Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
AGR093Wna 1ON61361323690.0
Ecym_4314na 1ON9302065005e-53
SAKL0H17182gna 2ON6851843133e-29
Kwal_56.23599na 2ON6481941958e-15
KLTH0G13816gna 2ON6552081644e-11
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AGR093W
         (613 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AGR093W Chr7 (911047..912888) [1842 bp, 613 aa] {ON} NOHBY738; N...   917   0.0  
Ecym_4314 Chr4 (675795..678587) [2793 bp, 930 aa] {ON} similar t...   197   5e-53
SAKL0H17182g Chr8 (1520135..1522192) [2058 bp, 685 aa] {ON} some...   125   3e-29
Kwal_56.23599 s56 complement(615840..617786) [1947 bp, 648 aa] {...    80   8e-15
KLTH0G13816g Chr7 (1194256..1196223) [1968 bp, 655 aa] {ON} cons...    68   4e-11

>AGR093W Chr7 (911047..912888) [1842 bp, 613 aa] {ON} NOHBY738; No
           homolog in Saccharomyces cerevisiae
          Length = 613

 Score =  917 bits (2369), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 474/613 (77%), Positives = 474/613 (77%)

Query: 1   MNIASGADERGTSGHIEGRLLVVQQLVRSMLVRLRQQEDLYQLYTATKEQCLSFSQEDPG 60
           MNIASGADERGTSGHIEGRLLVVQQLVRSMLVRLRQQEDLYQLYTATKEQCLSFSQEDPG
Sbjct: 1   MNIASGADERGTSGHIEGRLLVVQQLVRSMLVRLRQQEDLYQLYTATKEQCLSFSQEDPG 60

Query: 61  GGIDVDSMFELLMMRTPELLGLVSLPAMVRFFEWAQXXXXXXXXXXXXXXXPTRCYNFLK 120
           GGIDVDSMFELLMMRTPELLGLVSLPAMVRFFEWAQ               PTRCYNFLK
Sbjct: 61  GGIDVDSMFELLMMRTPELLGLVSLPAMVRFFEWAQRTETIAAETTRAVITPTRCYNFLK 120

Query: 121 EDVGTFAHGAEVVGGVFEALQLLQQLQMIVFREKPMLHDRNDPDSASPMWKPLDSPTTLQ 180
           EDVGTFAHGAEVVGGVFEALQLLQQLQMIVFREKPMLHDRNDPDSASPMWKPLDSPTTLQ
Sbjct: 121 EDVGTFAHGAEVVGGVFEALQLLQQLQMIVFREKPMLHDRNDPDSASPMWKPLDSPTTLQ 180

Query: 181 LLHSLVHDSATGSGKLGGLAHDDTALLSRDMLDRSAAHAHGHYXXXXXXXXXXXXXXXXX 240
           LLHSLVHDSATGSGKLGGLAHDDTALLSRDMLDRSAAHAHGHY                 
Sbjct: 181 LLHSLVHDSATGSGKLGGLAHDDTALLSRDMLDRSAAHAHGHYPQQEPQESQDEEQDASQ 240

Query: 241 LPHSQSLGPESRSSTAPQASHMXXXXXXXXXXXXXXXXXXGDDQKPXXXXXXXXXXXXXX 300
           LPHSQSLGPESRSSTAPQASHM                  GDDQKP              
Sbjct: 241 LPHSQSLGPESRSSTAPQASHMLPQQQHQQHHQEEPQLQPGDDQKPKVQQQVEDRRRDKE 300

Query: 301 XXXXXXXXXXXXXXXXXXXXXXXXXXXLAKRTXXXXXXXXXXXXXXXXXXXXXXKRNRPQ 360
                                      LAKRT                      KRNRPQ
Sbjct: 301 EQEQHQKPQQQQQQKSQKQHSQTSTTPLAKRTPPQPQDHQHQQNQQHQHQHQHQKRNRPQ 360

Query: 361 LHLPLQKSSTSNRQTVPLQQPQSASSTTPVQYYYPNYDSACSSPLFQQSIPDINQRIYHL 420
           LHLPLQKSSTSNRQTVPLQQPQSASSTTPVQYYYPNYDSACSSPLFQQSIPDINQRIYHL
Sbjct: 361 LHLPLQKSSTSNRQTVPLQQPQSASSTTPVQYYYPNYDSACSSPLFQQSIPDINQRIYHL 420

