Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
AGR092W8.257ON59659631080.0
Ecym_43138.257ON59759617650.0
NDAI0J014008.257ON58858916230.0
SAKL0H17160g8.257ON73954316370.0
KLTH0G13794g8.257ON72554016230.0
Kpol_392.98.257ON59459515900.0
Kwal_56.236078.257ON72554015950.0
KNAG0H032608.257ON58058415740.0
Skud_4.3708.257ON71467515550.0
KLLA0F19041g8.257ON76353515580.0
CAGL0B01727g8.257ON57758715320.0
KAFR0B055608.257ON60559215330.0
TDEL0F038408.257ON72658115420.0
YDR109C8.257ON71551815400.0
ZYRO0C01782g8.257ON73052815230.0
NCAS0B038708.257ON59660215040.0
TBLA0E044008.257ON58959515020.0
Suva_2.2698.257ON72551715140.0
Smik_4.3558.257ON70452314660.0
TPHA0B032408.257ON58558913820.0
Suva_14.931.111ON5436004926e-54
Skud_14.891.111ON5695954797e-52
YNL249C (MPA43)1.111ON5425984653e-50
TDEL0C059001.111ON5436134602e-49
Smik_14.861.111ON5435994433e-47
KLTH0F03080g1.111ON5336024424e-47
Kwal_33.135301.111ON5346124312e-45
ZYRO0F16016g1.111ON5425973977e-41
KNAG0F006601.111ON5355973899e-40
SAKL0C03432g1.111ON5476113891e-39
KLLA0C02937g1.111ON5165033022e-28
NCAS0A007801.111ON5495111501e-09
NCAS0C059004.9ON703146980.003
NDAI0H002204.9ON810158930.013
TPHA0K022804.9ON667159810.35
KAFR0I005908.590ON69387800.43
TDEL0G018204.9ON698118780.71
YPL106C (SSE1)8.590ON69387780.82
Smik_16.1318.590ON69387751.6
KNAG0A034008.590ON69057742.1
Skud_16.1778.590ON69387742.6
NDAI0C058208.590ON70887723.8
KLLA0E00595g4.9ON661135723.9
KLLA0E24597g8.590ON69487724.6
Smik_2.3108.590ON69387715.8
Suva_16.2068.590ON69387715.8
NDAI0E025908.590ON68587716.0
Kwal_27.122628.590ON69387706.3
CAGL0M06083g8.590ON69457706.9
Ecym_72274.105ON1053182707.5
Suva_4.4228.590ON69347698.3
SAKL0H25938g4.9ON68588699.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AGR092W
         (596 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AGR092W Chr7 (908750..910540) [1791 bp, 596 aa] {ON} Syntenic ho...  1201   0.0  
Ecym_4313 Chr4 (672950..674743) [1794 bp, 597 aa] {ON} similar t...   684   0.0  
NDAI0J01400 Chr10 (321913..323679) [1767 bp, 588 aa] {ON} Anc_8....   629   0.0  
SAKL0H17160g Chr8 (1516854..1519073) [2220 bp, 739 aa] {ON} simi...   635   0.0  
KLTH0G13794g Chr7 (1191104..1193281) [2178 bp, 725 aa] {ON} simi...   629   0.0  
Kpol_392.9 s392 (24389..26173) [1785 bp, 594 aa] {ON} (24389..26...   617   0.0  
Kwal_56.23607 s56 complement(618687..620864) [2178 bp, 725 aa] {...   619   0.0  
KNAG0H03260 Chr8 (607908..609650) [1743 bp, 580 aa] {ON} Anc_8.2...   610   0.0  
Skud_4.370 Chr4 complement(645143..647287) [2145 bp, 714 aa] {ON...   603   0.0  
KLLA0F19041g Chr6 complement(1753543..1755834) [2292 bp, 763 aa]...   604   0.0  
CAGL0B01727g Chr2 complement(159373..161106) [1734 bp, 577 aa] {...   594   0.0  
KAFR0B05560 Chr2 (1138380..1140197) [1818 bp, 605 aa] {ON} Anc_8...   595   0.0  
TDEL0F03840 Chr6 complement(705363..707543) [2181 bp, 726 aa] {O...   598   0.0  
YDR109C Chr4 complement(673520..675667) [2148 bp, 715 aa] {ON} P...   597   0.0  
ZYRO0C01782g Chr3 (137232..139424) [2193 bp, 730 aa] {ON} simila...   591   0.0  
NCAS0B03870 Chr2 (689411..691201) [1791 bp, 596 aa] {ON} Anc_8.257    583   0.0  
TBLA0E04400 Chr5 complement(1119643..1121412) [1770 bp, 589 aa] ...   583   0.0  
Suva_2.269 Chr2 complement(467973..470150) [2178 bp, 725 aa] {ON...   587   0.0  
Smik_4.355 Chr4 complement(634853..636967) [2115 bp, 704 aa] {ON...   569   0.0  
TPHA0B03240 Chr2 (743153..744910) [1758 bp, 585 aa] {ON} Anc_8.2...   536   0.0  
Suva_14.93 Chr14 complement(174204..175835) [1632 bp, 543 aa] {O...   194   6e-54
Skud_14.89 Chr14 complement(168159..169868) [1710 bp, 569 aa] {O...   189   7e-52
YNL249C Chr14 complement(179394..181022) [1629 bp, 542 aa] {ON} ...   183   3e-50
TDEL0C05900 Chr3 (1062033..1063664) [1632 bp, 543 aa] {ON} Anc_1...   181   2e-49
Smik_14.86 Chr14 complement(158487..160118) [1632 bp, 543 aa] {O...   175   3e-47
KLTH0F03080g Chr6 complement(268621..270222) [1602 bp, 533 aa] {...   174   4e-47
Kwal_33.13530 s33 complement(268296..269900) [1605 bp, 534 aa] {...   170   2e-45
ZYRO0F16016g Chr6 (1313995..1315623) [1629 bp, 542 aa] {ON} simi...   157   7e-41
KNAG0F00660 Chr6 complement(114441..116048) [1608 bp, 535 aa] {O...   154   9e-40
SAKL0C03432g Chr3 complement(325502..327145) [1644 bp, 547 aa] {...   154   1e-39
KLLA0C02937g Chr3 complement(265205..266755) [1551 bp, 516 aa] {...   120   2e-28
NCAS0A00780 Chr1 complement(152317..153966) [1650 bp, 549 aa] {O...    62   1e-09
NCAS0C05900 Chr3 (1214812..1216923) [2112 bp, 703 aa] {ON} Anc_4...    42   0.003
NDAI0H00220 Chr8 complement(30959..33391) [2433 bp, 810 aa] {ON}...    40   0.013
TPHA0K02280 Chr11 (490104..492107) [2004 bp, 667 aa] {ON} Anc_4....    36   0.35 
KAFR0I00590 Chr9 complement(120194..122275) [2082 bp, 693 aa] {O...    35   0.43 
TDEL0G01820 Chr7 (364972..367068) [2097 bp, 698 aa] {ON} Anc_4.9...    35   0.71 
YPL106C Chr16 complement(350194..352275) [2082 bp, 693 aa] {ON} ...    35   0.82 
Smik_16.131 Chr16 complement(233512..235593) [2082 bp, 693 aa] {...    33   1.6  
KNAG0A03400 Chr1 complement(431077..433149) [2073 bp, 690 aa] {O...    33   2.1  
Skud_16.177 Chr16 complement(321628..323709) [2082 bp, 693 aa] {...    33   2.6  
NDAI0C05820 Chr3 (1336776..1338902) [2127 bp, 708 aa] {ON} Anc_8...    32   3.8  
KLLA0E00595g Chr5 complement(49243..51228) [1986 bp, 661 aa] {ON...    32   3.9  
KLLA0E24597g Chr5 (2183993..2186077) [2085 bp, 694 aa] {ON} high...    32   4.6  
Smik_2.310 Chr2 complement(560092..562173) [2082 bp, 693 aa] {ON...    32   5.8  
Suva_16.206 Chr16 complement(359950..362031) [2082 bp, 693 aa] {...    32   5.8  
NDAI0E02590 Chr5 complement(537501..539558) [2058 bp, 685 aa] {O...    32   6.0  
Kwal_27.12262 s27 (1151990..1154071) [2082 bp, 693 aa] {ON} YPL1...    32   6.3  
CAGL0M06083g Chr13 complement(634963..637047) [2085 bp, 694 aa] ...    32   6.9  
Ecym_7227 Chr7 (469487..469510,469584..472721) [3162 bp, 1053 aa...    32   7.5  
Suva_4.422 Chr4 complement(743352..745433) [2082 bp, 693 aa] {ON...    31   8.3  
SAKL0H25938g Chr8 (2281415..2283472) [2058 bp, 685 aa] {ON} simi...    31   9.0  

>AGR092W Chr7 (908750..910540) [1791 bp, 596 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR109C and
           Non-syntenic homolog of Saccharomyces cerevisiae YNL249C
           (MPA43)
          Length = 596

