLISI--VDVIAVKTEPALDKRQTFSSTFDAILVAGQ-NYAEYPQ 1055

Query: 1074 INAMHYNFENWEPYYFTIGSSAREEFNVPRGQIFLNQDISRQTTTSLPLEVVVSDSPPT- 1132
              A  YNF+ W PYY  + + A +E +  R   F NQD S+   +   L      +  + 
Sbjct: 1056 --ASIYNFQRWLPYY--VANKADDE-DPSRTTFFTNQDDSQLYDSQNLLSDPTRTTTSSS 1110

Query: 1133 ----------------AEPKRKLAKGYXXXXXXXXXXXXXXXXXXXXXXXXYAFGDHNAY 1176
                                 K+ +G+                          F  H+ Y
Sbjct: 1111 SSTTSSSQTSPSKGSLVRKSGKINRGFVVLIGLALALGTVVIIGITGVLLALVFNGHSGY 1170

Query: 1177 QPLKPRINEDEMLKTVPPEKLMKFI 1201
            + + PR +E EM+ TVPPEKL+KF+
Sbjct: 1171 EQVDPRADESEMIDTVPPEKLLKFL 1195

>KLTH0G13838g Chr7 (1197919..1201563) [3645 bp, 1214 aa] {ON} similar
            to uniprot|Q12465 Saccharomyces cerevisiae YLR084C RAX2
            N-glycosylated protein involved in the maintenance of bud
            site selection during bipolar budding localization
            requires Rax1p
          Length = 1214

 Score =  577 bits (1487), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 371/1235 (30%), Positives = 621/1235 (50%), Gaps = 55/1235 (4%)

Query: 1    MRLHMGLVAALAPLGDVVRGSHLESVAQHFDIKHWQTPRLDLSAARNERLLVFDDFQAFE 60
            MR    L  ++  L     GSHL+++     ++ +  P LDLS ++N  + +  +F+   
Sbjct: 1    MRATTCLATSVLALAKFCSGSHLDALESKLGVEVYDIPNLDLSKSKNNEVQLLGNFKDIN 60

Query: 61   YYNYKGQQLFTGQ-EQHQGSSLIYYSEGTYVQL---AKLDDDTVVRRIVPFGSDSFILSG 116
               Y GQ+ FTG+   +  ++LIYYS  T++++   +   +   V  IVPF  D+FILSG
Sbjct: 61   ILKYSGQKNFTGEVSGNPENALIYYSNETFLEIYSSSDSSEVFSVDHIVPFKDDAFILSG 120

Query: 117  TGKLQDQRLEHQLMYNLSTLEVTEILPQSLESVNDILVDGDMVYFGGQFTYSDGNKSGHS 176
             G +   +L  QL++NLS+LE  EI  Q L  VN I  +GD V+FGG F Y   N++ HS
Sbjct: 121  AGSISGHQLSRQLLFNLSSLEFREIFGQDLAQVNTITANGDKVFFGGSFEYEMSNQTIHS 180

Query: 177  AVQWNATSRTTSLLPFGGFGRGSSVNNILKLSGSGVLFVGRFSNLEAASYAETASVLAST 236
             + W++      +LPFGGFG+ S+VN+IL L  S +LF G FS ++        +V  ++
Sbjct: 181  LLVWDSIKDGVEVLPFGGFGKNSTVNSILNLDNSNILFAGNFSAVDNTQQLNNINVSNTS 240

Query: 237  EKPQLNVTTIETNALTSLRYSTITSDGHLDKGKFICPTSNDDSWFVPHSGDGPARGELNI 296
                 N +  E     SL+ +   SDG LDK    CP++    W       G  +G+  +
Sbjct: 241  -----NTSVPELGHQISLQSAAWVSDGTLDKSAIKCPSTESTGWLKT----GSTQGQFEL 291

Query: 297  KVLHRIIPSKIRIYNSKKNGNEIKLFRIVTSPSQSIMNMTYIDPNTGELATCDAWCPLMP 356
             +     PSK+R++N++ +  ++ LFRIVT+PS  IMN+TY+DP TGELA+CDAWCPL+ 
Sbjct: 292  YMPEETRPSKLRVFNARDSDEQVSLFRIVTTPSNGIMNLTYLDPTTGELASCDAWCPLLS 351

Query: 357  RSNLTSKAAESGPADVARLVNDEKVLIKWTPDYQEFAFINQIHMEEIKFIALDSYGNNVG 416
              NLT  +++S P D  +   + +  ++W+  +Q+FAF+N + + ++ FIALDSYG++VG
Sbjct: 352  SQNLTDISSKSYPGDQVQYF-ENRTTLQWSESFQDFAFVNNVPVSDLTFIALDSYGSSVG 410

Query: 417  LVGVELFQTEYDAYVNSTLNQPNC--GEQQLSPFSTTANIWHQGATDASYLSANV--VES 472
            L G+EL+++ Y  Y N+TLN PNC  G    +   + ++ W  G+++ +YLS +V   E+
Sbjct: 411  LAGIELYESAYSVYANNTLNAPNCAQGSATSNALLSNSSAWDSGSSEGNYLSTSVQDSET 470

Query: 473  NPMVNVKPVIPHSGTYTLNLYTPGCEDDGTCDYRGIVNVTLL-ASNGTTLMTRWIYQNNY 531
            NP V   P I + G YT+++ TPGC +D +C  RGI+N T+    N T L +  IYQNN 
Sbjct: 471  NPFVIFYPSIIYPGVYTIDVLTPGCLEDSSCQTRGIINATIRDVQNNTLLDSIEIYQNND 530

Query: 532  RLKYDPLYTGHLDPNPTVRMEWVSPINSAVNRKIMVADRVSAIIDSLDGLDDIRHPREKS 591
              K+D LY+G LD    V +E+   INS     +MVA ++   I+  D      +     
Sbjct: 531  YEKFDTLYSGFLDSEVKVTLEFDGAINSGTEVPVMVASKIVVNIEDFDQ-SVFENNTSGF 589

Query: 592  LNGLFQYTPAG-SSLDNGIQKYINKD----PQTDMPEGVSLVGQVYDGKLILGVKSTGHI 646
            +NGL  Y+ +  SS  + +  Y   D      + +P+  ++   +++  L+L   + G +
Sbjct: 590  INGLLHYSTSNTSSFLSELGSYSATDLAHYSVSKLPKHSNIFANMFEDDLVL-FTTDGEM 648

Query: 647  AVVTPKGTDWNDVDVTRQDVPGSLNGISPYSKGLVFTGKFNLSSGPSSALHYDGNFGSFF 706
            A +     + +  + T + +   ++ IS YS GL+  G FN SS P +A  ++G F +  
Sbjct: 649  ARL-KLANNLSIEEYTFETIGKDISTISEYSGGLIIVGTFNGSSEP-AARGFNGTFFNLT 706

Query: 707  DLNSETSSIINMTIDGSELLLFNNKFIYNTSTSQML-TSSMFQXXXXXXXXXXXXXXXFT 765
            + NS   +  N+T+  +E+L+F+   I N +T + +  +S                  F 
Sbjct: 707  EFNSTVRTFSNLTLGQTEMLIFDKNIILNGTTGEKIYDTSKLTLEVASAGRNPYNDTLFQ 766

