Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
AGR094Wna 1ON1381386521e-88
Ecym_4314na 2ON9301345182e-61
SAKL0H17182gna 1ON6851364333e-50
KLLA0F18997gna 1ON4001283681e-42
KLTH0G13816gna 1ON6551343762e-42
Kwal_56.23599na 1ON6481343482e-38
SAKL0G10912g5.277ON337951464e-11
AER235C5.277ON324861412e-10
Ecym_73645.277ON330861384e-10
Kwal_23.55935.277ON3501041147e-07
TDEL0E034905.277ON345871085e-06
KLLA0F21824g5.277ON276971068e-06
KLTH0G06908g5.277ON3611171014e-05
NDAI0D015805.277ON29998981e-04
KAFR0D050205.277ON25794710.31
NCAS0A066405.277ON27068700.50
Ecym_32912.253ON140030626.8
KLLA0E23431g8.543ON76733618.1
NDAI0F014106.254ON63826618.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AGR094W
         (138 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AGR094W Chr7 (913067..913483) [417 bp, 138 aa] {ON} NOHBY739; No...   255   1e-88
Ecym_4314 Chr4 (675795..678587) [2793 bp, 930 aa] {ON} similar t...   204   2e-61
SAKL0H17182g Chr8 (1520135..1522192) [2058 bp, 685 aa] {ON} some...   171   3e-50
KLLA0F18997g Chr6 complement(1747295..1748497) [1203 bp, 400 aa]...   146   1e-42
KLTH0G13816g Chr7 (1194256..1196223) [1968 bp, 655 aa] {ON} cons...   149   2e-42
Kwal_56.23599 s56 complement(615840..617786) [1947 bp, 648 aa] {...   138   2e-38
SAKL0G10912g Chr7 (922534..923547) [1014 bp, 337 aa] {ON} conser...    61   4e-11
AER235C Chr5 complement(1073608..1074582) [975 bp, 324 aa] {ON} ...    59   2e-10
Ecym_7364 Chr7 complement(760757..761749) [993 bp, 330 aa] {ON} ...    58   4e-10
Kwal_23.5593 s23 complement(1230110..1231162) [1053 bp, 350 aa] ...    49   7e-07
TDEL0E03490 Chr5 (652306..653343) [1038 bp, 345 aa] {ON} Anc_5.277     46   5e-06
KLLA0F21824g Chr6 complement(2031719..2032549) [831 bp, 276 aa] ...    45   8e-06
KLTH0G06908g Chr7 (550439..551524) [1086 bp, 361 aa] {ON} conser...    44   4e-05
NDAI0D01580 Chr4 (377632..378531) [900 bp, 299 aa] {ON} Anc_5.277      42   1e-04
KAFR0D05020 Chr4 (987269..988042) [774 bp, 257 aa] {ON} Anc_5.277      32   0.31 
NCAS0A06640 Chr1 (1311768..1312580) [813 bp, 270 aa] {ON} Anc_5....    32   0.50 
Ecym_3291 Chr3 complement(548039..552241) [4203 bp, 1400 aa] {ON...    28   6.8  
KLLA0E23431g Chr5 complement(2084504..2086807) [2304 bp, 767 aa]...    28   8.1  
NDAI0F01410 Chr6 (349389..351305) [1917 bp, 638 aa] {ON} Anc_6.254     28   8.7  

>AGR094W Chr7 (913067..913483) [417 bp, 138 aa] {ON} NOHBY739; No
           homolog in Saccharomyces cerevisiae
          Length = 138

 Score =  255 bits (652), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 126/138 (91%), Positives = 126/138 (91%)

Query: 1   MQYQPPLTADGKNYLVDDEGKFSIIMSNDQDSIYSIYNEFYQSLKLQVEAFVQDFGKSKL 60
           MQYQPPLTADGKNYLVDDEGKFSIIMSNDQDSIYSIYNEFYQSLKLQVEAFVQDFGKSKL
Sbjct: 1   MQYQPPLTADGKNYLVDDEGKFSIIMSNDQDSIYSIYNEFYQSLKLQVEAFVQDFGKSKL 60