 Score = 1201 bits (3108), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 583/596 (97%), Positives = 583/596 (97%)

Query: 1   MSAAEMKQYYVGVDVGTEFARACIIDKSGAILATTQNPISRSQPKHDHITQSSSEIWGAV 60
           MSAAEMKQYYVGVDVGTEFARACIIDKSGAILATTQNPISRSQPKHDHITQSSSEIWGAV
Sbjct: 1   MSAAEMKQYYVGVDVGTEFARACIIDKSGAILATTQNPISRSQPKHDHITQSSSEIWGAV 60

Query: 61  CKSVRAAVAESQVAVDEVAGINFDATCSLVVLDEDSDGEVAVGPDFSDNRQNVILWMDHR 120
           CKSVRAAVAESQVAVDEVAGINFDATCSLVVLDEDSDGEVAVGPDFSDNRQNVILWMDHR
Sbjct: 61  CKSVRAAVAESQVAVDEVAGINFDATCSLVVLDEDSDGEVAVGPDFSDNRQNVILWMDHR 120

Query: 121 AVAEASEINSTGHSVLRYVGGKMSVEMQMPKIKWLQRHMPRGEFAKCKFYDLPDFLTYQA 180
           AVAEASEINSTGHSVLRYVGGKMSVEMQMPKIKWLQRHMPRGEFAKCKFYDLPDFLTYQA
Sbjct: 121 AVAEASEINSTGHSVLRYVGGKMSVEMQMPKIKWLQRHMPRGEFAKCKFYDLPDFLTYQA 180

Query: 181 TGIESRSFCSTVCKMGLVPNGVDSSTSGWSREFLEQIGLEELCEDGFRRLGGALDEPGSE 240
           TGIESRSFCSTVCKMGLVPNGVDSSTSGWSREFLEQIGLEELCEDGFRRLGGALDEPGSE
Sbjct: 181 TGIESRSFCSTVCKMGLVPNGVDSSTSGWSREFLEQIGLEELCEDGFRRLGGALDEPGSE 240

Query: 241 FRSAGEPVXXXXXXXXXXXXXTPRCVVGSGVIDAYAGWVGTVGASPDGARESGGVEELAG 300
           FRSAGEPV             TPRCVVGSGVIDAYAGWVGTVGASPDGARESGGVEELAG
Sbjct: 241 FRSAGEPVGLLSEAAAASLGLTPRCVVGSGVIDAYAGWVGTVGASPDGARESGGVEELAG 300

Query: 301 RLAAVAGTSTCLIMLSQTPHFVEGVWGPYRDVLARGYWCTEGGQSCTGALLAHTLHTHPA 360
           RLAAVAGTSTCLIMLSQTPHFVEGVWGPYRDVLARGYWCTEGGQSCTGALLAHTLHTHPA
Sbjct: 301 RLAAVAGTSTCLIMLSQTPHFVEGVWGPYRDVLARGYWCTEGGQSCTGALLAHTLHTHPA 360

Query: 361 YTELHQAAQQRGLTDFDYINWRLDKLRAETGARSIRALAKHRFLYGDYHGNRSPLADPSM 420
           YTELHQAAQQRGLTDFDYINWRLDKLRAETGARSIRALAKHRFLYGDYHGNRSPLADPSM
Sbjct: 361 YTELHQAAQQRGLTDFDYINWRLDKLRAETGARSIRALAKHRFLYGDYHGNRSPLADPSM 420

Query: 421 RAAMVGLSMDVSQDDLALAVLTAFEFIALQARHILDHMAAAGLHVDTVYLSGGQARNPLL 480
           RAAMVGLSMDVSQDDLALAVLTAFEFIALQARHILDHMAAAGLHVDTVYLSGGQARNPLL
Sbjct: 421 RAAMVGLSMDVSQDDLALAVLTAFEFIALQARHILDHMAAAGLHVDTVYLSGGQARNPLL 480

Query: 481 TQLLADAVRRPVVTPRHVGAAVVFGSALLAAAAVENYLANTNATASSILPSSASRAPMHR 540
           TQLLADAVRRPVVTPRHVGAAVVFGSALLAAAAVENYLANTNATASSILPSSASRAPMHR
Sbjct: 481 TQLLADAVRRPVVTPRHVGAAVVFGSALLAAAAVENYLANTNATASSILPSSASRAPMHR 540

Query: 541 LWQIMSRLTVPGNVVSPSPDADPDIRLLEAKYKVFLEMAEAQKLYRKLVDDVENTP 596
           LWQIMSRLTVPGNVVSPSPDADPDIRLLEAKYKVFLEMAEAQKLYRKLVDDVENTP
Sbjct: 541 LWQIMSRLTVPGNVVSPSPDADPDIRLLEAKYKVFLEMAEAQKLYRKLVDDVENTP 596

>Ecym_4313 Chr4 (672950..674743) [1794 bp, 597 aa] {ON} similar to
           Ashbya gossypii AGR092W
          Length = 597

 Score =  684 bits (1765), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 324/596 (54%), Positives = 423/596 (70%), Gaps = 6/596 (1%)

Query: 6   MKQYYVGVDVGTEFARACIIDKSGAILATTQNPISRSQPKHDHITQSSSEIWGAVCKSVR 65
           M Q+Y+GVDVGTE  RAC++D  G IL+    PISR + + +++TQSS+EIW A+C  +R
Sbjct: 1   MLQHYIGVDVGTESVRACVVDVHGTILSLASKPISRQEIQPNYLTQSSNEIWRAICFCIR 60

Query: 66  AAVAESQVAVDEVAGINFDATCSLVVLDEDSDGEVAVGPDFSDNRQNVILWMDHRAVAEA 125
             + +SQV  D + GI FDATCSLVVL+E ++  VAVGP+F D  Q++ILWMDHRA+ E 
Sbjct: 61  KIICDSQVVKDSIIGIGFDATCSLVVLEEVTNKGVAVGPNFDDFEQDIILWMDHRAIDEV 120

Query: 126 SEINSTGHSVLRYVGGKMSVEMQMPKIKWLQRHMPRGEFAKCKFYDLPDFLTYQATGIES 185
           +EINSTGH  L+YVGGKMS+EMQ+PKIKWL+ ++P+G+F KC+FYDLPDFLTY+ATG + 
Sbjct: 121 NEINSTGHRCLKYVGGKMSIEMQIPKIKWLKNNLPQGKFDKCEFYDLPDFLTYRATGNKC 180

Query: 186 RSFCSTVCKMGLVPNGVDSSTSGWSREFLEQIGLEELCEDGFRRLGGALDEPGSEFRSAG 245
           RSFCSTVCKMGL+P GVD ST GW ++  E IGL ELC   F +LGG +    S F SAG
Sbjct: 181 RSFCSTVCKMGLLPLGVDGSTKGWPQDLFEDIGLAELCRREFSKLGGVVSSTASNFLSAG 240

Query: 246 EPVXXXXXXXXXXXXXTPRCVVGSGVIDAYAGWVGTVGASPDGARESGGVEELAGRLAAV 305
           + V             T +C+V SG+IDAYAGWVGT+ A      +    E  + RLA V
Sbjct: 241 DYVGHLSDEAAADLGLTTKCIVASGLIDAYAGWVGTIAAGITLGSDGQESELASSRLATV 300

Query: 306 AGTSTCLIMLSQTPHFVEGVWGPYRDVLARGYWCTEGGQSCTGALLAHTLHTHPAYTELH 365
           AGTSTC I +S+ PHF++GVWGPYRD L  GYW TEGGQSCTGALLAH L +HPAY  L 
Sbjct: 301 AGTSTCHITISKCPHFMDGVWGPYRDALMPGYWVTEGGQSCTGALLAHVLKSHPAYDTLC 360

Query: 366 QAAQQRGLTDFDYINWRLDKLRAETGARSIRALAKHRFLYGDYHGNRSPLADPSMRAAMV 425
           + A+ +G++ FD+IN RL++L+ E GA+S+ AL KH F YGDYHGNRSP+ADP+MRA ++
Sbjct: 361 KLAKNQGISKFDFINNRLEELKEERGAQSVAALGKHLFFYGDYHGNRSPIADPNMRATII 420

Query: 426 GLSMDVSQDDLALAVLTAFEFIALQARHILDHMAAAGLHVDTVYLSGGQARNPLLTQLLA 485
           G SMDVS DDLA+  L A EFIA Q R I++H+  +G  + ++Y+SGGQ RN +L +LLA
Sbjct: 421 GQSMDVSVDDLAIMTLGACEFIAQQTRQIVEHIKQSGHEITSIYMSGGQCRNLVLIKLLA 480

Query: 486 DAVRRPVVTPRHVGAAVVFGSALLAAAAVENYLANTNATA--SSILP----SSASRAPMH 539
           +  + P+V P+++ AAVVFGSALL  AA E YL   + TA  S+I+     +S  +    
Sbjct: 481 NCTKLPIVLPKYIDAAVVFGSALLGVAASEKYLHGCSDTASVSTIVDQQRITSELKPKQS 540