Query: 421 TLENNKLKQQDTVLMQHINSLKQLVSSLQKTVTSMSLAXXXXXXXXXXXXXXRSAATTPI 480
           TLENNKLKQQDTVLMQHINSLKQLVSSLQKTVTSMSLA              RSAATTPI
Sbjct: 421 TLENNKLKQQDTVLMQHINSLKQLVSSLQKTVTSMSLATGTTPVKGKVTKLKRSAATTPI 480

Query: 481 RSTFINESNNSSMTSISGALNYSESNTANAADDELVDPLLENYEPFILKTEQRQQSRSAN 540
           RSTFINESNNSSMTSISGALNYSESNTANAADDELVDPLLENYEPFILKTEQRQQSRSAN
Sbjct: 481 RSTFINESNNSSMTSISGALNYSESNTANAADDELVDPLLENYEPFILKTEQRQQSRSAN 540

Query: 541 HEPXXXXXXXXXXXXFQNDPLFDIPRDDTSSLLSYQTVPVPDSSASYSSMLARPVGASVD 600
           HEP            FQNDPLFDIPRDDTSSLLSYQTVPVPDSSASYSSMLARPVGASVD
Sbjct: 541 HEPSSSSQGMQSVLSFQNDPLFDIPRDDTSSLLSYQTVPVPDSSASYSSMLARPVGASVD 600

Query: 601 IFSETESCCYTHE 613
           IFSETESCCYTHE
Sbjct: 601 IFSETESCCYTHE 613

>Ecym_4314 Chr4 (675795..678587) [2793 bp, 930 aa] {ON} similar to
           Ashbya gossypii AGR093W +AGR094W
          Length = 930

 Score =  197 bits (500), Expect = 5e-53,   Method: Compositional matrix adjust.
 Identities = 96/206 (46%), Positives = 124/206 (60%), Gaps = 2/206 (0%)

Query: 20  LLVVQQLVRSMLVRLRQQEDLYQLYTATKEQCLSFSQEDPGGGIDVDSMFELLMMRTPEL 79
           L    Q++ +ML+R+R  EDLYQ YT TKEQCLS++Q+     IDVD++F+LLM  TPEL
Sbjct: 12  LYCYHQMLSNMLMRIRNHEDLYQFYTVTKEQCLSYAQDGNNVCIDVDALFKLLMSSTPEL 71

Query: 80  LGLVSLPAMVRFFEWAQXX--XXXXXXXXXXXXXPTRCYNFLKEDVGTFAHGAEVVGGVF 137
           L LVSLPAM+RF EW++                 PTRC NFLK DV  F H +E   G+ 
Sbjct: 72  LNLVSLPAMLRFIEWSRQTPSISSDVKKARSIITPTRCLNFLKNDVHAFKHSSETCKGIL 131

Query: 138 EALQLLQQLQMIVFREKPMLHDRNDPDSASPMWKPLDSPTTLQLLHSLVHDSATGSGKLG 197
            AL+LLQ+LQMI+F EKPML+D NDPDS S +WKPLD+   +Q L+SL  +  T  G++ 
Sbjct: 132 GALKLLQKLQMIMFAEKPMLNDTNDPDSESVVWKPLDTAIAIQFLNSLPANQVTPLGRIN 191

Query: 198 GLAHDDTALLSRDMLDRSAAHAHGHY 223
                        ML +     H  Y
Sbjct: 192 SYTGRSHGSSQNGMLHQPVMQIHSQY 217

 Score =  187 bits (475), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 108/230 (46%), Positives = 148/230 (64%), Gaps = 10/230 (4%)

Query: 378 LQQPQSA--SSTTPVQYYYPNYDSACSSPLFQQSIPDINQRIYHLTLENNKLKQQDTVLM 435
           LQQ Q+    STTP  Y    YDS     LFQQ IP+INQR++HLT++NNKLKQQDT+LM
Sbjct: 487 LQQLQNYPNGSTTPCYYQNYFYDSVA---LFQQGIPEINQRLHHLTVQNNKLKQQDTILM 543

Query: 436 QHINSLKQLVSSLQKTVTSMSLAXXXXXXXXXXXXXXRSAATTPIRSTFINESNNSSMTS 495
           Q IN+L+Q+V+SLQKTVTS+SL               +S ATTPI S F  +SN S +TS
Sbjct: 544 QQINNLRQIVTSLQKTVTSISLT-NSVSTKGKVTKLKQSTATTPICSKFTYDSNISGVTS 602