Query: 61  VXXXXXXXXXXXXAFVYLVEKIAYFTKLSPEQVLDIADNVRLKEEKSVVWVCNNLGALKC 120
           V            AFVYLVEKIAYFTKLSPEQVLDIADNVRLKEEKSVVWVCNNLGALKC
Sbjct: 61  VQFRKKRTFQKKKAFVYLVEKIAYFTKLSPEQVLDIADNVRLKEEKSVVWVCNNLGALKC 120

Query: 121 ALVKYRPDLHDIIMSDPD 138
           ALVKYRPDLHDIIMSDPD
Sbjct: 121 ALVKYRPDLHDIIMSDPD 138

>Ecym_4314 Chr4 (675795..678587) [2793 bp, 930 aa] {ON} similar to
           Ashbya gossypii AGR093W +AGR094W
          Length = 930

 Score =  204 bits (518), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 96/134 (71%), Positives = 113/134 (84%)

Query: 1   MQYQPPLTADGKNYLVDDEGKFSIIMSNDQDSIYSIYNEFYQSLKLQVEAFVQDFGKSKL 60
           +QYQPPLT++GK Y++ ++GKFSI+MS+DQDSIYSIYNEFYQSLKLQV++FVQD+GKSKL
Sbjct: 793 VQYQPPLTSEGKRYMLGEDGKFSIVMSSDQDSIYSIYNEFYQSLKLQVDSFVQDYGKSKL 852

Query: 61  VXXXXXXXXXXXXAFVYLVEKIAYFTKLSPEQVLDIADNVRLKEEKSVVWVCNNLGALKC 120
                        AFVYLVEKI+YF+KL PEQVLDI D+VR+KE KSVVWVCNNLG+LK 
Sbjct: 853 TQFRKKRTFQKKKAFVYLVEKISYFSKLPPEQVLDIVDDVRIKEGKSVVWVCNNLGSLKY 912

Query: 121 ALVKYRPDLHDIIM 134
           ALVKYRP L DIIM
Sbjct: 913 ALVKYRPKLKDIIM 926

>SAKL0H17182g Chr8 (1520135..1522192) [2058 bp, 685 aa] {ON} some
           similarities with uniprot|Q74ZV5 Ashbya gossypii AGR094W
           AGR094Wp
          Length = 685

 Score =  171 bits (433), Expect = 3e-50,   Method: Composition-based stats.
 Identities = 83/136 (61%), Positives = 99/136 (72%)

Query: 3   YQPPLTADGKNYLVDDEGKFSIIMSNDQDSIYSIYNEFYQSLKLQVEAFVQDFGKSKLVX 62
           Y PP++  GKNYLVD++G+ +I+MSNDQDSIYSIYNEFYQSLK QVE+FV+DFGKS+LV 
Sbjct: 550 YHPPVSITGKNYLVDEDGRLAIVMSNDQDSIYSIYNEFYQSLKPQVESFVKDFGKSRLVQ 609

Query: 63  XXXXXXXXXXXAFVYLVEKIAYFTKLSPEQVLDIADNVRLKEEKSVVWVCNNLGALKCAL 122
                      AFVYL EKIAY   +  E VL I D +R +EEKSVVW CNNL  LK  L
Sbjct: 610 FKKKRTFQKKKAFVYLAEKIAYMQNMPVETVLGIIDQIRHREEKSVVWACNNLNLLKDML 669

Query: 123 VKYRPDLHDIIMSDPD 138
           VK+RPDL D + SD +
Sbjct: 670 VKHRPDLRDTVFSDTE 685

>KLLA0F18997g Chr6 complement(1747295..1748497) [1203 bp, 400 aa]
           {ON} some similarities with uniprot|Q74ZV5 Ashbya
           gossypii AGR094W AGR094Wp
          Length = 400