Query: 540 RLWQIMSRLTVPGNVVSPSPDADPDIRLLEAKYKVFLEMAEAQKLYRKLVDDVENT 595
            LW +M+ LT  G ++ PS   D +IRLL+ KY++FL+M E QK YR LV   EN+
Sbjct: 541 ILWTVMANLTGIGQIIEPSNMLDSEIRLLDQKYEIFLDMIETQKRYRDLVTRAENS 596

>NDAI0J01400 Chr10 (321913..323679) [1767 bp, 588 aa] {ON} Anc_8.257
          Length = 588

 Score =  629 bits (1623), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 306/589 (51%), Positives = 401/589 (68%), Gaps = 10/589 (1%)

Query: 9   YYVGVDVGTEFARACIIDKSGAILATTQNPISRSQPKHDHITQSSSEIWGAVCKSVRAAV 68
           YY+GVDVGT   RACIID  G I +  +  I R + K D ITQSS EIW AVC  V+  V
Sbjct: 7   YYIGVDVGTGSVRACIIDDLGTIKSQAELSIHRQELKTDCITQSSQEIWRAVCFCVKKVV 66

Query: 69  AESQVAVDEVAGINFDATCSLVVLDEDSDGEVAVGPDFSDNRQNVILWMDHRAVAEASEI 128
            E     D+V GI FDATCSLVV+D+ ++  VAVGPDF+D+ Q++ILWMDHRA+ E  EI
Sbjct: 67  NELGCTRDQVKGIGFDATCSLVVVDKVTNRGVAVGPDFNDSNQDIILWMDHRALKETKEI 126

Query: 129 NSTGHSVLRYVGGKMSVEMQMPKIKWLQRHMPRGEFAKCKFYDLPDFLTYQATGIESRSF 188
           NST    L+YVGG+MS+EM++PKIKWL+RHM +  FA+C+FYDL D+LT++ATG ++RSF
Sbjct: 127 NSTNDECLKYVGGQMSIEMELPKIKWLKRHMSKDVFARCEFYDLADYLTFKATGRKTRSF 186

Query: 189 CSTVCKMGLVPNGVDSSTSGWSREFLEQIGLEELCEDGFRRLGGALD-EPGSEFRSAGEP 247
           CS VCK G+VP GV+ S  GWS++FL  I LEEL  + + +LGG++    G  F +AGE 
Sbjct: 187 CSVVCKQGMVPMGVEGSKLGWSKDFLRNIDLEELTYNDYAKLGGSVSGSHGRNFLTAGEY 246

Query: 248 VXXXXXXXXXXXXXTPRCVVGSGVIDAYAGWVGTVGASPDGARE--SGGVEELAGRLAAV 305
           +             +  C+VGSG+IDAYAGW+GTVG+      +    G+    GRLAAV
Sbjct: 247 IAPLNDQAIEELELSKECIVGSGIIDAYAGWLGTVGSGTVDLEQLFRVGMANAIGRLAAV 306

Query: 306 AGTSTCLIMLSQTPHFVEGVWGPYRDVLARGYWCTEGGQSCTGALLAHTLHTHPAYTELH 365
           AGTSTC I+LS+ P FV GVWGPY+D + +GYWCTEGGQSCTGALL H L THP+Y EL 
Sbjct: 307 AGTSTCHIVLSKDPIFVPGVWGPYKDTITKGYWCTEGGQSCTGALLQHVLQTHPSYKELE 366

Query: 366 QAAQQRGLTDFDYINWRLDKLRAETGARSIRALAKHRFLYGDYHGNRSPLADPSMRAAMV 425
           + +++ G+  FDY+N RL ++   +  RS+  LAKH F YGD HGNRSPLADPSM+ A+V
Sbjct: 367 EISEKNGMNKFDYLNTRLAEMAKRSNERSVLCLAKHIFFYGDLHGNRSPLADPSMKGAIV 426

Query: 426 GLSMDVSQDDLALAVLTAFEFIALQARHILDHMAAAGLHVDTVYLSGGQARNPLLTQLLA 485
           GLSMD S D+LA   L A EFIA Q R I++ M  AG  +  +Y+SGGQ RN LL +LLA
Sbjct: 427 GLSMDTSLDNLAKTYLAACEFIAQQNRQIIEAMCDAGHEISAIYMSGGQCRNSLLMKLLA 486

Query: 486 DAVRRPVVTPRHVGAAVVFGSALLAAAAVENYLANTNATASSILPSSASRAPMHRLWQIM 545
           D     V+ P ++ +AVVFG+A+L A+A + Y  N + + + I   +        LW  M
Sbjct: 487 DCSGLSVIIPEYIDSAVVFGAAILGASASKLYQLNGSESDTVINTENI-------LWSTM 539

Query: 546 SRLTVPGNVVSPSPDADPDIRLLEAKYKVFLEMAEAQKLYRKLVDDVEN 594
           +++T  G+ + P P   PD  LL+AKYK+FL+MA+ QK YR +VD VE+
Sbjct: 540 NKMTKVGSYIMPVPKDHPDRILLDAKYKIFLDMADRQKRYRAIVDAVED 588

>SAKL0H17160g Chr8 (1516854..1519073) [2220 bp, 739 aa] {ON} similar
           to uniprot|P53583 Saccharomyces cerevisiae YNL249C MPA43
           Mitochondrial protein of unknown function and similar to
           uniprot|Q04585 Saccharomyces cerevisiae YDR109C
           Hypothetical ORF
          Length = 739

 Score =  635 bits (1637), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 311/543 (57%), Positives = 388/543 (71%), Gaps = 17/543 (3%)

Query: 1   MSAAEMKQ----YYVGVDVGTEFARACIIDKSGAILATTQNPISRSQPKHDHITQSSSEI 56
           MSA  M+Q    YYVGVDVGT  ARACIID  G IL+  + PI R + K  +ITQSS EI
Sbjct: 22  MSALSMEQNKMTYYVGVDVGTGSARACIIDNMGNILSLAERPIQRQELKPSYITQSSQEI 81

Query: 57  WGAVCKSVRAAVAESQVAVDEVAGINFDATCSLVVLDEDSDGEVAVGPDFSDNRQNVILW 116
           W A+C  V++ V +S V  +++ GI FDATCSLVV+++DSD EVAVGPDF +  QN+ILW
Sbjct: 82  WLAICYCVKSVVKDSGVLPEKIHGIGFDATCSLVVVEDDSDKEVAVGPDFFNTEQNIILW 141

Query: 117 MDHRAVAEASEINSTGHSVLRYVGGKMSVEMQMPKIKWLQRHMPRGEFAKCKFYDLPDFL 176
           MDHRA+ E  EIN+T    L+YVGG+MSVEM++PKIKWL+ ++PR +F KCKF+DL D+L
Sbjct: 142 MDHRAIDETKEINATNDKCLKYVGGQMSVEMEIPKIKWLKNNLPREKFEKCKFFDLADYL 201

Query: 177 TYQATGIESRSFCSTVCKMGLVPNGVDSSTSGWSREFLEQIGLEELCEDGFRRLGGALDE 236
           T++ATG+E+RS+CSTVCK GL+P GV+SS  GWS+EFL  IGLE+LC+D FR+LGG++  
Sbjct: 202 TFKATGLETRSYCSTVCKQGLLPVGVESSKQGWSKEFLTNIGLEDLCQDDFRKLGGSIKS 261

Query: 237 P---GSEFRSAGEPVXXXXXXXXXXXXXTPRCVVGSGVIDAYAGWVGTVGASPD------ 287
               GS F SAGE +                CVVGSGVIDAYAGWVGTV A  D      
Sbjct: 262 DGSGGSTFLSAGECIGSLDPSAAEELGLPAHCVVGSGVIDAYAGWVGTVAARTDVDIPEL 321

Query: 288 --GARESGGVEELAGRLAAVAGTSTCLIMLSQTPHFVEGVWGPYRDVLARGYWCTEGGQS 345
                E  G++   GRLAAVAGTSTC I +S+ P FV+GVWGPYRDV+A G+WC EGGQS
Sbjct: 322 VEADNEKTGIDHATGRLAAVAGTSTCHIAMSKDPIFVDGVWGPYRDVMAPGFWCAEGGQS 381

Query: 346 CTGALLAHTLHTHPAYTELHQAAQQRGLTDFDYINWRLDKLRAETGARSIRALAKHRFLY 405
           CTGALLAH L  HPAYTEL   +    ++ FDY+N RL+ L  + GARS+ ALAKH F Y
Sbjct: 382 CTGALLAHVLTIHPAYTELSHLSDAASVSKFDYLNSRLEVLTQQRGARSVVALAKHLFFY 441

Query: 406 GDYHGNRSPLADPSMRAAMVGLSMDVSQDDLALAVLTAFEFIALQARHILDHMAAAGLHV 465
           GDYHGNRSP+ADPSMRAA++G SMD S DDLA+  L A EFIA Q R I++ M+ +G  +
Sbjct: 442 GDYHGNRSPIADPSMRAAVIGQSMDNSIDDLAIMYLGACEFIAQQTRQIVEKMSVSGHRI 501