Query: 766  GSIADIKHGSAHGAVALDAEGNIFTSGTPSISGARVHRGVYLNDTATAYAYYSVSPNSSV 825
            G +    + + +G+  +       +    ++ G   +   +++++ TAYAYY+   N+S 
Sbjct: 767  GYVLQNDYTNLNGSFFISTNSEEVSQNFWALGGKLPYDAAFVDNSTTAYAYYN-PDNTSN 825

Query: 826  ATGGVVIETPGNNFNLSNNIATVREMIYVKKTNFLVISTNEVEGTPGALILYDLRTLQEV 885
            + G  V+   G+   LS     V  M   K  + L I   + + T   L++ +  + + +
Sbjct: 826  SFGVSVMNDSGSTVQLSAWSGKVGAMASSKNDSLLAIGGKD-QHTDSQLLVTNSSSGESL 884

Query: 886  AREKLNPGERINSIVLFGEDNTLLVGGSFEKDG--CHDLCLYNFVKRSWSAFASGLISGE 943
            A  K +    +NSI+ F  +N++LVGGSF  +   C  LCL+N+  + WS F +  I G 
Sbjct: 885  ASYKWDSEISLNSIIFFARNNSVLVGGSFRVNNTQCSGLCLFNYQDKKWSPFLNNSIRGV 944

Query: 944  IKQLQFVNNRNLIAVGSMTVQSRPNILFLNFDLVRSRVVEQHEQPNGRAFNSVLTIGDSG 1003
            I +++  NN NL+  GS  +     +   +  L  S     HE       N  +++  S 
Sbjct: 945  INRMEIFNNSNLLIAGSFRLNETDGVSLASICLKDSSSEILHE--GNITLNGFVSMDGSS 1002

Query: 1004 DEYVAEDGKQVWHYSGSEWKTVTPLSGGQIRIDGISLLMLNNPRSQNKRNRVGNELVVIH 1063
            +  VA     +      +W+ ++       +  G+ +  L +   + KR+   +++++I 
Sbjct: 1003 NNVVAFSDTSLLQLESGKWQQISTNFTENSKFKGLDVFPLKDTTRKQKRDS-SSKVLLIT 1061

Query: 1064 GQMNSSEYGEINAMHYNFENWEPYYFTIGSSAREEFNVPRGQIFLNQDIS---------- 1113
            G +  +++G INA  Y+   W P  F   + A    ++    +FLN+D+S          
Sbjct: 1062 GSLQHAKFGSINAAFYDSGEWTP--FLSSNQATSSSDLETSHVFLNRDLSDFLDYKGYLQ 1119

Query: 1114 ------RQTTTSLPLEVVVSDSPPTAEPKRKLAKGYXXXXXXXXXXXXXXXXXXXXXXXX 1167
                    + TS       S        K+K+ +G+                        
Sbjct: 1120 GTFSSNTSSGTSGTPSPSGSSPSNLQRKKKKIDRGFIVLISLALALGTLAVLGLLGVIFS 1179

Query: 1168 YAFGDH-NAYQPLKPRINEDEMLKTVPPEKLMKFI 1201
            Y FGD  + YQ  KPR +E+EM+ TVPPEKLM+FI
Sbjct: 1180 YFFGDSGDGYQLSKPRTDENEMIDTVPPEKLMRFI 1214

>Kpol_392.10 s392 (27006..30686) [3681 bp, 1226 aa] {ON}
            (27006..30686) [3681 nt, 1227 aa]
          Length = 1226

 Score =  573 bits (1476), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 412/1266 (32%), Positives = 633/1266 (50%), Gaps = 110/1266 (8%)

Query: 5    MGLVAALAPLG--DVVRGSHLESVAQHFDIKHWQTPRLDLSAARNERLLVFDDFQAFEYY 62
            +  +  L  LG   V + S L +V     I     P+++     NE + +  + +   +Y
Sbjct: 2    LATIVRLISLGIIGVSQASQLTNVKDSLGINTVNIPQINFGNTNNE-IQILSNIEGLTFY 60

Query: 63   NYKGQQLFTGQEQHQGSS--LIYYSEGTYVQLAKLDDDTVVRRIVPFGSDSFILSGTGKL 120
             Y+GQQ FTG      ++  LIYYS  T ++L +  D+T + +IVP   D+FILSG+G L
Sbjct: 61   QYQGQQNFTGSIDTNSNTHGLIYYSNDTLIKLLEGSDNTKIDQIVPLDEDAFILSGSGTL 120

Query: 121  QDQRLEHQLMYNLSTLEVTEILPQSLESVNDILVDGDMVYFGGQFTYSDGNKSGHSAVQW 180
               +LE+QL+YNLS L +  +    L+++  ILVD D+VYFGG F+Y+  NK+ +S + W
Sbjct: 121  GGFQLENQLLYNLSDLSIIPLFNNQLQNIKSILVDKDIVYFGGNFSYTSNNKTANSIISW 180

Query: 181  NATSRTTSLLPFGGFGRGSSVNNILKLSGSGVLFVGRFSNLEAASYAE---TASVLASTE 237
            N  ++   +LPF GFG+ S+VN+ILKL    +LF G FS L+  S      T     ++ 
Sbjct: 181  NKVTKNVDMLPFIGFGKNSTVNSILKLDEDNLLFFGDFSTLDDKSLLVSNITTYTQQNST 240

Query: 238  KPQLNVTTIETNALTSLRYSTITSDGHLDKG-KFICPTSNDDSWFVPHSGDGPARGELNI 296
                  T +E     SL+Y++  S G L    +FICP   +++W           GE+  
Sbjct: 241  SSSSTETNLELEQQISLKYASWASLGDLKSSTQFICPNGQNEAW-----SSAGTTGEITC 295

Query: 297  KVLHRIIPSKIRIYNSKKNGNEIKLFRIVTSPSQSIMNMTYIDPNTGELATCDAWCPLMP 356
             +      SKIRI+NS    ++I  FRIVT+PS  IMN+TY+DP T E+  CDA+CPL  
Sbjct: 296  NLAFEASLSKIRIFNSPYEQDQIASFRIVTAPSNGIMNLTYLDPLTSEVKYCDAFCPLYS 355

Query: 357  RSNL-TSKAAESGPADVARLVNDEKVLIKWTPDYQEFAFINQIHMEEIKFIALDSYGNNV 415
             + L  S    +  A  +  +N  K  I W+ DYQEFAF+NQ+ +  ++ IAL SYG+NV
Sbjct: 356  SNALQASSENATTSASTSAFINGNKTNIGWSTDYQEFAFVNQVPVTALQVIALTSYGDNV 415

Query: 416  GLVGVELFQTEYDAYVNSTLNQPNCGE-QQLSPFS-TTANIWHQGATDASYLSANVV--- 470
            GL G +L+Q  Y  + N++LN+P C     + P S  + NIW+QG    SY++       
Sbjct: 416  GLSGFQLYQNSYSIFANNSLNEPACDSPNTVIPSSYLSNNIWYQGLNSQSYIATKYTPGD 475

Query: 471  ESNPMVNVKPVIPHSGTYTLNLYTPGCEDDGTCDYRGIVNVTLLASNGTTLM-TRWIYQN 529
            + +P+VN  P I   G YT+N+YTPGC  DGTC +RGIVNVTL  +    L+ T  IYQN
Sbjct: 476  DPSPLVNFYPSINRIGNYTVNIYTPGCTGDGTCSFRGIVNVTLWDTATNDLISTTLIYQN 535