 Score =  146 bits (368), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 68/128 (53%), Positives = 86/128 (67%)

Query: 2   QYQPPLTADGKNYLVDDEGKFSIIMSNDQDSIYSIYNEFYQSLKLQVEAFVQDFGKSKLV 61
           Q++PPL+ DGKNYLV D+G  SI+M ND DS+YSIYNEF QSLK Q+++FVQD G+SKL 
Sbjct: 271 QFKPPLSEDGKNYLVTDDGSLSIVMKNDLDSVYSIYNEFMQSLKPQIDSFVQDHGRSKLA 330

Query: 62  XXXXXXXXXXXXAFVYLVEKIAYFTKLSPEQVLDIADNVRLKEEKSVVWVCNNLGALKCA 121
                       AF   VE I   T  + E++LDI D +R + + SV+WVCNNL  LK  
Sbjct: 331 KFQKKRTFQKRKAFCSFVETIVNSTSFTSEEILDIIDGIRAQNDHSVIWVCNNLNQLKMD 390

Query: 122 LVKYRPDL 129
           L+K RPDL
Sbjct: 391 LLKQRPDL 398

>KLTH0G13816g Chr7 (1194256..1196223) [1968 bp, 655 aa] {ON}
           conserved hypothetical protein
          Length = 655

 Score =  149 bits (376), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 66/134 (49%), Positives = 90/134 (67%)

Query: 3   YQPPLTADGKNYLVDDEGKFSIIMSNDQDSIYSIYNEFYQSLKLQVEAFVQDFGKSKLVX 62
           YQPP   +GKNYL+D+EG+ +I+M+ +Q S+Y +YNE+YQSL+ QV+++  DFGK  +  
Sbjct: 520 YQPPQAPNGKNYLLDNEGRLAIVMATEQSSVYGVYNEYYQSLRPQVDSYADDFGKKSMGH 579

Query: 63  XXXXXXXXXXXAFVYLVEKIAYFTKLSPEQVLDIADNVRLKEEKSVVWVCNNLGALKCAL 122
                      AFV  VE+I+    + PE VLDI D VRLKE+KSVVW CNNLG  +  L
Sbjct: 580 FRKKRTFQKKKAFVQWVERISQLNNMPPELVLDIVDEVRLKEKKSVVWACNNLGRFRLVL 639

Query: 123 VKYRPDLHDIIMSD 136
            +Y+PDL D  +SD
Sbjct: 640 NRYKPDLKDTALSD 653

>Kwal_56.23599 s56 complement(615840..617786) [1947 bp, 648 aa] {ON}
           [contig 176] FULL
          Length = 648

 Score =  138 bits (348), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 62/134 (46%), Positives = 89/134 (66%)

Query: 3   YQPPLTADGKNYLVDDEGKFSIIMSNDQDSIYSIYNEFYQSLKLQVEAFVQDFGKSKLVX 62
           Y PP   DGK YL+D+EGK +I+M+  Q S+Y +YNE+YQSL+ QV+A+ +D+GK  +  
Sbjct: 513 YHPPQAPDGKRYLLDEEGKLAIVMAPVQSSVYGVYNEYYQSLRPQVDAYAEDYGKKSIGH 572

Query: 63  XXXXXXXXXXXAFVYLVEKIAYFTKLSPEQVLDIADNVRLKEEKSVVWVCNNLGALKCAL 122
                      AFV  VE+++    + PE VLD+ D+VR++E+KSVVW CNNLG+ + AL
Sbjct: 573 FRKKRTFQKKKAFVQWVERLSDLNGIPPELVLDMIDDVRVREKKSVVWACNNLGSCRTAL 632

Query: 123 VKYRPDLHDIIMSD 136
             Y P+L D  +SD
Sbjct: 633 GHYNPELKDRGLSD 646

>SAKL0G10912g Chr7 (922534..923547) [1014 bp, 337 aa] {ON} conserved
           hypothetical protein
          Length = 337