Query: 466 DTVYLSGGQARNPLLTQLLADAVRRPVVTPRHVGAAVVFGSALLAAAAVENYLANTNATA 525
             +++SGGQ RN LL +LLAD    P+V PR++ AAVVFGSALL A A E++  N N  +
Sbjct: 502 AAIFMSGGQCRNGLLMRLLADCTGLPIVIPRYIDAAVVFGSALLGAVASESF--NLNHKS 559

Query: 526 SSI 528
            S+
Sbjct: 560 GSL 562

 Score = 68.9 bits (167), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 42/100 (42%), Positives = 51/100 (51%), Gaps = 11/100 (11%)

Query: 495 PRHVGAAVVFGSALLAAAAVENYLANTNATASSILPSSASRAPMHRLWQIMSRLTVPGNV 554
           P    AA+ FGS    A A E        +AS              LW +M  +T  G V
Sbjct: 641 PEEANAALSFGSK--KATAQEQLALEKEKSAS---------GKGDALWDVMYNMTGGGKV 689

Query: 555 VSPSPDADPDIRLLEAKYKVFLEMAEAQKLYRKLVDDVEN 594
           V PS D  PD  LL+AKYK+FL+MAE Q+ YR+ VD VEN
Sbjct: 690 VQPSSDDHPDRVLLDAKYKIFLDMAETQRRYREAVDKVEN 729

>KLTH0G13794g Chr7 (1191104..1193281) [2178 bp, 725 aa] {ON} similar
           to uniprot|Q04585 Saccharomyces cerevisiae YDR109C
           Hypothetical ORF
          Length = 725

 Score =  629 bits (1623), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 311/540 (57%), Positives = 384/540 (71%), Gaps = 11/540 (2%)

Query: 9   YYVGVDVGTEFARACIIDKSGAILATTQNPISRSQPKHDHITQSSSEIWGAVCKSVRAAV 68
           YYVGVDVGT  ARACIID  G IL+  + PI R Q K + ITQSS EIW AVC  V++ V
Sbjct: 34  YYVGVDVGTGSARACIIDSMGNILSLAERPIQREQLKANFITQSSQEIWQAVCHCVKSVV 93

Query: 69  AESQVAVDEVAGINFDATCSLVVLDEDSDGEVAVGPDFSDNRQNVILWMDHRAVAEASEI 128
            +S V  +++ GI FDATCSLVV++E ++ EVAVGPDFS+  QN+ILWMDHRA+ E   I
Sbjct: 94  RDSGVPAEKIHGIGFDATCSLVVVEEQTNKEVAVGPDFSNTDQNIILWMDHRAIEETQLI 153

Query: 129 NSTGHSVLRYVGGKMSVEMQMPKIKWLQRHMPRGEFAKCKFYDLPDFLTYQATGIESRSF 188
           N+TG   L+YVGG+MSVEM++PKIKWL+ H+P  +F +CKF+DL D+LT++A+G E+RSF
Sbjct: 154 NATGDKCLKYVGGQMSVEMEIPKIKWLKNHLPENKFNECKFFDLADYLTFKASGKETRSF 213

Query: 189 CSTVCKMGLVPNGVDSSTSGWSREFLEQIGLEELCEDGFRRLGGALD--EPGSEFRSAGE 246
           CSTVCK GL+P GV+ S  GWSREFL +IGLEEL ED FRR+GG++   + G  F SAGE
Sbjct: 214 CSTVCKQGLLPVGVEGSAEGWSREFLTEIGLEELIEDDFRRIGGSVKNSDKGKNFLSAGE 273

Query: 247 PVXXXXXXXXXXXXXTPRCVVGSGVIDAYAGWVGTVGASPDGA--------RESGGVEEL 298
            +             +  CVVGSGVIDAYAGWVGTV A  D +        +E  G++  
Sbjct: 274 FIGAIDATVAEELGLSNHCVVGSGVIDAYAGWVGTVAARTDVSIPALVKTDQEKVGMDRA 333

Query: 299 AGRLAAVAGTSTCLIMLSQTPHFVEGVWGPYRDVLARGYWCTEGGQSCTGALLAHTLHTH 358
            GRLAAVAGTSTC I +S+ P FV+GVWGPYRD LA  +WC EGGQSCTGALLAH L TH
Sbjct: 334 TGRLAAVAGTSTCHIAMSRDPIFVDGVWGPYRDALATNFWCAEGGQSCTGALLAHVLTTH 393

Query: 359 PAYTELHQAAQQRGLTDFDYINWRLDKLRAETGARSIRALAKHRFLYGDYHGNRSPLADP 418
           PAYTEL Q A    ++ FDY+N RL+ L  +  ARS+  LAKH F YGDYHGNRSP+ADP
Sbjct: 394 PAYTELSQLADAASVSKFDYLNSRLETLAQQQKARSVVHLAKHLFFYGDYHGNRSPIADP 453

Query: 419 SMRAAMVGLSMDVSQDDLALAVLTAFEFIALQARHILDHMAAAGLHVDTVYLSGGQARNP 478
           SMRAA++G SMD S DDLAL  L A EFIA Q R I+D M  +G  +  +++SGGQ RN 
Sbjct: 454 SMRAAIIGQSMDNSIDDLALMYLGACEFIAQQTRQIVDKMCTSGHDLSAIFMSGGQCRNG 513

Query: 479 LLTQLLADAVRRPVVTPRHVGAAVVFGSALLAAAAVENY-LANTNATASSILPSSASRAP 537
           LL +LLAD    P+V PR++ AAVVFGSALL A A E++ L+ T++  S    SS +  P
Sbjct: 514 LLMRLLADCTGLPIVIPRYIDAAVVFGSALLGAVASESFDLSGTHSALSVSRKSSIAGEP 573

 Score = 59.7 bits (143), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 35/51 (68%)

Query: 541 LWQIMSRLTVPGNVVSPSPDADPDIRLLEAKYKVFLEMAEAQKLYRKLVDD 591
           +W +M  +T  G VV P+ + + D  LL AKYK+FL+MAE Q+ YR +VDD
Sbjct: 671 MWNVMYNMTGGGKVVQPAAEENADRVLLNAKYKIFLDMAETQRKYRTIVDD 721

>Kpol_392.9 s392 (24389..26173) [1785 bp, 594 aa] {ON}
           (24389..26173) [1785 nt, 595 aa]
          Length = 594

 Score =  617 bits (1590), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 299/595 (50%), Positives = 396/595 (66%), Gaps = 16/595 (2%)

Query: 8   QYYVGVDVGTEFARACIIDKSGAILATTQNPISRSQPKHDHITQSSSEIWGAVCKSVRAA 67
            +Y+GVDVGT   RAC+I+  G IL+     I++ + K ++ITQSS EIW  +C+ V   
Sbjct: 2   NHYIGVDVGTGSVRACVINDKGEILSLRSKDITKEELKPNYITQSSREIWQCICECVNYV 61

Query: 68  VAESQVAVDEVAGINFDATCSLVVLDEDSDGEVAVGPDFSDNRQNVILWMDHRAVAEASE 127
           + ESQ+    V GI FDATCSLVV+D+++  EV VGP+F D+ +N+ILWMDHRAV E  E
Sbjct: 62  LQESQIIPSSVLGIGFDATCSLVVIDKETQQEVGVGPNFEDDNRNIILWMDHRAVKETDE 121

Query: 128 INSTGHSVLRYVGGKMSVEMQMPKIKWLQRHMPRGEFAKCKFYDLPDFLTYQATGIESRS 187
           IN+TG   L+YVGGKMSVEM++PKIKWL+ ++  G F+ CKF+DL D+LTY+AT  + RS
Sbjct: 122 INATGDKCLKYVGGKMSVEMELPKIKWLKNNLADGVFSNCKFFDLVDYLTYKATDKDVRS 181

Query: 188 FCSTVCKMGLVPNGVDSSTSGWSREFLEQIGLEELCEDGFRRLGGAL--DEPGSEFRSAG 245
           F STVCK GL+P GV+ S  GWS+EF  +I L+EL  D F  +GG++  ++  +  RS G
Sbjct: 182 FSSTVCKQGLLPLGVEGSDIGWSKEFFTKIDLDELSSDNFSAIGGSIHSEQLENNIRSVG 241

Query: 246 EPVXXXXXXXXXXXXXTPRCVVGSGVIDAYAGWVGTVGAS-------PDGARESGGVEEL 298
           E V                C+VGSG+IDAYAGWVGTV A         +    S  ++  
Sbjct: 242 EYVGHLSEISAKELGLPTTCIVGSGIIDAYAGWVGTVAAKVEEIGTINNDDDASSKLDSS 301