Query: 530  NYRLKYDPLYTGHLDPNPTVRMEWVSPINSAVNRKIMVADRVSAI---IDSLDGLDDIRH 586
            N  +KYD L+ G LD  P V +E+ S IN   +  ++VAD V  +   I+  + + ++  
Sbjct: 536  NNEMKYDQLFEGFLDYAPKVTLEYYSGINDENSPVVVVADNVDLVPINIELDETIGNVTS 595

Query: 587  PREK---SLNGLFQYTPAGS---------SLDNGIQKYINKDPQTDMPEGVSLVGQVYDG 634
              E+    LNG+FQY  +            +DN     +N  P +     VSL G  Y+ 
Sbjct: 596  STEELKVPLNGMFQYQLSNFTSSNNNSTLKVDN---TSLNLFPVSRFSSSVSLYGVEYNE 652

Query: 635  KLILGVKSTGHIA-VVTPKGTDWNDVDVTR-QDVPGSLNGISPYSKGLVFTGKFNLSSGP 692
             L+LG    G IA V     +++ ++  TR  +  G + G   Y+ G+V  G FN+S+  
Sbjct: 653  TLLLG----GSIAGVYALSLSNYTNIRSTRIVETGGEVTGTGAYAGGVVLFGNFNISNRI 708

Query: 693  SSALHYDGNFGSFFDLNSETSSIINMTIDGSELLLFNNKFIYNTSTSQ-MLTSSMFQXXX 751
             S+L Y+G F SF ++NS  ++  N+T   SE+L FNN++ +NTSTS  +  +S      
Sbjct: 709  VSSLSYNGTFDSFGNVNSNIATFSNLTFGESEILAFNNEYFFNTSTSSYIFNTSALSLSI 768

Query: 752  XXXXXXXXXXXXFTGSIADIKHGSAHGAVALDAEGNIFTSGTPSI-SGARVHRGVYLNDT 810
                        F+G I   +  + + +  L   G   T+ +  + +G + + GVYLND+
Sbjct: 769  WSAGSNDFGDTLFSGLITRNEFPNLNNSAVLTGNG---TAQSLQLRNGIQPYLGVYLNDS 825

Query: 811  ATAYAYYSVSPNSSVATGGVVIETPGNNFNLSNNIATVREMIYVKKTNFLVISTNEVEGT 870
             TAY Y S S ++ + + G+       N+NL  ++++     Y      + + ++   G 
Sbjct: 826  LTAYLYDSSSNSNILFSNGL-----QGNWNLPRSVSSA----YYSDNETMFVGSSLSNGD 876

Query: 871  PGA-LILYDLRTLQEVAREKLNPGERINSIVLFGEDNTLLVGGSFE--KDGCHDLCLYNF 927
             GA L + +  T+  +  E  +    INSIV FG +++LLVGG F      C +LCL N 
Sbjct: 877  SGAELFVLNFTTMDLLYNETFDVNSSINSIVSFGRNSSLLVGGDFTAPNTNCSNLCLLNL 936

Query: 928  VKRSWSAFASGLISGEIKQLQFVNNRNLIAVGSMTVQSRPNILFLNFDLVRSRVVEQHEQ 987
                WS+F++    G I  L+F N+  L+  GS   +++  I     DL           
Sbjct: 937  GNNQWSSFSNKF-DGTITGLEFANDSRLLISGSYRFENQSGISLGYIDL----------- 984

Query: 988  PNGRAFNSVLTIGDSGDEY-------VAEDGKQVWHYSGSEWKT-VTPLSGGQIRIDGIS 1039
             N + F S+L+     + +       VA D   ++ Y G  W     P +     I  + 
Sbjct: 985  -NNQEFKSLLSDSQKVNSFNYNNGTIVAWDSSTIYSYRGDSWSNHQIPNTNSSTSIKNVQ 1043

Query: 1040 LL--MLNNPRSQNKRNRVGNELVVIHGQMNSSEYGEINAMHYNFENWEPYYFTIGSSARE 1097
            ++  + N+  + N  N + +EL+++ G++ S +YG + AM Y+F+NW PYY T       
Sbjct: 1044 IVSKLNNSLSTNNTSNNLNDELILVFGELYSEDYGFVQAMFYDFQNWIPYYIT---QPYS 1100

Query: 1098 EFNVPRGQIFLNQDISRQTTTSLPLE---------------------VVVSDSPPTAEPK 1136
              N  +  +F+N+DIS    + + L+                        S S      +
Sbjct: 1101 SLNTSKNSLFMNKDISLLYESQVVLQNPNSTISISSTSSSSATTRSSSTSSTSLKNGNIE 1160

Query: 1137 RKLAKGYXXXXXXXXXXXXXXXXXXXXXXXXYAFGDHNA-YQPLKPRINEDEMLKTVPPE 1195
             K+ +GY                        Y F D    Y  +KPRI+E EML TVPPE
Sbjct: 1161 SKIHRGYVVLIGLALAIGTVAILGIFGVTMAYIFSDDKGEYVRIKPRIDEHEMLDTVPPE 1220

Query: 1196 KLMKFI 1201
            KLMKFI
Sbjct: 1221 KLMKFI 1226

>Kwal_56.23589 s56 complement(610601..614242) [3642 bp, 1213 aa] {ON}
            YLR084C (RAX2) - YLR084C [contig 176] FULL
          Length = 1213

 Score =  527 bits (1358), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 369/1235 (29%), Positives = 608/1235 (49%), Gaps = 68/1235 (5%)

Query: 7    LVAALAPLGDVVRGSHLESVAQHFDIKHWQTPRLDLSAARNERLLVFDDFQAFEYYNYKG 66
            L  +   +  +  G+HL ++     +K+++ P LDLS + NE + +  +FQ   YY Y G
Sbjct: 7    LATSFLVVAKLCSGTHLNTIESALGVKNFEVPSLDLSGSNNEEIQLLGNFQNLNYYRYTG 66

Query: 67   QQLFTG-QEQHQGSSLIYYSEGTYVQLAK---LDDDTVVRRIVPFGSDSFILSGTGKLQD 122
            Q  FTG  ++    SLIY+S GT ++L+     ++   V  ++P   DSFILSGTG +  
Sbjct: 67   QDNFTGISDEKARESLIYHSNGTLLELSSPQYSNESFSVDHVIPLRDDSFILSGTGAISG 126

Query: 123  QRLEHQLMYNLSTLEVTEILPQSLESVNDILVDGDMVYFGGQFTYSDGNKSGHSAVQWNA 182
              L+HQ+++NLS L  T I  QSL  VN I V+G+  YFGG F +   ++  H  + W+ 
Sbjct: 127  AVLDHQVVFNLSDLSYTAIFNQSLSPVNAITVNGNKAYFGGSFKFKGPDQDTHGLIVWDF 186

Query: 183  TSRTTSLLPFGGFGRGSSVNNILKLSGSGVLFVGRFSNLEAASYAETASVLASTEKPQLN 242
                   LPFGG G+ S+VN+IL L  + +LF G FS ++  S   +   + ST      
Sbjct: 187  VKNEVETLPFGGLGKDSNVNSILVLDDNNILFAGNFSTIDEKSALNSTLGINSTSD---- 242