Query: 496 ISGALNYSESNTANAADDELVDPLLENYEPFILKTEQRQQSRSA--NHEPXXXXXXXXXX 553
           +SG +NYSE+N +N  D ELV+PLLE+YE FI+K + R  +++A  +H+           
Sbjct: 603 VSGHMNYSETNVSNTGDQELVNPLLESYESFIVKNDPRSNTKTAESSHQAPVTAQKDRGE 662

Query: 554 XXFQNDPLFDIPRDDTSSLLSYQTVPVPDSSASYSSMLAR--PVGASVDI 601
             FQ++ +F++ +DD  S+LSY  +   DS+ SYS++L R  P   +V I
Sbjct: 663 LPFQSENIFEVQKDDEGSILSYHPITFADSATSYSNILPRSMPPSGTVSI 712

>SAKL0H17182g Chr8 (1520135..1522192) [2058 bp, 685 aa] {ON} some
           similarities with uniprot|Q74ZV5 Ashbya gossypii AGR094W
           AGR094Wp
          Length = 685

 Score =  125 bits (313), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 62/184 (33%), Positives = 101/184 (54%), Gaps = 3/184 (1%)

Query: 5   SGADERGTSGHIEGRLLVVQQLVRSMLVRLRQQEDLYQLYTATKEQCLSFSQEDPGGGID 64
           S  +     G ++  L +++ +++S+L ++R Q++LYQ YT  +EQCLS+SQ      +D
Sbjct: 41  SSEESNNGDGQVDSALWLLRDILQSVLTKIRNQKNLYQFYTTAREQCLSYSQSPGHVSVD 100

Query: 65  VDSMFELLMMRTPELLGLVSLPAMVRFFEWAQXXXXXXXXXXXXXXXPT--RCYNFLKED 122
            DS+F+ LM    E+L  + +P  +RF +WA                 T  RC  FLK+D
Sbjct: 101 PDSIFKNLMAYPTEVLSAIYIPVTIRFLDWANATHRIPAQCTSGRGIVTSKRCLGFLKDD 160

Query: 123 VGTFAHGAEVVGGVFEALQLLQQLQMIVFREKPMLH-DRNDPDSASPMWKPLDSPTTLQL 181
               +H +     + E L+LLQ+LQMI+F EKP+ + D  D  + + +W+PL+S    + 
Sbjct: 161 SNVLSHTSGTAQRIVEGLKLLQRLQMIIFPEKPVFYNDPGDDQALNSVWQPLESREVYEF 220

Query: 182 LHSL 185
           L SL
Sbjct: 221 LESL 224

 Score = 55.5 bits (132), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 65/245 (26%), Positives = 112/245 (45%), Gaps = 40/245 (16%)

Query: 364 PLQKSSTSNRQTVPLQQPQSASSTTPVQYYYPNYDSACS-SPLFQQSIPDINQRIYHLTL 422
           PL  SS ++++   L  P     T P Q    N D     +P+F Q IPD+ QR+++L L
Sbjct: 282 PLHPSSITDQRDADLLNPHV---TFPSQQTLTNSDLDMKLAPIFNQIIPDMEQRLHYLAL 338

Query: 423 ENNKLKQQDTVLMQHINSLKQLVSSLQKTV----------TSMSLAXXXXXXXXXXXXXX 472
           EN  L++Q+ VL+Q+++SL+  ++ LQ  V          TS+SL               
Sbjct: 339 ENKSLREQNMVLLQNVSSLESQIAQLQNFVSVVVSKPTGATSLSLQPQEPRQARKKIGKV 398

Query: 473 RSAATTPIR-STFINESNNSSMTSI----SGALNYSESNT-----ANAADDEL--VDPLL 520
           +   T+P + S   N++  + +  I       LN + SN      +N+ D  +   D +L
Sbjct: 399 KQQRTSPTQMSATPNQAPLAQIDQIVPKQPPTLNTASSNLHNLQFSNSTDHRMSEYDTML 458

Query: 521 ENYEPFILKTEQRQQSR----SANHEPXXXXXXXXXXXXFQNDPLFDIPRDDTSSLLSYQ 576
            +Y+P ++++ +  +S     ++  EP               +PL  I ++  S +LSYQ
Sbjct: 459 HSYDPLMVRSSELGRSSNGLTNSTQEPTFELHSA--------NPL--IIQEGQSRILSYQ 508