Query: 299 AGRLAAVAGTSTCLIMLSQTPHFVEGVWGPYRDVLARGYWCTEGGQSCTGALLAHTLHTH 358
            G LA +AGTSTC I LS  P FV G+WGPYRDVL+  +WC EGGQSCTGALL H L TH
Sbjct: 302 IGNLAVIAGTSTCHITLSSKPIFVNGIWGPYRDVLSHNFWCAEGGQSCTGALLEHILTTH 361

Query: 359 PAYTELHQAAQQRGLTDFDYINWRLDKLRAETGARSIRALAKHRFLYGDYHGNRSPLADP 418
           PAY ELH+  ++  +  F+++N RL +L+ E  ARSI +L KH FLYGDYHGNRSP++D 
Sbjct: 362 PAYPELHEQCEKHSVGSFEFLNNRLAELQKENSARSIISLGKHFFLYGDYHGNRSPISDE 421

Query: 419 SMRAAMVGLSMDVSQDDLALAVLTAFEFIALQARHILDHMAAAGLHVDTVYLSGGQARNP 478
           SMRAA++G SMD S D LA+  L+A EFI+ Q+R I+  +  AG  +  +Y+SGGQARN 
Sbjct: 422 SMRAAIIGQSMDTSIDSLAIMYLSACEFISQQSRQIISELVKAGHTIKKIYMSGGQARNQ 481

Query: 479 LLTQLLADAVRRPVVTPRHVGAAVVFGSALLAAAAVENYLANTNATASSILPSSASRAPM 538
           LL +LLAD    PVV PR++ A+V+FGSA+L A AV+ Y           L  + +    
Sbjct: 482 LLMRLLADCTGLPVVIPRYIDASVIFGSAILGAVAVDAYNIKH-------LDGNKNWDHG 534

Query: 539 HRLWQIMSRLTVPGNVVSPSPDADPDIRLLEAKYKVFLEMAEAQKLYRKLVDDVE 593
             LW  M +LT PG V++P+    PD  LL AKYK+FL+MAE Q+ YR+ +D++E
Sbjct: 535 KTLWNKMCKLTPPGTVINPNAVNHPDRVLLNAKYKIFLDMAETQRKYRRQIDEIE 589

>Kwal_56.23607 s56 complement(618687..620864) [2178 bp, 725 aa] {ON}
           YDR109C - Hypothetical ORF [contig 176] FULL
          Length = 725

 Score =  619 bits (1595), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 304/540 (56%), Positives = 382/540 (70%), Gaps = 11/540 (2%)

Query: 9   YYVGVDVGTEFARACIIDKSGAILATTQNPISRSQPKHDHITQSSSEIWGAVCKSVRAAV 68
           YY+GVDVGT  ARACIID  G IL+  + PI R Q K + ITQSS EIW AVC  V++ V
Sbjct: 34  YYIGVDVGTGSARACIIDSMGNILSLAERPIQREQLKPNFITQSSQEIWQAVCHCVKSVV 93

Query: 69  AESQVAVDEVAGINFDATCSLVVLDEDSDGEVAVGPDFSDNRQNVILWMDHRAVAEASEI 128
            +S V  +++ GI FDATCSLVV++E S+ EVAVGPDF +  QN+ILWMDHRA+ E  +I
Sbjct: 94  RDSGVPSEKIHGIGFDATCSLVVVEEGSNKEVAVGPDFQNTNQNIILWMDHRAIEETEQI 153

Query: 129 NSTGHSVLRYVGGKMSVEMQMPKIKWLQRHMPRGEFAKCKFYDLPDFLTYQATGIESRSF 188
           N+TG   L+YVGG+MSVEM++PKIKWL+ H+P  +F +CKF+DL D+LT++A+G E+RSF
Sbjct: 154 NATGDKCLKYVGGQMSVEMEIPKIKWLKNHLPNNKFDECKFFDLADYLTFKASGKETRSF 213

Query: 189 CSTVCKMGLVPNGVDSSTSGWSREFLEQIGLEELCEDGFRRLGGALD--EPGSEFRSAGE 246
           CSTVCK GL+P GV+ S  GWSREFL +IGLE+  ED FR++GG++   + G  F SAGE
Sbjct: 214 CSTVCKQGLLPVGVEGSKEGWSREFLTEIGLEDFIEDDFRKIGGSVKNSDKGKNFLSAGE 273

Query: 247 PVXXXXXXXXXXXXXTPRCVVGSGVIDAYAGWVGTVGASPDGA--------RESGGVEEL 298
            V             +  CVVGSGVIDAYAGWVGTV A  D +        +E  G++  
Sbjct: 274 FVGAIDPAVAEELGLSNHCVVGSGVIDAYAGWVGTVAARTDVSIPALVKIDQEKVGMDRA 333

Query: 299 AGRLAAVAGTSTCLIMLSQTPHFVEGVWGPYRDVLARGYWCTEGGQSCTGALLAHTLHTH 358
            GRLAAVAGTSTC I +S+ P FV+GVWGPYRD LA  +WC EGGQSCTGALLAH + TH
Sbjct: 334 TGRLAAVAGTSTCHIAMSRDPIFVDGVWGPYRDALATNFWCAEGGQSCTGALLAHVMTTH 393

Query: 359 PAYTELHQAAQQRGLTDFDYINWRLDKLRAETGARSIRALAKHRFLYGDYHGNRSPLADP 418
           PAYTEL Q A    ++ FDY+N RL+ L  +  +RS+  LA+H F YGDYHGNRSP+ADP
Sbjct: 394 PAYTELSQLADAASVSKFDYLNSRLETLAQQQKSRSVVHLARHLFFYGDYHGNRSPIADP 453

Query: 419 SMRAAMVGLSMDVSQDDLALAVLTAFEFIALQARHILDHMAAAGLHVDTVYLSGGQARNP 478
           SMRAA++G SMD S DDLAL  L A EFIA Q R I++ M  +G  +  +++SGGQ RN 
Sbjct: 454 SMRAAIIGQSMDNSIDDLALMYLGACEFIAQQTRQIVEKMTTSGHDMAAIFMSGGQCRNG 513

Query: 479 LLTQLLADAVRRPVVTPRHVGAAVVFGSALLAAAAVENY-LANTNATASSILPSSASRAP 537
           LL +LLAD    P+V PR++ AAVVFGSALL A A E++ L+ T +  S    SS +  P
Sbjct: 514 LLMRLLADCTGLPIVIPRYIDAAVVFGSALLGAVASESFDLSGTTSELSVSRKSSIAGHP 573

 Score = 68.2 bits (165), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 40/55 (72%)

Query: 541 LWQIMSRLTVPGNVVSPSPDADPDIRLLEAKYKVFLEMAEAQKLYRKLVDDVENT 595
           +W +M  +T  G VV P P+ +PD +LL+ KYK+FL+MAE Q+ YR LV++VE +
Sbjct: 671 MWNVMYNMTGGGKVVQPCPEDNPDRKLLDVKYKIFLDMAETQRKYRNLVNEVEKS 725

>KNAG0H03260 Chr8 (607908..609650) [1743 bp, 580 aa] {ON} Anc_8.257
           YDR109C
          Length = 580

 Score =  610 bits (1574), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 309/584 (52%), Positives = 390/584 (66%), Gaps = 14/584 (2%)

Query: 9   YYVGVDVGTEFARACIIDKSGAILATTQNPISRSQPKHDHITQSSSEIWGAVCKSVRAAV 68
           YY+GVDVGT  ARA ++   GA LA  ++PI R + + D ITQSSSEIW AVC  VR  V
Sbjct: 6   YYIGVDVGTGSARAVMLQHDGAALALEEHPIKRQELRVDFITQSSSEIWSAVCHCVRGVV 65

Query: 69  AESQVAVDEVAGINFDATCSLVVLDEDSDGEVAVGPDFSDNRQNVILWMDHRAVAEASEI 128
            +S V    V GI FDATCSLV +D  +   V VGP+F D+ QN+ILWMDHRA  E   I
Sbjct: 66  TKSGVNPRLVKGIGFDATCSLVAVDAVTGDAVPVGPNFDDSTQNIILWMDHRATRETDAI 125

Query: 129 NSTGHSVLRYVGGKMSVEMQMPKIKWLQRHMPRGEFAKCKFYDLPDFLTYQATGIESRSF 188
           N+TG   L+YVGG+MSVEM++PKIKWL+ HMPRG+F KCKF+DLPD+LT+ AT  + RSF
Sbjct: 126 NATGDRCLKYVGGQMSVEMELPKIKWLKGHMPRGQFTKCKFFDLPDYLTFMATAKDRRSF 185

Query: 189 CSTVCKMGLVPNGVDSSTSGWSREFLEQIGLEELCEDGFRRLGGALDEPGSEFRSAGEPV 248
           CS VCK GL+P GVD S   WS EFLE +GL EL +  F +LGG   E   +F +AG+PV
Sbjct: 186 CSAVCKQGLLPPGVDGSEGHWSPEFLEAVGLSELIDTNFVQLGGT-SESKPKFLTAGQPV 244