Query: 243  VTTIETNALTSLRYSTITSDGHLDKGKFICPTSNDDSWFVPHSGDGPARGELNIKVLHRI 302
             +  E +    L+ +  TSDG L K   +CP+++  S ++   G G   G+  + + H I
Sbjct: 243  -SAPELSHKIPLKTAKWTSDGSLQKDDLVCPSNSATSAWL---GTGTT-GQFELSIAHTI 297

Query: 303  IPSKIRIYNSKKNGNEIKLFRIVTSPSQSIMNMTYIDPNTGELATCDAWCPLMPRSNLTS 362
             PSK+R++N++    E+ LFR++T+PS  IMN+TY+DP++GEL TCDAWCPL+   NLT+
Sbjct: 298  RPSKLRLHNARTLDEEVSLFRVITTPSNGIMNLTYLDPSSGELRTCDAWCPLLSTQNLTA 357

Query: 363  KAAESGPADVARLVNDEKVLIKWTPDYQEFAFINQIHMEEIKFIALDSYGNNVGLVGVEL 422
              +++   D    +N++   ++W+  YQ+FAF+N + +  I F+ALDSYG++VG+ G EL
Sbjct: 358  AKSKAASTDQVEFLNNQTT-VQWSESYQDFAFVNSVPVTSITFMALDSYGSSVGVNGFEL 416

Query: 423  FQTEYDAYVNSTLNQPNCGE-QQLSPFSTTANIWHQGATDASYLSANVVESN--PMVNVK 479
            ++ ++  Y N + N P+C      S  S +A+ W QG++D  Y+   V  S   P V   
Sbjct: 417  YEDDFSVYANDSFNVPDCSSTSNYSKASLSASQWDQGSSDEDYVYTLVENSQEAPSVTFY 476

Query: 480  PVIPHSGTYTLNLYTPGCEDDGTCDYRGIVNVTLLAS-NGTTLMTRWIYQNNYRLKYDPL 538
            P I +SG YT+N+ TPGC  DG+C  R +VN +L  S NGT L +  IYQNN   KYD L
Sbjct: 477  PQIVYSGLYTINVLTPGCLADGSCQSRSVVNASLWDSNNGTLLSSITIYQNNDYEKYDNL 536

Query: 539  YTGHLDPNPTVRMEWVSPINSAVNRKIMVADRVSAIIDSLDGLDDIRHPREKSLNGLFQY 598
            Y+G+L+    V +E+   I +     +MVA ++S   D  D        +   LNGL  Y
Sbjct: 537  YSGYLENEVKVVLEYEGAIGNTEGSPMMVAGQISVNTDEFDSSVFTDKYKTGKLNGLLHY 596

Query: 599  TPAGSSLDNGIQKYINKDPQTDMPE-GVSLVGQ---VYDGKL---ILGVKSTGHIAVVTP 651
            + + SS      +    +  TD+ +  VS   +    +  K    I+   S+G ++ +  
Sbjct: 597  SLSNSSS---YLQNFKSNNSTDLAQYSVSNFAKNSNFFVDKFKNYIMLFASSGKVSKLEI 653

Query: 652  KGTDWNDVDVTRQDVPGSLNGISPYSKGLVFTGKFNLSSGPSSALHYDGNFGSFFDL--- 708
                ++   VT ++V   ++G+  +S+GL   G F+ S+    A  Y+   GSFFD+   
Sbjct: 654  D-QQFDVRTVTTEEVGDEVSGVFAFSEGLGVIGTFDGST--KGAKFYN---GSFFDIPLS 707

Query: 709  NSETSSIINMTIDGSELLLFNNKFIYNTSTSQML-TSSMFQXXXXXXXXXXXXXXXFTGS 767
            +S  ++  N T+DG+EL+   N +  NT+T  +   SS                  F GS
Sbjct: 708  HSNVTTFTNFTLDGAELVSLGNYYAINTTTDTLFRNSSKMTLTARSAGLNNLGETVFYGS 767

Query: 768  IADIKHGSAHGAVALDAEGNIFTSGTPSISGARVHRGVYLNDTATAYAYYSVSPNSSVAT 827
            +   ++   +G+  + +     +    S  G   +   Y++++ T YA+Y   P+S+  +
Sbjct: 768  LTRNEYTDLNGSFFISSNSQSSSRLRGS-QGRIWYDATYIDNSTTGYAFY--DPSSTNGS 824

Query: 828  GGVVI-ETPGNNFNLSNNIAT-VREMIYVKKTNFLVISTNEVEGTPGALILYDLRTLQEV 885
             GV I +      +LS      V  M+Y K ++ L +       +P  L+L +L T ++ 
Sbjct: 825  YGVSIYKDMAKERDLSYRWTNMVGSMLYSKNSSLLALGMKNETRSP-QLLLTNLTTGEDT 883

Query: 886  AREKLNPGERINSIVLFGEDNTLLVGGSF--EKDGCHDLCLYNFVKRSWSAFASGLISGE 943
            A  +      INS++ F ++ ++LVGG F   +  C  LCL+++ ++ WS F   +I+G 
Sbjct: 884  ATFEWKTNVSINSLIFFDQNTSVLVGGDFNESESNCSGLCLFDYERKHWSPFFDNMINGS 943

Query: 944  IKQLQFVNNRNLIAVGSMTVQSRPNILFLNFDLVRSRVVEQHEQPNGRAFNSVLTIGDSG 1003
            I  ++  N  +L+  G   +     +   +  L        H+          + +    
Sbjct: 944  IHSMKIFNKSSLVLGGFFDINDTKQVNLASMSLTDGSYNILHQGT--ETILDFIFVDGKV 1001

Query: 1004 DEYVAEDGKQVWHYSGSEWKTVTPLSGGQIRIDGISLLMLNNPRSQNKRNRVGNELVVIH 1063
            D  VA     ++  + + W++++          G+S   +       KR    N L +I 
Sbjct: 1002 DNLVAVSANDLFRLTNNNWESISAQFDDSSVFGGLSEFPIQQGGQNKKREEEKNSL-LIT 1060

Query: 1064 GQMNSSEYGEINAMHYNFENWEPYYFTIGSSAREEFNVPRGQIFLNQDISRQTTTSLPLE 1123
            G +    YG+I+A  Y+F +W PY+ T  +++ +     R  I+ N+DIS        L+
Sbjct: 1061 GDLLHKTYGKISAALYDFNDWIPYFSTTPATSTDGLGQSR--IYSNKDISSAFNYQGVLQ 1118

Query: 1124 ----------------VVVSDSPPTAEPKRKLAKGYXXXXXXXXXXXXXXXXXXXXXXXX 1167
                               S        K K+A+G+                        
Sbjct: 1119 SSRGGNSSSVPSGTSSPTSSSPSQLGAKKNKIARGFVVLIGLALAMGTLAVMGVIGIALT 1178

Query: 1168 YAFG-DHNAYQPLKPRINEDEMLKTVPPEKLMKFI 1201
            + FG   + YQ L+PR +E EM+ TVPPEKLM+FI
Sbjct: 1179 FFFGKSSDKYQSLEPRADESEMIDTVPPEKLMRFI 1213

>KNAG0G02000 Chr7 complement(443631..447239) [3609 bp, 1202 aa] {ON}
            Anc_8.256 YLR084C
          Length = 1202