 Score = 60.8 bits (146), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 32/95 (33%), Positives = 51/95 (53%)

Query: 22  FSIIMSNDQDSIYSIYNEFYQSLKLQVEAFVQDFGKSKLVXXXXXXXXXXXXAFVYLVEK 81
           + + M ++  S+  +Y+EF  SLKLQ+  F + FGK +L             A V  ++K
Sbjct: 235 YELQMIDNPKSVAELYDEFDNSLKLQILEFEKKFGKGQLSRIPKIRTYQRRRALVSEIDK 294

Query: 82  IAYFTKLSPEQVLDIADNVRLKEEKSVVWVCNNLG 116
            A FT  S E  +   +N+R ++ K+V W+ NNLG
Sbjct: 295 YARFTNKSTEDAIHFFENIRNEKNKTVAWLYNNLG 329

>AER235C Chr5 complement(1073608..1074582) [975 bp, 324 aa] {ON}
           NOHBY524; No homolog in Saccharomyces cerevisiae'
          Length = 324

 Score = 58.9 bits (141), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 28/86 (32%), Positives = 47/86 (54%)

Query: 33  IYSIYNEFYQSLKLQVEAFVQDFGKSKLVXXXXXXXXXXXXAFVYLVEKIAYFTKLSPEQ 92
           +  +Y EF  SLKLQ+  F + +GK +L             A V  +++ A FT  S E+
Sbjct: 232 VNELYREFDTSLKLQIMEFEKRYGKGQLSRIPKIRTYQRRRALVSEIDRYARFTNKSTEE 291

Query: 93  VLDIADNVRLKEEKSVVWVCNNLGAL 118
            +   D++R+++ K+V W+ NNLG +
Sbjct: 292 AIQFFDDIRMEKNKTVAWLYNNLGKI 317

>Ecym_7364 Chr7 complement(760757..761749) [993 bp, 330 aa] {ON}
           similar to Ashbya gossypii AER235C
          Length = 330

 Score = 57.8 bits (138), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 28/86 (32%), Positives = 46/86 (53%)

Query: 33  IYSIYNEFYQSLKLQVEAFVQDFGKSKLVXXXXXXXXXXXXAFVYLVEKIAYFTKLSPEQ 92
           +  +Y EF  SLKLQ+  F + +GK +L             A V  +++ A FT  S E+
Sbjct: 238 VNELYREFDTSLKLQIMEFEKRYGKGQLSRIPKIRTYQRRRALVSEIDRYARFTNKSTEE 297

Query: 93  VLDIADNVRLKEEKSVVWVCNNLGAL 118
            +   D +R+++ K+V W+ NNLG +
Sbjct: 298 AIQFFDTIRVEKNKTVAWLYNNLGKI 323

>Kwal_23.5593 s23 complement(1230110..1231162) [1053 bp, 350 aa]
           {ON} [contig 11] FULL
          Length = 350

 Score = 48.5 bits (114), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 28/104 (26%), Positives = 52/104 (50%), Gaps = 2/104 (1%)

Query: 14  YLVD--DEGKFSIIMSNDQDSIYSIYNEFYQSLKLQVEAFVQDFGKSKLVXXXXXXXXXX 71
           YL D  D  +F++ MSN   +++++Y+EF  SL  Q+  + + +GK +            
Sbjct: 239 YLKDWVDISEFTLQMSNQPTTVFALYSEFETSLGPQMLEYEKRYGKGQSSRLPRIRTFQR 298

Query: 72  XXAFVYLVEKIAYFTKLSPEQVLDIADNVRLKEEKSVVWVCNNL 115
             A V  ++K +  T    E+ +   + +R +  +SV W+ NNL
Sbjct: 299 RRALVSEIDKFSRRTGRPIEEAIAYFELIRTRNRRSVAWLYNNL 342