Query: 249 XXXXXXXXXXXXXTPRCVVGSGVIDAYAGWVGTVGASPDGARESGGVEELAGRLAAVAGT 308
                        +  C+V SGVIDAYAGW+G+VGA  D + +S G++    RLA +AGT
Sbjct: 245 GQLTLEASEQFGLSTSCIVASGVIDAYAGWIGSVGAKFDQSHKSSGLDVAITRLALIAGT 304

Query: 309 STCLIMLSQTPHFVEGVWGPYRDVLARGYWCTEGGQSCTGALLAHTLHTHPAYTELHQAA 368
           STC IMLS+ P FV GVWGPYRDVL  GYWC EGGQSCTGALLAH L THPA+ EL + A
Sbjct: 305 STCHIMLSKGPQFVPGVWGPYRDVLIPGYWCAEGGQSCTGALLAHILETHPAHEELVRLA 364

Query: 369 QQRGLTDFDYINWRLDKLRAETGARSIRALAKHRFLYGDYHGNRSPLADPSMRAAMVGLS 428
            ++ ++ F+Y+   LD L  +   R++  L++  FLYGD+HGNRSPLADPSMRA ++G S
Sbjct: 365 AKQQVSHFEYLGLMLDTLMMKRQVRNVLELSRSFFLYGDFHGNRSPLADPSMRATVIGQS 424

Query: 429 MDVSQDDLALAVLTAFEFIALQARHILDHMAAAGLHVDTVYLSGGQARNPLLTQLLADAV 488
           MDVS + LA+  L A EFIALQ R I++ M   G  V+ VY+SGGQ RN LL QL+AD+V
Sbjct: 425 MDVSIESLAVEYLAACEFIALQTRQIVETMVRNGHVVECVYMSGGQCRNSLLMQLIADSV 484

Query: 489 RRPVVTPRHVGAAVVFGSALLAAAAVENYLANTNATASSILPSSASRAPMHRLWQIMSRL 548
             PVV P++    VVFG+ALLA  A +       A  S+            RLW IM+ +
Sbjct: 485 GVPVVLPKYTDCCVVFGAALLACCASKG-CDGIEADQST------------RLWDIMTAM 531

Query: 549 TVPGNVVSPSPDADPDIRLLEAKYKVFLEMAEAQKLYRKLVDDV 592
           T  G  V P+ D+  + + ++AKY +FL+M E QKLYR  +D V
Sbjct: 532 TPMGTRVLPNDDSSFERKYMDAKYGIFLDMIERQKLYRSQMDQV 575

>Skud_4.370 Chr4 complement(645143..647287) [2145 bp, 714 aa] {ON}
           YDR109C (REAL)
          Length = 714

 Score =  603 bits (1555), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 316/675 (46%), Positives = 405/675 (60%), Gaps = 88/675 (13%)

Query: 8   QYYVGVDVGTEFARACIIDKSGAILATTQNPISRSQPKHDHITQSSSEIWGAVCKSVRAA 67
           ++YVGVDVGT  ARACIID+SG +L+  + PI R + + + ITQSS EIW AVC  V+A 
Sbjct: 38  KFYVGVDVGTGSARACIIDQSGNMLSLAEKPIKREELRPNFITQSSREIWDAVCHCVKAV 97

Query: 68  VAESQVAVDEVAGINFDATCSLVVLDEDSDGEVAVGPDFSDNRQNVILWMDHRAVAEASE 127
           + ES+V  D V G+ FDATCSLVV+       VAVGPDF+ N QN+ILWMDHRA+ E  E
Sbjct: 98  IQESRVDPDRVHGMGFDATCSLVVVSATDAKGVAVGPDFTKNDQNIILWMDHRAMKETEE 157

Query: 128 INSTGHSVLRYVGGKMSVEMQMPKIKWLQRHMPRGEFAKCKFYDLPDFLTYQATGIESRS 187
           INS+    L+YVGG+MSVEM++PKIKWL+ ++    F  CKF+DLPD+LT++ATG E+RS
Sbjct: 158 INSSEDKCLKYVGGQMSVEMEIPKIKWLKNNLRSELFQDCKFFDLPDYLTFKATGKENRS 217

Query: 188 FCSTVCKMGLVPNGVDSSTSGWSREFLEQIGLEELCEDGFRRLGGALDEPGSEFRSAGEP 247
           F S VCK G +P GV+ S  GWS EFL  IGL EL E  F +LGG+L      F SAGE 
Sbjct: 218 FSSAVCKQGFLPAGVEGSNLGWSEEFLNTIGLSELIESDFEKLGGSLRHK-KNFLSAGEC 276

Query: 248 VXXXXXXXXXXXXXTPRCVVGSGVIDAYAGWVGTVGASPDGARESGGVEE--------LA 299
           +             T  CVV SG+IDAYAGWVGTV A P+         E          
Sbjct: 277 IGSLDWKAARELGLTENCVVSSGLIDAYAGWVGTVAAKPESPIRGLAENEDNTYNYNGAI 336

Query: 300 GRLAAVAGTSTCLIMLSQTPHFVEGVWGPYRDVLARGYWCTEGGQSCTGALLAHTLHTHP 359
           GRLAAVAGTSTC I+LS+ P FV G+WGPYRDVLARG+W  EGGQSCTG LL H +  HP
Sbjct: 337 GRLAAVAGTSTCHILLSKDPIFVHGIWGPYRDVLARGFWAAEGGQSCTGVLLDHVIKIHP 396

Query: 360 AYTELHQAAQQRGLTDFDYINWRLDKLRAETGARSIRALAKHRFLYGDYHGNRSPLADPS 419
           AYTEL Q     G++ F+Y+N  L+ +  +   RS+ +LA+H F YGDYHGNRSP+AD +
Sbjct: 397 AYTELSQLTNAAGVSKFEYLNSMLETMVKKRNERSVISLARHLFFYGDYHGNRSPIADSN 456

Query: 420 MRAAMVGLSMDVSQDDLALAVLTAFEFIALQARHILDHMAAAGLHVDTVYLSGGQARNPL 479
           MRA ++G SMD S +DLA+  L+A EFI+ Q R I++ M  +G  +D +++SGGQ RN L
Sbjct: 457 MRACIIGQSMDNSVEDLAITYLSACEFISQQTRQIVEVMLKSGHKIDAIFMSGGQCRNDL 516

Query: 480 LTQLLADAVRRPVVTPRHVGAAVVFGSALLAAAA--------------------VENYLA 519
           LT+LLAD    P+V PR++  AVVFGSALL AAA                     + +  
Sbjct: 517 LTRLLADCSGLPIVIPRYIDGAVVFGSALLGAAASEAFDLAKGRRTLTTKKSSSAQEFFI 576

Query: 520 NT----------------NATASSILPSSASRAP--MHR--------------------- 540
           N+                + T S  LP+S S AP  M+R                     
Sbjct: 577 NSYPSPQNSAMRHQNLASDVTCSYNLPNSISSAPDTMNRHSSTISKQSRGDMSSEESSKG 636

Query: 541 --------------------LWQIMSRLTVPGNVVSPSPDADPDIRLLEAKYKVFLEMAE 580
                               LW++M  LT     V+P+    PD  LL+ KY++FL+MAE
Sbjct: 637 TLNTVALRSLEEKRYRGTGILWKVMQELTGDAKAVNPNKATHPDRILLDTKYQIFLDMAE 696

Query: 581 AQKLYRKLVDDVENT 595
            QK YR +VD++E +
Sbjct: 697 TQKRYRHMVDNLEES 711

>KLLA0F19041g Chr6 complement(1753543..1755834) [2292 bp, 763 aa]
           {ON} similar to uniprot|Q04585 Saccharomyces cerevisiae
           YDR109C Hypothetical ORF
          Length = 763

 Score =  604 bits (1558), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/535 (55%), Positives = 377/535 (70%), Gaps = 11/535 (2%)

Query: 9   YYVGVDVGTEFARACIIDKSGAILATTQNPISRSQPKHDHITQSSSEIWGAVCKSVRAAV 68
           YYVGVDVGT  ARAC+ID  G IL+  + PI R + K ++ITQSS EIW A+C  V+  V
Sbjct: 36  YYVGVDVGTGSARACVIDNLGNILSLAERPIQRHELKPNYITQSSQEIWNAICYCVKNVV 95

Query: 69  AESQVAVDEVAGINFDATCSLVVLDEDSDGEVAVGPDFSDNRQNVILWMDHRAVAEASEI 128
            +S V    + GI FDATCSLVV+D +++ +V VGPDF+DN QN+ILWMDHRA+ E  EI
Sbjct: 96  RDSGVDPRTIHGIGFDATCSLVVVDNNNE-DVGVGPDFTDNLQNIILWMDHRAIEETEEI 154

Query: 129 NSTGHSVLRYVGGKMSVEMQMPKIKWLQRHMPRGEFAKCKFYDLPDFLTYQATGIESRSF 188
           N+TG   L+YVGG+MSVEM++PKIKWL+ ++P  +FA+CKF+DL D+LT++ATG E RS+
Sbjct: 155 NATGDKCLKYVGGQMSVEMEIPKIKWLKNNIPEKKFAQCKFFDLADYLTFKATGSEIRSY 214