 Score =  516 bits (1328), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 374/1247 (29%), Positives = 606/1247 (48%), Gaps = 129/1247 (10%)

Query: 17   VVRGSHLESVAQHFDIKHWQTPRLDLSAARNERLLVFDDFQAFEYYNYKGQQLFTGQEQH 76
            + R S+LE+V +  +      P  D+   +N +  + DD     +Y Y GQQ FT     
Sbjct: 15   ITRASNLENVRRILNATEVTVPTFDV-GNKNNQFQILDDINGISFYEYLGQQNFTTDANV 73

Query: 77   QG-SSLIYYSEGTYVQLA-KLDDDTVVRRIVPFGSDSFILSGTGKLQDQRLEHQLMYNLS 134
                 LIYYS  T++ L+  +  +  ++ I+P G DSFILSG G + +  L  QL++N++
Sbjct: 74   TDVQRLIYYSNETFMSLSDSIAAEAQIQGIIPLGDDSFILSGQGMINNVSLASQLVFNMT 133

Query: 135  TLEVTEILPQSLESVNDILVDGDMVYFGGQFTYSDGNKSGHSAVQWNATSRTTSLLPFGG 194
             L +T+I    L S+  + VDG +VYF G FT++  N +G  A+ W++  R+ +LLPF G
Sbjct: 134  DLSITKIFDTPLRSIEGVTVDGPLVYFMGNFTFN--NNTG--AIMWDSRDRSINLLPFHG 189

Query: 195  FGRGSSVNNILKLSGSGVLFVGRFSNLEAASYAETASVLASTEKPQLNVTTIETNALTSL 254
            FG  +++N+ILKL+   +LF G FS +  +S    ++V   +E+   N T++  N    L
Sbjct: 190  FGPYANINSILKLNDDNILFAGHFSTVWNSSLLLQSNV---SEESVRNTTSLLLNPSVPL 246

Query: 255  RYSTITSDGHLDKGKFICPTSNDDSWFVPHSGDGPARGELNIKVLHRIIPSKIRIYNSKK 314
            +YS   ++G LD  + ICP  + DSW V         G+   ++  +I PSKIRIYNS  
Sbjct: 247  QYSQWKTNGELDSSQLICPDPSKDSWSV-----SATTGDFTCELPFQITPSKIRIYNSPD 301

Query: 315  NGNEIKLFRIVTSPSQSIMNMTYIDPNTGELATCDAWCPLMPRSNLTSKAAESGPADVAR 374
              +++ LFR +T P+ SIMN+TY+DP +G + +CDA+CPL  ++ L S+   +  A+   
Sbjct: 302  KDSQVSLFRFLTYPAGSIMNLTYLDPLSGNMTSCDAFCPLYSKTVLQSQWDNTAEANTVA 361

Query: 375  LVNDEKVLIKWTPDYQEFAFINQIHMEEIKFIALDSYGNNVGLVGVELFQTEYDAYVNST 434
            ++N+    I+WTP+YQEFA ++ +    ++F AL SYGNN+GL G +++Q  + A+ N++
Sbjct: 362  IINNNSTNIQWTPNYQEFALVSPVAATSLEFNALASYGNNLGLAGFQIYQASFSAFGNNS 421

Query: 435  LNQPNCGEQQ------LSPFSTTANIWHQGATDASYLSANVVESN---PMVNVKPVIPHS 485
             N PNC           +  S + N W    +   YL+     +    P V  K  I HS
Sbjct: 422  FNTPNCNNNDKDSNNTFTSSSLSPNNW---TSVGEYLTVGYTPNENPVPKVTYKIDIQHS 478

Query: 486  GTYTLNLYTPGCEDDGTCDYRGIVNVTLLAS-NGTTLMTRWIYQNNYRLKYDPLYTGHLD 544
            G Y++N++TPGC  D TC  RGIVN TL  +     L T  IYQNN  +KYD LY+G L+
Sbjct: 479  GEYSINVFTPGCSADNTCSTRGIVNYTLFDTVTNKMLATSLIYQNNDEIKYDTLYSGQLN 538

Query: 545  PNPTVRMEWVSPINSAVNRKIMVADRVSAIIDSLDGLDDIRHPREKS---LNGLFQYTPA 601
             +  + M + S + ++     +VADRV   I S+D    + H  E S   LNGLFQY  +
Sbjct: 539  SSCEITMTYYSGLYASNTVTTIVADRVDLNIISMD----LSHRTEVSKLALNGLFQYQIS 594

Query: 602  GSSLDNGIQKY----INKDPQTDMPEGVSLVGQVYDGKLILGVKSTGHIAVVTPKGTDWN 657
              + D+   K     +N+    +    VSL         IL   + G++  +    TD +
Sbjct: 595  NFTNDSIPMKIANTSLNQFALNNFEPSVSLRAFPLSNSSILLSGTEGNMFSIN-LNTDLS 653

Query: 658  DVDVTRQDVPGSLNGISPYSKGLV-FTGKFNLSSGPSSALHYDG--NFGSFFDLNSETSS 714
              + TR     +     PYS GLV   G+ N+S      L  D   N  +  D  S  + 
Sbjct: 654  VQNSTRLISTENFTTFQPYSNGLVMLDGQGNVS------LFKDNFKNLNTTMD-GSLATD 706

Query: 715  IINMTIDGSELLLFNNKFIYNTSTSQML--TSSMFQXXXXXXXXXXXXXXXFTGSIADIK 772
            + N+T++G ELL+FNN +IYN ++ Q     SS+F                F G +   +
Sbjct: 707  VANITLNGDELLVFNNGYIYNVTSQQQTRSNSSIFNLTVSSAGANSINDTIFLGKVVQWQ 766

Query: 773  HGSAHGAVALDAEGNIFTSGTPSISGARVHRGVYLNDTATAYAYYSVSP------NSSVA 826
            +  A+ +  ++A+ N         S     RG++LND +T Y Y   +       NS+  
Sbjct: 767  YAIANQSAQVNADFNDGIEQMSLPSNTVPSRGIFLNDDSTGYFYKESNKSKLYITNSNST 826

Query: 827  TGGVVIETPGNNFNLSNNIATVREMIYVKKTNFLVISTNEVEGTPGALILYDLRTLQEVA 886
            +G      P               ++Y K    L++           L L +L +   + 
Sbjct: 827  SGLEWYGEP-------------ETVVYDKNDTLLMVGYYNDNTFSSTLSLTNLTSFDVIK 873

Query: 887  REKLNPGERINSIVLFGEDNTLLVGGSFEKDG--CHDLCLYNFVKRSWSAFASGLISGEI 944
             E LN G  I+S++ F +++TLLV G FE     C DLCLYN+    W + A+  +SG +
Sbjct: 874  EENLNVGSSISSLLYFAKNDTLLVAGDFEPSNGNCSDLCLYNYKSGQWDSLANNSVSGSV 933

Query: 945  KQLQFVNNRNLIAVGSMTV--QSRPNILFLNF--DLVRSRVVEQHEQPNGRAFNSVLTIG 1000
              LQ   N  ++ +G++T+   +  N+ F+N   + V S ++++    N    +S++   
Sbjct: 934  AALQLYQNDTILVLGNLTLPQANDVNMAFVNLSNNHVGSLIMKKDAPVN---LHSMIV-- 988