>TDEL0E03490 Chr5 (652306..653343) [1038 bp, 345 aa] {ON} Anc_5.277
          Length = 345

 Score = 46.2 bits (108), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 24/87 (27%), Positives = 45/87 (51%)

Query: 32  SIYSIYNEFYQSLKLQVEAFVQDFGKSKLVXXXXXXXXXXXXAFVYLVEKIAYFTKLSPE 91
           S+  +Y+E+  SLK Q+E F + FGK +L             A V  ++K A     +  
Sbjct: 247 SVAEVYHEYENSLKSQIEEFERLFGKGQLSKLPKIRTYQRRRALVTEIDKYATSYNKTTH 306

Query: 92  QVLDIADNVRLKEEKSVVWVCNNLGAL 118
           + ++  + VR+ ++++V  + NNLG +
Sbjct: 307 EAIEFFEKVRIAKKRTVPGLYNNLGKI 333

>KLLA0F21824g Chr6 complement(2031719..2032549) [831 bp, 276 aa]
           {ON} conserved hypothetical protein
          Length = 276

 Score = 45.4 bits (106), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 24/97 (24%), Positives = 47/97 (48%)

Query: 22  FSIIMSNDQDSIYSIYNEFYQSLKLQVEAFVQDFGKSKLVXXXXXXXXXXXXAFVYLVEK 81
           + +IM++   S++ +Y+EFY   KLQ+  F +  G  +L             A V  + K
Sbjct: 172 YHLIMTDCPKSVHDLYHEFYTDTKLQILHFEEKHGAGQLSKLPKLRTYQRRSALVNAINK 231

Query: 82  IAYFTKLSPEQVLDIADNVRLKEEKSVVWVCNNLGAL 118
            A    ++ EQ ++    +  + +K++ W+ NNL  +
Sbjct: 232 YAKGKNITVEQSIEHFQGIVEENDKTIPWLYNNLAKI 268

>KLTH0G06908g Chr7 (550439..551524) [1086 bp, 361 aa] {ON} conserved
           hypothetical protein
          Length = 361

 Score = 43.5 bits (101), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 27/117 (23%), Positives = 53/117 (45%), Gaps = 2/117 (1%)

Query: 4   QPPLTADGKNYLVD--DEGKFSIIMSNDQDSIYSIYNEFYQSLKLQVEAFVQDFGKSKLV 61
           Q P ++    Y  D  D   + + MS +  ++  +Y E+   L+ Q+  F + +GK ++ 
Sbjct: 240 QTPCSSRHLRYAKDAKDISAYVLKMSGNPKTVGDMYYEYEHQLRPQILEFEKRYGKGQIS 299

Query: 62  XXXXXXXXXXXXAFVYLVEKIAYFTKLSPEQVLDIADNVRLKEEKSVVWVCNNLGAL 118
                       A +  +EK A     S E+ +   + +R + +K+V W+ NNL  +
Sbjct: 300 RLPKVRTYQRRRALINEIEKFARREGKSIEEAVQYFEEIRTQNKKTVPWLYNNLNRI 356

>NDAI0D01580 Chr4 (377632..378531) [900 bp, 299 aa] {ON} Anc_5.277
          Length = 299

 Score = 42.4 bits (98), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 26/98 (26%), Positives = 48/98 (48%)

Query: 21  KFSIIMSNDQDSIYSIYNEFYQSLKLQVEAFVQDFGKSKLVXXXXXXXXXXXXAFVYLVE 80
           K  + M+   +SI  ++ E+   L  +V+   + +GK  L             A V  ++
Sbjct: 193 KIQLAMAVKPNSITELFYEYENVLTPKVKDIQKKYGKKCLKQITNIRTLQRRKALVSEIK 252

Query: 81  KIAYFTKLSPEQVLDIADNVRLKEEKSVVWVCNNLGAL 118
           K A   + S ++ L++A+ +RLK  +SV W+ NN+  L
Sbjct: 253 KFAKQNRKSIKETLEVAEYIRLKNNRSVPWLYNNISHL 290