Query: 189 CSTVCKMGLVPNGVDSSTSGWSREFLEQIGLEELCEDGFRRLGGALDEPGSEFRSAGEPV 248
           CSTVCK GL+P GV+ S +GWS+EFL++IGLEEL  D F +LGG++ E  + F SAGE +
Sbjct: 215 CSTVCKQGLLPLGVEGSKNGWSKEFLQEIGLEELIADDFAKLGGSVTE--TTFLSAGECI 272

Query: 249 XXXXXXXXXXXXXTPRCVVGSGVIDAYAGWVGTVGASPD--------GARESGGVEELAG 300
                        +  CVVGSGVIDAYAGWVGTV A  D              G++   G
Sbjct: 273 GTLTEESAAELGLSTHCVVGSGVIDAYAGWVGTVAARTDVEIPALVKSDEVKHGIDRATG 332

Query: 301 RLAAVAGTSTCLIMLSQTPHFVEGVWGPYRDVLARGYWCTEGGQSCTGALLAHTLHTHPA 360
           RLAAVAGTSTC I +S+ P FV+GVWGPYRDV+A G+W  EGGQSCTGALLAH L THPA
Sbjct: 333 RLAAVAGTSTCHIAMSKDPIFVKGVWGPYRDVMAPGFWLAEGGQSCTGALLAHVLTTHPA 392

Query: 361 YTELHQAAQQRGLTDFDYINWRLDKLRAETGARSIRALAKHRFLYGDYHGNRSPLADPSM 420
           Y EL Q +    ++ FDY+N RL+ L  +  A S+ ALAKH F YGDYHGNRSP+ADPSM
Sbjct: 393 YAELSQLSDAANVSKFDYLNSRLELLAQQRKASSVVALAKHLFFYGDYHGNRSPIADPSM 452

Query: 421 RAAMVGLSMDVSQDDLALAVLTAFEFIALQARHILDHMAAAGLHVDTVYLSGGQARNPLL 480
           RAA++G SMD S DDL++  L A EFIA Q R I++ M  +G  +  +++SGGQ RN LL
Sbjct: 453 RAAIIGQSMDNSIDDLSIMYLGACEFIAQQTRQIVEQMCNSGHELAAIFMSGGQCRNGLL 512

Query: 481 TQLLADAVRRPVVTPRHVGAAVVFGSALLAAAAVENYLANTNATASSILPSSASR 535
            +LLAD    P+V PR++ AAVVFGSALL A A E++ A      ++  P++ S 
Sbjct: 513 MRLLADCTGLPIVIPRYIDAAVVFGSALLGAVASESFNACAKLEETASDPATTSN 567

 Score = 63.2 bits (152), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 28/54 (51%), Positives = 39/54 (72%)

Query: 540 RLWQIMSRLTVPGNVVSPSPDADPDIRLLEAKYKVFLEMAEAQKLYRKLVDDVE 593
           +LW++M  +T  G VV P+ +  PD  LL AKYK+FL+MA  Q+ YRKLVD+V+
Sbjct: 710 KLWEVMYNMTGGGKVVWPTEEDAPDRLLLNAKYKIFLDMAATQQKYRKLVDEVK 763

>CAGL0B01727g Chr2 complement(159373..161106) [1734 bp, 577 aa] {ON}
           similar to uniprot|Q04585 Saccharomyces cerevisiae
           YDR109c
          Length = 577

 Score =  594 bits (1532), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 288/587 (49%), Positives = 388/587 (66%), Gaps = 19/587 (3%)

Query: 9   YYVGVDVGTEFARACIIDKSGAILATTQNPISRSQPKHDHITQSSSEIWGAVCKSVRAAV 68
           YY+GVDVG+   RAC++D  GA+L+     IS+ +    H+TQSS+EIW AVC  V++A+
Sbjct: 3   YYIGVDVGSGSVRACVVDDQGAMLSMATRDISKEEKLPGHVTQSSNEIWDAVCYCVKSAI 62

Query: 69  AESQVAVDEVAGINFDATCSLVVLDEDSDGEVAVGPDFSDNRQNVILWMDHRAVAEASEI 128
             S V   ++ GI FDATCSLVVL++DS   VA GP+F +N QN+I+WMDHRA+ E  EI
Sbjct: 63  GNSNVNNGDILGIGFDATCSLVVLNKDSFEPVAAGPNFDNNNQNIIMWMDHRAIEETKEI 122

Query: 129 NSTGHSVLRYVGGKMSVEMQMPKIKWLQRHMPRGEFAKCKFYDLPDFLTYQATGIESRSF 188
           N +G   L+YVGG+MSVEM++PKIKWL+ HM   EF K  F DLPD+LT+ A+G+ +RS+
Sbjct: 123 NRSGDPCLKYVGGQMSVEMEIPKIKWLKNHMAPEEFKKLVFMDLPDYLTFMASGVNTRSY 182

Query: 189 CSTVCKMGLVPNGVDSSTSGWSREFLEQIGLEELCEDGFRRLGGALDEPGSEFRSAGEPV 248
           CS VCK G +P GV+ S+ GWS EFL +IGLEE+ +  F  LGG  +E G+ F  AG  +
Sbjct: 183 CSAVCKQGFLPKGVEGSSKGWSTEFLTKIGLEEISQSNFNALGGP-NESGN-FTYAGNQL 240

Query: 249 XXXXXXXXXXXXXTPRCVVGSGVIDAYAGWVGTVGAS----PDGARESGGVEELAGRLAA 304
                         P C+VGSG+IDAYAGW+GTV +S    P+  +E   +EE AGRLAA
Sbjct: 241 STVSESFIKSTNINPGCIVGSGIIDAYAGWIGTVASSTIEVPNN-KEVVDIEECAGRLAA 299

Query: 305 VAGTSTCLIMLSQTPHFVEGVWGPYRDVLARGYWCTEGGQSCTGALLAHTLHTHPAYTEL 364
           VAGTSTC I+LS+T  FV GVWGPYRDVL   YWC EGGQS TGALLAH L  HP+  EL
Sbjct: 300 VAGTSTCHIVLSKTSIFVPGVWGPYRDVLVPDYWCAEGGQSFTGALLAHILSIHPSANEL 359

Query: 365 HQAAQQRGLTDFDYINWRLDKLRAETGARSIRALAKHRFLYGDYHGNRSPLADPSMRAAM 424
               +QR +  F ++N  + +L  +    +   L K  FLYGDYHGNRSP+ADP+MRAA+
Sbjct: 360 SNLVKQRNVDKFSFLNNYILELSRKNNLETPLLLTKDFFLYGDYHGNRSPIADPNMRAAI 419

Query: 425 VGLSMDVSQDDLALAVLTAFEFIALQARHILDHMAAAGLHVDTVYLSGGQARNPLLTQLL 484
           +G SMD S DDLA   L A EFIA Q +HI+D +  AG  +  +Y+SGGQ RN +L QL+
Sbjct: 420 IGQSMDTSMDDLARTYLAACEFIAHQTKHIIDTLMNAGHTIKAIYMSGGQCRNNILMQLI 479

Query: 485 ADAVRRPVVTPRHVGAAVVFGSALLAAAAVENYLANTNATASSILPSSASRAPMHRLWQI 544
           A+    P++ P+++ +AVVFGSA+L A A  +   N++   + +            LW  
Sbjct: 480 ANCTGLPLIIPKYIDSAVVFGSAILGAMAYSSSKNNSDKGGADL------------LWST 527

Query: 545 MSRLTVPGNVVSPSPDADPDIRLLEAKYKVFLEMAEAQKLYRKLVDD 591
           MS +T  G  V P+ +   + +L+  K+K+FL+MA+ Q+ YR+LV++
Sbjct: 528 MSNMTPDGTTVFPATEDSIERKLINVKHKIFLDMAKTQQTYRQLVEN 574

>KAFR0B05560 Chr2 (1138380..1140197) [1818 bp, 605 aa] {ON}
           Anc_8.257 YDR109C
          Length = 605

 Score =  595 bits (1533), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/592 (50%), Positives = 388/592 (65%), Gaps = 20/592 (3%)

Query: 9   YYVGVDVGTEFARACIIDKSGAILATTQNPISRSQPKHDHITQSSSEIWGAVCKSVRAAV 68
           +++GVDVGT   RAC+ID+ G ILA    PISR + K   ITQSS EIW ++C  VR  +
Sbjct: 20  HFIGVDVGTGSVRACVIDRKGDILALVDKPISREELKPGFITQSSEEIWDSICFCVRKVI 79

Query: 69  AESQVAVDEVAGINFDATCSLVVLDEDSDGEVAVGPDFSDNRQNVILWMDHRAVAEASEI 128
           A++++  ++V GI FDATCSL V+D+D+   +AVGP FS N QN+I+WMDHRA  E  EI
Sbjct: 80  ADAKIPANKVIGIGFDATCSLAVVDKDTLEGLAVGPQFSKNDQNIIMWMDHRASQETDEI 139