Query: 1001 DSGDEYVAEDGKQVWHYSGSEWKTVTPLSGGQIRIDGISLLMLNNPRSQNKRNRVGNELV 1060
             S    VA +   ++ + G+ W  V+ + G       IS +   +    +       + +
Sbjct: 989  -SNSRIVAWNDTVLFSFDGNSWTRVS-VPGTDSSATSISSVQFISMEGTD-------DAL 1039

Query: 1061 VIHGQMNSSEYGEINAMHYNFENWEPYYFTIGSSAREEFNVPR---GQIFLNQDISRQTT 1117
            ++ G+   SE+G+I ++ YNF +W PY   +          PR   G +F+N+DIS    
Sbjct: 1040 LLLGEFRHSEFGDIKSIVYNFRDWIPYLLYVDG--------PRQGTGHLFMNRDISLHNI 1091

Query: 1118 TSLPL----EVVVSDS----------------PPTA----EPKRKLA-KGYXXXXXXXXX 1152
              +PL     V+ + S                P  +    +P R++  +G+         
Sbjct: 1092 AQIPLLNSTRVLTNQSFASSTSSSVSSTSTTLPKVSTTHSKPGRRIVDRGFVVLIGLALA 1151

Query: 1153 XXXXXXXXXXXXXXXYAFGDH--NAYQPLKPRINEDEMLKTVPPEKL 1197
                           Y F D+  ++YQ L PR++E+ M+ T+PPEKL
Sbjct: 1152 LATVSVMGVAGVLLAYIFRDNVGDSYQTLNPRMDENAMVNTLPPEKL 1198

>TBLA0E04390 Chr5 complement(1115294..1119130) [3837 bp, 1278 aa] {ON}
            Anc_8.256 YLR084C
          Length = 1278

 Score =  501 bits (1290), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 390/1315 (29%), Positives = 637/1315 (48%), Gaps = 156/1315 (11%)

Query: 1    MRLHMG-LVAALAPLGDVVRGSHLESVAQHFDIKHWQTPRLDLSAARNE--RLLVFDDFQ 57
            +R  +G L+ ++AP    V  + L  +    +I++   P+ +L  + N+  +LL  + F 
Sbjct: 5    IRTILGILLLSVAP--SSVVANQLNHLKDILEIENIPAPQFNLQDSTNQSLQLLTSNGFD 62

Query: 58   AFEYYNYKGQQLFT-----GQEQHQGSSLIYYSEGTYVQLAKLDDDTVVRRIVPFGSDSF 112
               + +Y GQQ FT       + H    LIYYS  TY++L  +   T ++ I+P+G D+F
Sbjct: 63   TLNFVHYNGQQNFTQPIISSSQNH----LIYYSNDTYIRLLDIPYSTRIQHIIPYGQDAF 118

Query: 113  ILSGTGKLQDQRLEHQLMYNLSTLEVTEILPQSL-ESVNDILVDGD--MVYFGGQFTY-- 167
            ILSGTG L    L +QL+YNL+ L +T I    L   V  I  D D  +VYFGG F+Y  
Sbjct: 119  ILSGTGSLNGFELSNQLVYNLTDLSLTPIFENKLVPEVRTIFKDPDTNLVYFGGNFSYLL 178

Query: 168  SDGNKSGHSAVQWNATSRTTSLLPFGGFGRGSSVNNILKLSGSGVLFVGRFSNLEAAS-- 225
             D N S +  + W+++S  T    FGGFG  S +NNILKL+ + +LF G+F  L+  S  
Sbjct: 179  PDSNIS-NGLIIWDSSSNDTISYEFGGFGSNSVINNILKLNSNDLLFSGQFYTLDDPSIL 237

Query: 226  ---YAETASVLASTEKPQLNVTTIETNA---LTSLRYSTITSDGHLDKGKFICPTSNDDS 279
               Y  T     S+   Q NV+T E N    LT  ++ST  ++ +++K + ICPTS  ++
Sbjct: 238  HIPYNITFPNNTSSLLSQQNVSTFELNQRIPLTFGKFSTADTNDYINKNQLICPTSEIEA 297

Query: 280  WFVPHSGDGPARGELNIKVLHRIIPSKIRIYNSKKNGNEIKLFRIVTSPSQSIMNMTYID 339
            W    + D  A G L I +   I PSKIRI+NS    +E+  FRI      SIM++ Y+D
Sbjct: 298  W----ASDSKA-GSLQITLPFSIRPSKIRIFNSPDPDDEVATFRINPGNQNSIMSLAYLD 352

Query: 340  PNTGELATCDAWCPLMPRSNLT-SKAAESGPADVARLVNDEKVLIKWTPDYQEFAFINQI 398
            P  G+L  C  +CPL  R+ L    + ++  + V  L+++    IKW+  YQEFAF+NQ 
Sbjct: 353  PLDGQLKYCSEFCPLYNRNQLKLFNSNDNLKSHVITLLDNNTTDIKWSTTYQEFAFVNQF 412

Query: 399  HMEEIKFIALDSYGNNVGLVGVELFQTEYDAYVNSTLNQPNCGEQQL------------- 445
             +  ++F AL SYG+ VGL G+ LFQ++   + N + N+P+C +Q               
Sbjct: 413  DLTTLEFQALSSYGSRVGLSGLSLFQSDIAVFANESYNKPSCNDQTAYDNEDLIKAALPR 472

Query: 446  ---SPFSTTA-NIWHQGATDASYLSANVVESN---PMVNVKPVIPHSGTYTLNLYTPGCE 498
               S +S  + N W+    ++ YL+   + S+   P V   P + ++G YT+++ TPGC 
Sbjct: 473  VMGSSYSILSDNDWYTPLPNSDYLACTYLSSSKLIPTVTFYPNLLYAGNYTVDMITPGCT 532

Query: 499  DDGTCDYRGIVNVTLL-ASNGTTLMTRWIYQNNYRLKYDPLYTGHLDPNPTVRMEWVSPI 557
             D +CD RGIVNVT+   ++ + L T  IYQ N   K+D ++ G+LDP   + M + S +
Sbjct: 533  ADNSCDSRGIVNVTMWNQTDSSILQTSLIYQTNENYKFDQIFNGYLDPLVKITMSFYSGV 592

Query: 558  NSAVNRKIMVADRVSAIIDSLDGLDDIRHPR----EKSLNGLFQYTPAGSSLDNGIQKY- 612
             S      +VADR++ II+SLD +             +LNGLFQY P  +S++N  + Y 
Sbjct: 593  YSNTGNFTIVADRINLIINSLDFVTTTSSNEIDIYNVTLNGLFQY-PEYNSVNNLNENYT 651

Query: 613  ---INKDPQTDMPEGVSLVGQVYD-GKLILGVKSTGHIAVVTPKGTDWNDVDVTRQDVPG 668
               IN+   ++ P  VSL+   YD   L++G    G I  +     + N  +++ Q+   
Sbjct: 652  NSTINQYAYSNYPANVSLIAAAYDKDTLLVG----GSINKLQEFQIEKNGQNISLQNTFK 707

Query: 669  SLN---GISPYSKGLVFTGKFNLSSGPSSALHYDGN-FGSFFDLNSETSSIINMTIDGS- 723
             LN   GI PYS GL+  G    SSG   A+ +  N FG+  +   E  S  N+++  S 
Sbjct: 708  DLNSVTGIVPYSDGLIAYGDIMDSSGSYKAITFTNNKFGTLGNFTDEIQSFSNISLTTSW 767