Query: 577 TVPVP 581
             P P
Sbjct: 509 NTPDP 513

>Kwal_56.23599 s56 complement(615840..617786) [1947 bp, 648 aa] {ON}
           [contig 176] FULL
          Length = 648

 Score = 79.7 bits (195), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 52/194 (26%), Positives = 92/194 (47%), Gaps = 7/194 (3%)

Query: 1   MNIASGADERGTSGHIEGRLLVVQQLVRSMLVRLRQQEDLYQLYTATKEQCLSFSQEDPG 60
           + + S   +   + H+E  L V+Q ++ ++LV  R    L   Y   K +C    +    
Sbjct: 44  LAVPSSMRQHNQAQHVESTLFVLQDVLWNLLVHFRNHGTLQASYEMAKHRC----EGHYP 99

Query: 61  GGIDVDSMFELLMMRTPELLGLVSLPAMVRFFEWAQXXXXXXXXXXXXXXXPT--RCYNF 118
             + V+ +F++LM    ELL  + +P ++RFF+W+                 T  R   F
Sbjct: 100 SILSVECIFKVLMDYPAELLSAIYVPMILRFFKWSFSVQQHSQELKWSRAIITTKRGMAF 159

Query: 119 LKEDVGTFAHGAEVVGGVFEALQLLQQLQMIVFREKPML-HDRNDPDSASPMWKPLDSPT 177
           L  +   F++ A  +    ++L+LLQ L+M +  +KP+L  D  D ++  P W PL+S  
Sbjct: 160 LVANFHEFSYNAATLYQASQSLKLLQSLEMALLPQKPVLGDDSEDEEAMDPTWTPLNSEQ 219

Query: 178 TLQLLHSLVHDSAT 191
              L+ SL  D++T
Sbjct: 220 LESLIKSLTKDAST 233

 Score = 38.1 bits (87), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 32/56 (57%)

Query: 402 SSPLFQQSIPDINQRIYHLTLENNKLKQQDTVLMQHINSLKQLVSSLQKTVTSMSL 457
           S  LF Q+ P+I  RI  L + N +L Q +  L + +  LK  + +L+K+V + SL
Sbjct: 316 SDKLFSQTFPNIFHRINALEVANERLTQDNDALFKDMEKLKSQLQNLEKSVENTSL 371

>KLTH0G13816g Chr7 (1194256..1196223) [1968 bp, 655 aa] {ON}
           conserved hypothetical protein
          Length = 655

 Score = 67.8 bits (164), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 52/208 (25%), Positives = 93/208 (44%), Gaps = 12/208 (5%)

Query: 16  IEGRLLVVQQLVRSMLVRLRQQEDLYQLYTATKEQCLSFSQEDPGGGIDVDSMFELLMMR 75
           ++  L ++Q ++ ++LV +R        Y+  K +  +  Q      + V+ +F+ L   
Sbjct: 66  VDSTLNLLQDVLWNVLVHIRGHGTFESCYSLAKRRYEAHYQ----SLVSVECIFKTLANY 121

Query: 76  TPELLGLVSLPAMVRFFEWAQXXXXXXXXXXXXXXXPT--RCYNFLKEDVGTFAHGAEVV 133
             E+L  + +P ++RFF+W                  T  +   FL  ++   ++ A  +
Sbjct: 122 PAEILSAMYIPVILRFFKWCSSVRQLPPEFKGSRFLITTKKGITFLMTNLSECSYNAATL 181

Query: 134 GGVFEALQLLQQLQMIVFREKPML-HDRNDPDSASPMWKPLDSPTTLQLLHSLVHDSATG 192
              F AL+LLQ L++ +F +KP L HD  D ++  P WKPLD       L  L+     G
Sbjct: 182 YQAFRALKLLQSLEIALFPQKPALYHDPEDEEADDPNWKPLDD----SQLEVLISSVTKG 237

Query: 193 SGKLGGLAHDDTALLSRDMLDRSA-AHA 219
             ++G  A       +  M + SA +HA
Sbjct: 238 DFRIGASAPPQPEPTNAGMFEGSALSHA 265

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.128    0.365 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 48,338,074
Number of extensions: 1777632
Number of successful extensions: 5691
Number of sequences better than 10.0: 13
Number of HSP's gapped: 5851
Number of HSP's successfully gapped: 17
Length of query: 613
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 497
Effective length of database: 40,180,143
Effective search space: 19969531071
Effective search space used: 19969531071
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 69 (31.2 bits)