>KAFR0D05020 Chr4 (987269..988042) [774 bp, 257 aa] {ON} Anc_5.277
          Length = 257

 Score = 32.0 bits (71), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 21/94 (22%), Positives = 42/94 (44%)

Query: 22  FSIIMSNDQDSIYSIYNEFYQSLKLQVEAFVQDFGKSKLVXXXXXXXXXXXXAFVYLVEK 81
           F I M  +  +++ +Y +F   +K  V    + +GKS               A V  ++K
Sbjct: 142 FEIPMIENPKTVHELYYDFQNCVKETVRELKEKYGKSYFRKATNIRSYQRRRALVSEIQK 201

Query: 82  IAYFTKLSPEQVLDIADNVRLKEEKSVVWVCNNL 115
           ++    +  E+ L   + +R +  K+V W+ +NL
Sbjct: 202 LSEEYDIDIEEALQCFEELRKENYKTVPWLYSNL 235

>NCAS0A06640 Chr1 (1311768..1312580) [813 bp, 270 aa] {ON} Anc_5.277
          Length = 270

 Score = 31.6 bits (70), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 18/68 (26%), Positives = 30/68 (44%)

Query: 47  QVEAFVQDFGKSKLVXXXXXXXXXXXXAFVYLVEKIAYFTKLSPEQVLDIADNVRLKEEK 106
           Q++   +  GK  L             + V  +  I+    LS E+V++I + +R    K
Sbjct: 190 QLKYLQRSMGKKALRNIAKLRTVQRRKSLVRAIHDISTLYNLSLEEVINIFETIRENGGK 249

Query: 107 SVVWVCNN 114
           SV W+ NN
Sbjct: 250 SVAWMYNN 257

>Ecym_3291 Chr3 complement(548039..552241) [4203 bp, 1400 aa] {ON}
           similar to Ashbya gossypii ADL248C
          Length = 1400

 Score = 28.5 bits (62), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 11/30 (36%), Positives = 19/30 (63%)

Query: 91  EQVLDIADNVRLKEEKSVVWVCNNLGALKC 120
           +++L     V +  E  +V+V NNLG+L+C
Sbjct: 358 QEILSPCGGVEITSELPLVYVLNNLGSLEC 387

>KLLA0E23431g Chr5 complement(2084504..2086807) [2304 bp, 767 aa]
           {ON} uniprot|Q9C4B2 Kluyveromyces lactis KLLA0E23507g
           KlGCR1
          Length = 767

 Score = 28.1 bits (61), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 11/33 (33%), Positives = 21/33 (63%), Gaps = 2/33 (6%)

Query: 26  MSNDQDSIYSIYNEFYQSL--KLQVEAFVQDFG 56
           +S D  +I+ +YNE+Y  L  KL ++  ++ +G
Sbjct: 606 LSRDNKTIWDLYNEWYHGLNGKLSIKELIEKYG 638

>NDAI0F01410 Chr6 (349389..351305) [1917 bp, 638 aa] {ON} Anc_6.254
          Length = 638

 Score = 28.1 bits (61), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 12/26 (46%), Positives = 19/26 (73%)

Query: 11  GKNYLVDDEGKFSIIMSNDQDSIYSI 36
           G + L ++ GKFSII S+ +DS+Y +
Sbjct: 447 GVSELNENSGKFSIIESHTRDSVYRV 472

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.137    0.398 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 14,286,323
Number of extensions: 509157
Number of successful extensions: 1416
Number of sequences better than 10.0: 21
Number of HSP's gapped: 1415
Number of HSP's successfully gapped: 21
Length of query: 138
Length of database: 53,481,399
Length adjustment: 98
Effective length of query: 40
Effective length of database: 42,244,131
Effective search space: 1689765240
Effective search space used: 1689765240
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 59 (27.3 bits)