Query: 724  ELLLFNNKFIYNTSTSQ-MLTSSMFQXXXXXXXXXXXXXXXFTGSIADIKHGSAHGAVAL 782
            E+L FNNK+ YN S  +    +S F+               F+G +++ ++ +  G V++
Sbjct: 768  EILSFNNKYFYNQSNMEDFKNTSTFELSLWSAGKNAQNDLIFSGLVSENENVNLTGVVSI 827

Query: 783  DA-----EGNIFTSGTPSISGARVHRGVYLNDTATAYAYYSVSPNSSVATGGVVIETPGN 837
            +A     E N+  +  P       +  V+LND++T YAY  + PN+ +     +I + G 
Sbjct: 828  NANEQIKELNLGNNIYP-------YSAVFLNDSSTIYAY--MEPNTRL---NRLIHSNGE 875

Query: 838  NFNLS--NNIATVREMIYVKKTNFLVISTNEVEGTPGALILYDLRTLQEVAREKLNPGER 895
              + S  N I++   M +    + L + T   +    +  + +L + + +A E LN   +
Sbjct: 876  QISWSWKNKISS---MAFFPNESLLSVGTISDKDVFPSFSILNLTSNKVIANETLNKNSQ 932

Query: 896  INSIVLFGEDNTLLVGG--SFEKDGCHDLCLYNFVKRSWSAFASGLISGEIKQLQFVNNR 953
            I+S++ F +++++LVGG  +F    C  LCL+N+  ++WS F +  + G + +L+  NN 
Sbjct: 933  ISSLLYFTKNSSVLVGGNFTFSDYQCSGLCLFNYETKNWSTFMNNTLEGTVSKLELKNNS 992

Query: 954  NLIAVGSMTVQSRPNI--LFLNFDLVRSRVVEQHEQPNGRAFNSVLTIGDSGDEYVAEDG 1011
            N++  G+++     NI    LN +     ++ Q+       F        +G++  A + 
Sbjct: 993  NILISGTLSTNKSANIDLALLNLNTYNVSILLQNTNLTSFEF--------TGNQIAAWNS 1044

Query: 1012 KQVWHYSGSEWKTVTPLSGGQ-IRIDGISLLMLNNPRSQN---KRNRVGNELVVIHGQMN 1067
              ++ Y+   W  +   +G + +++D IS+  + N  S +   KR      ++V  GQ  
Sbjct: 1045 STLFQYNNEAWSQILLPNGTESLKLDSISIFDITNKNSSSILEKRALRDTNIMVATGQFY 1104

Query: 1068 SSEYGEINAMHYNFENWEPYYFTIGSSAREEFNVPRGQIFLNQDISRQ------------ 1115
            S   G + A++Y  + W PY++  G+            IF N+DIS +            
Sbjct: 1105 SKGLGTVQALYYTSDTWIPYFY--GNLTNNMDTSNSINIFPNKDISSKIISDFVLKNWNF 1162

Query: 1116 ----------------------------TTTSLPLEVVVSDSPPTAEPKRKLAKGYXXXX 1147
                                        TT+  P   ++         K K+ +G+    
Sbjct: 1163 NLSDVGNSTNTTNSTNTTSTTNLTSPSNTTSPQPSSSIIPIIGKQQNKKHKIQRGFVVLI 1222

Query: 1148 XXXXXXXXXXXXXXXXXXXXYAFGDHNA-YQPLKPRINEDEMLKTVPPEKLMKFI 1201
                                + F D    Y+ LKPR  E EM   VPPEKLM F+
Sbjct: 1223 GLALSLATVALLGIFGILLSFIFRDSRGDYESLKPRTTEHEMFDAVPPEKLMPFV 1277

>CAGL0L12144g Chr12 complement(1304574..1308044) [3471 bp, 1156 aa]
            {ON} similar to uniprot|Q12465 Saccharomyces cerevisiae
            YLR084c
          Length = 1156

 Score =  454 bits (1169), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 344/1094 (31%), Positives = 528/1094 (48%), Gaps = 107/1094 (9%)

Query: 40   LDLSAARNERLLVFDDFQAFEYYNYKGQQLFTGQEQHQGS-SLIYYSEGTYVQLAKLDDD 98
            L+ S++RN  + +    + F YYNY+GQQ FT     Q    LIYYS  T ++L  +  D
Sbjct: 2    LNFSSSRNNEIQLLGSIETFNYYNYQGQQNFTTASSSQNELELIYYSNNTLLRLDAVPTD 61

Query: 99   TVVRRIVPFGSDSFILSGTGKLQDQRLEHQLMYNLSTLEVTEILPQSLESVNDILVDGDM 158
              +R I+PF  D FILSG G +    L  Q++ NL+ L    I  + L  V  I VD ++
Sbjct: 62   VEMRHIIPFMDDCFILSGIGTISGIELSRQILLNLTQLSYQPIFEKELGMVKSIFVDNEV 121

Query: 159  VYFGGQFTYSDGNKSGHSAVQWNATSRTTSLLPFGGFGRGSSVNNILKLSGSGVLFVGRF 218
            VYFGG  TY++   SG S VQWN+T+ ++SLLPFGGFG  S+VN+I++L  + +LF G+F
Sbjct: 122  VYFGGDITYNNNGVSGRSVVQWNSTTNSSSLLPFGGFGSNSTVNSIIRLENNNLLFTGQF 181

Query: 219  SNLEAASYAETASVLASTEKPQLNVTTIETNALTSLRYSTITSDGHLDKGKFICPTSNDD 278
            + LE  S+    +    T    +++   E     SLR +T  ++ +LD   FICP S+  
Sbjct: 182  AKLENNSFVSKTN---RTRNFSISMEDSEVGQQISLRQATWNANSNLDVDAFICPNSDQQ 238

Query: 279  SWFVPHSGDGPARGELNIKVLHRIIPSKIRIYNSKKNGNEIKLFRIVTSPSQSIMNMTYI 338
            +W+   S      G +     + +  SKIRIYN+    N+I LFR++  P   I+N+TY+
Sbjct: 239  AWYSEGS-----YGVITCNFPNTLTLSKIRIYNTPITDNQISLFRLIAIPGNGILNLTYL 293

Query: 339  DPNTGELATCDAWCPLMPRSNLTSKAAE-SGPADVARLVNDEKVLIKWTPDYQEFAFINQ 397
            DP + ++  C   CPL  R  L +     +  +DV R +N+    IKW   YQEFAF+NQ
Sbjct: 294  DPISHDIKHCTENCPLFTRETLLNAMGNVTQESDVIRFINNNSTNIKWNEYYQEFAFVNQ 353

Query: 398  IHMEEIKFIALDSYGNNVGLVGVELFQTEYDAYVNSTLNQPNCGEQQ--LSPFSTTANIW 455
            + +  ++F+A +SY  NVGL G +++Q  +  + N++ N+PNC       S    + N W
Sbjct: 354  LPITSLQFVASNSYYQNVGLSGFQIYQDSFPIFPNNSFNEPNCPSSNDIASYVKLSGNGW 413

Query: 456  HQGATDASYLSANVVESNPMVNVKPVIPH------SGTYTLNLYTPGCEDDGTCDYRGIV 509
               A D SYL+ + +   P    KP I +       G Y LNL TPGC+ D TC  RGIV
Sbjct: 414  FTVANDNSYLANSYI---PNQGTKPSITYFVGINVPGEYVLNLVTPGCDKDNTCSTRGIV 470

Query: 510  NVTLL-ASNGTTLMTRWIYQNNYRLKYDPLYTGHLDPNPTVRMEWVSPINSAVNRKIMVA 568
            NVT    SNG  L +  IYQNN  LKYD ++ G L+ + +V++E+ S IN+      +V 
Sbjct: 471  NVTTFDNSNGNILGSALIYQNNNNLKYDQIFAGVLNNSISVQVEYYSGINTNTGTATVVV 530

Query: 569  DRVSAIIDSLDG---LDDIRHPREKSLNGLFQYTPAGSSLDNG-----IQKYINKD-PQT 619
              V  +  S+      D I   R   LNG+F+Y+P+  + DNG     I   I  D   +
Sbjct: 531  GVVDVVRVSISSEFISDQIDGDRSLHLNGIFEYSPSNFTFDNGYLTGKIDYTILDDFGVS 590

Query: 620  DMPEGVSLVGQVYDGKLILGVKSTGHIAVVTPKGTDWNDVDVTRQDVPGSLNGISPYSKG 679
            +  +G S+     +  L LG  +     + +  G+    V  T  ++ G +NG+    +G
Sbjct: 591  NFNKGASIFAVDQNQNLYLGSTNGSVYELNSLNGS---SVPSTENNLSGLINGMYSVEEG 647

Query: 680  LVFTGKFNLSSGPSSALHYDGNFGSF--------FDL--NSETSSIINMTIDGSELLLFN 729
            LV  G         S  H    +G+          D+  N    +  N T+ GS LL+F+
Sbjct: 648  LVIFG---------SIAHRGREYGAVILNKSITPLDIVANDSIQASFNSTLFGSNLLVFD 698

Query: 730  NKFIYNTSTSQMLTSSMFQXXXXXXX-XXXXXXXXFTGSIADIKHGSAHGAVALDAEGNI 788
            N  I+N ++  +  ++ ++                  G+I  +  GSA G  +L    N 
Sbjct: 699  NSTIFNMTSFMVFENTSYRNLDLRNAGKNSNDDMLLVGNI--VNKGSAIGNESLLISSNG 756

Query: 789  FTSGTPSISGARVHRGVYLNDTATAYAYYSVSPNSSVATGGVVIETPGNNFNLSNN---- 844
              S         +   +YLNDT   Y         S+++G V      N F LS+     
Sbjct: 757  TYSPFSLSDNDTIEGAIYLNDTKALY---------SLSSGNV------NYFQLSDKQRLP 801

Query: 845  ---IATVREMIYVKKTNFL-VISTNEVEGTPGALILYDLRTLQEVAREKLNPGERINSIV 900
                +TV  + Y      L  I  N        ++L DL + Q +         +IN+IV
Sbjct: 802  WTWQSTVVPVFYSNGQQLLGAIQENS---NKSQIVLIDLFSSQVINDTGNLTMHKINAIV 858

Query: 901  LFGEDNTLLVGGSF--EKDGCHDLCLYNFVKRSWSAFASGLISGEIKQLQFVNNRNLIAV 958
             F  + T LVGG F      C  LCLYN+   +WS+F +  I+G I Q++F N+  ++  
Sbjct: 859  NFASNATALVGGDFSLSNPACVGLCLYNYNNSNWSSFLNNSITGNISQIKF-NDTQMLLS 917

Query: 959  GSMTVQSRPNILFLNFDLVRSRVVEQHEQPNGRAFNSVLTIGDSGDEYVAEDGKQV-WHY 1017
            G + V    +I  L+ +L  ++      Q      NSV+      D+++      V W+ 
Sbjct: 918  GKLEVNKTADINLLSINLTSNK------QDILLYNNSVVL-----DDFILVRNLVVGWNS 966

Query: 1018 SGSEWKTVTPLSGGQIRIDGISLLMLNNPRSQNKRNRVG---NELVVIHGQMNSSEYGEI 1074
            +    + VT  S   I  DG +  +       N+    G   N  ++I+GQ +S +YG I
Sbjct: 967  TDIFIRNVTQWSNLNIFDDGTNATI-------NRIENFGADSNPALIIYGQFDSMKYGTI 1019

Query: 1075 NAMHYNFENWEPYY 1088
            NA+ Y+F +W PY+
Sbjct: 1020 NAVIYDFNSWYPYF 1033

>CAGL0L08910g Chr12 (973872..975743) [1872 bp, 623 aa] {ON} similar
           to uniprot|Q12089 Saccharomyces cerevisiae YPL005w
          Length = 623

 Score = 36.2 bits (82), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 33/106 (31%), Positives = 50/106 (47%), Gaps = 13/106 (12%)

Query: 901 LFGEDNTLLVGGSFEKDGCHDLCLYNFVKRSWSAFASGLISGEIKQLQFVNN-RNLIAVG 959
           +FGED    V   F      DL L + V+R+WS     L   E+KQL+FVN  + LI   
Sbjct: 352 MFGEDGESFVNLKFVNLLISDLVLDHNVERAWSV----LRYFELKQLKFVNQPKFLINSE 407

Query: 960 SMTV-------QSRPNILFLNFD-LVRSRVVEQHEQPNGRAFNSVL 997
           +M         Q R ++ FL ++  V+  V     +PN   F+ ++
Sbjct: 408 TMNTFLRYFAEQGRIDLCFLTYNYFVKDLVGPNKIRPNVNTFDMLM 453

>Kpol_1049.21 s1049 (53694..64829) [11136 bp, 3711 aa] {ON}
           (53694..64829) [11136 nt, 3712 aa]
          Length = 3711

 Score = 33.1 bits (74), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 31/138 (22%), Positives = 59/138 (42%), Gaps = 20/138 (14%)

Query: 835 PGNNFNLSNNIATVREMIYVKKTNFLVISTNEVEGTPGALILYDLRTLQEVAREKLNPGE 894
           P ++FN S+NI     +I++K T+  ++ST E+E     L   D R  QE+  +  N   
Sbjct: 50  PLSDFNCSSNIFN-SSVIFLKSTDKDIVSTFEIENEKARL---DNRLNQEIENDLSNK-- 103

Query: 895 RINSIVLFGEDNTLLVGGSFEKDGCHDLCLYNFVKRSWSAFASGLISGEIKQLQFVNNRN 954
                         ++  +F  +      +Y+ +   W+     L S   +  +FV + +
Sbjct: 104 --------------IIKRNFNPNDIDTNGIYSIIATEWTGKTPTLYSTGYQVTEFVGSTS 149

Query: 955 LIAVGSMTVQSRPNILFL 972
           +I +  ++V  R    FL
Sbjct: 150 IITLYYLSVPVRTTTTFL 167

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.134    0.392 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 129,386,863
Number of extensions: 5909794
Number of successful extensions: 15233
Number of sequences better than 10.0: 28
Number of HSP's gapped: 15309
Number of HSP's successfully gapped: 30
Length of query: 1201
Length of database: 53,481,399
Length adjustment: 121
Effective length of query: 1080
Effective length of database: 39,606,813
Effective search space: 42775358040
Effective search space used: 42775358040
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 72 (32.3 bits)