Query: 129 NSTGHSVLRYVGGKMSVEMQMPKIKWLQRHMPRGEFAKCKFYDLPDFLTYQATGIESRSF 188
           NS   + L+YVGGKMS+EM+MPKIKWL+ HMPR  F K  F+DLPD+LT++ATG+++RS 
Sbjct: 140 NSIYDAPLKYVGGKMSIEMEMPKIKWLKNHMPRETFRKAVFFDLPDYLTFKATGMQNRSL 199

Query: 189 CSTVCKMGLVPNGVDSSTSGWSREFLEQIGLEELCEDGFRRLGGALDEPGS---EFRSAG 245
           CS VCK GL+P GV+ ST GWSR FL   GL EL E+ F R+GG    PG+    F SAG
Sbjct: 200 CSAVCKQGLLPIGVEGSTEGWSRTFLSNTGLPELIENEFERIGG----PGNNSRNFLSAG 255

Query: 246 EPVXXXXXXXXXXXXXTPRCVVGSGVIDAYAGWVGTVGASPD-GAR---ESGG--VEELA 299
           E V             T  CVVGSG+IDAYAG +GT+ A  D  AR   ++ G  ++   
Sbjct: 256 EYVSTLSKSSGEQLGLTESCVVGSGLIDAYAGLIGTIAARIDESARTQDDANGQDLQNAI 315

Query: 300 GRLAAVAGTSTCLIMLSQTPHFVEGVWGPYRDVLARGYWCTEGGQSCTGALLAHTLHTHP 359
           GRLAAVAGTSTC I LS  P FV GVWGPY+D+LA+ YWC EGGQSCTG LL H + THP
Sbjct: 316 GRLAAVAGTSTCHITLSDKPIFVNGVWGPYKDILAKDYWCAEGGQSCTGELLKHVITTHP 375

Query: 360 AYTELHQAAQQRGLTDFDYINWRLDKLRAETGARSIRALAKHRFLYGDYHGNRSPLADPS 419
           AY EL   A +  L  F+ +N  +  L  + G  +I  L K  FLYGDYHGNRSP+ADP 
Sbjct: 376 AYEELKIKAAKSKLDLFECLNEIIRDLAEQKGTCTILELTKGLFLYGDYHGNRSPIADPR 435

Query: 420 MRAAMVGLSMDVSQDDLALAVLTAFEFIALQARHILDHMAAAGLHVDTVYLSGGQARNPL 479
           MRA+++G SMD + + LAL  L A EFIA Q RHI+  M  AG  + ++Y+SGGQ RN +
Sbjct: 436 MRASIIGQSMDTTVESLALIYLAACEFIAHQTRHIITKMNEAGHSIRSIYMSGGQCRNNI 495

Query: 480 LTQLLADAVRRPVVTPRHVGAAVVFGSALLAAAAVENYLANTNATASSILPSSASRAPMH 539
           L +LLAD    PVV P+++ AAVVFG+AL+ A A + +  N   T    +P        H
Sbjct: 496 LMELLADFTGLPVVIPKYIDAAVVFGAALIGATAWDVF--NQCETNDDRVPQVE-----H 548

Query: 540 RLWQIMSRLTVPGNVVSPSPDADPDIRLLEAKYKVFLEMAEAQKLYRKLVDD 591
            LW  M ++T  G  ++P  +      LL  KYK++++MA+ QK YR L+DD
Sbjct: 549 TLWNAMVKMTGNGTTIAPKVNRHASQALLNTKYKIYMDMAKTQKKYRSLIDD 600

>TDEL0F03840 Chr6 complement(705363..707543) [2181 bp, 726 aa] {ON}
           Anc_8.257 YDR109C
          Length = 726

 Score =  598 bits (1542), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/581 (52%), Positives = 393/581 (67%), Gaps = 32/581 (5%)

Query: 1   MSAAEMKQ---YYVGVDVGTEFARACIIDKSGAILATTQNPISRSQPKHDHITQSSSEIW 57
           M+A  ++Q   YYVGVDVGT  ARACIID +G IL+  + PI R + K ++ITQSS EIW
Sbjct: 23  MAAISLEQAMIYYVGVDVGTGSARACIIDNTGNILSLAEKPIQREELKPNYITQSSQEIW 82

Query: 58  GAVCKSVRAAVAESQVAVDEVAGINFDATCSLVVLDEDSDGEVAVGPDFSDNRQNVILWM 117
            ++C  V++ V +S V V+ + GI FDATCSLVV+D D D EV VGP F++N QN++LWM
Sbjct: 83  QSICHCVKSVVRDSGVPVERIHGIGFDATCSLVVVD-DEDKEVGVGPVFANNDQNIVLWM 141

Query: 118 DHRAVAEASEINSTGHSVLRYVGGKMSVEMQMPKIKWLQRHMPRGEFAKCKFYDLPDFLT 177
           DHRA+AE +EIN+T    L+YVGG+MSVEM++PKIKWL+ ++P+ +F KCKF+DL D+LT
Sbjct: 142 DHRAIAETNEINATNDKCLKYVGGQMSVEMEIPKIKWLKNNLPKEQFDKCKFFDLADYLT 201

Query: 178 YQATGIESRSFCSTVCKMGLVPNGVDSSTSGWSREFLEQIGLEEL-----CEDGFRRLGG 232
           ++AT  ++RSFCSTVCK GL+P GV+ S  GWS++FL  I L EL     C+D +     
Sbjct: 202 FKATNKDTRSFCSTVCKQGLIPIGVEGSKEGWSKDFLNTINLPELVENVFCQDRWPATAT 261

Query: 233 ALDEPGSEFRSAGEPVXXXXXXXXXXXXXTPRCVVGSGVIDAYAGWVGTVGAS-----PD 287
           A D     F SAGE V                CVVGSGVIDAYAGWVGTV A      PD
Sbjct: 262 AADGTTHSFLSAGEYVGALDEEAAEELGLPVHCVVGSGVIDAYAGWVGTVAAQTDVELPD 321

Query: 288 GA---RESGGVEELAGRLAAVAGTSTCLIMLSQTPHFVEGVWGPYRDVLARGYWCTEGGQ 344
            A   R   G++   GRLAAVAGTSTC I LS+ P FV GVWGPYRDV+A G+W  EGGQ
Sbjct: 322 LAEADRTKKGIDRATGRLAAVAGTSTCHIALSRDPVFVNGVWGPYRDVMAHGFWAAEGGQ 381

Query: 345 SCTGALLAHTLHTHPAYTELHQAAQQRGLTDFDYINWRLDKLRAETGARSIRALAKHRFL 404
           SCTGALLAH + THPA+TEL   +    ++ FDY+N RL+ L  + G RS+ ALAKH + 
Sbjct: 382 SCTGALLAHVMSTHPAFTELSHLSDAANISKFDYLNSRLETLVQQRGDRSVVALAKHLYF 441

Query: 405 YGDYHGNRSPLADPSMRAAMVGLSMDVSQDDLALAVLTAFEFIALQARHILDHMAAAGLH 464
           YGDYHGNRSP+ADPSMRAA++G SMD S DDLA+  L A EFIA Q R I++ M  AG  
Sbjct: 442 YGDYHGNRSPIADPSMRAAIIGQSMDNSIDDLAIMYLGACEFIAQQTRQIVEKMCDAGHQ 501

Query: 465 VDTVYLSGGQARNPLLTQLLADAVRRPVVTPRHVGAAVVFGSALLAAAAVENYLAN---- 520
           + T+++SGGQ RN LL +LLAD    P++ PR++ AAVVFGSALL A A E++ ++    
Sbjct: 502 ISTIFMSGGQCRNGLLMRLLADCTGLPIIIPRYIDAAVVFGSALLGAVASESFNSHHAKS 561

Query: 521 ----------TNATASSILPSSASRAPMHRLWQIMSRLTVP 551
                     TN   SS LPS++ + P+ +L ++   L  P
Sbjct: 562 EITRRRKSSLTNLDPSS-LPSASGKGPLSQLGKMKPDLPSP 601

 Score = 68.2 bits (165), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 32/65 (49%), Positives = 45/65 (69%), Gaps = 3/65 (4%)

Query: 533 ASRAPMHR---LWQIMSRLTVPGNVVSPSPDADPDIRLLEAKYKVFLEMAEAQKLYRKLV 589
           A+R P +    LW +M ++T  G VV PSP+ DPD  LL AKYK+FL+MA++Q+ YR+ +
Sbjct: 658 ATRNPPNNGDALWDVMYQMTGGGKVVRPSPEDDPDRVLLNAKYKIFLDMADSQRRYREAI 717

Query: 590 DDVEN 594
           D VE 
Sbjct: 718 DKVEK 722

>YDR109C Chr4 complement(673520..675667) [2148 bp, 715 aa] {ON}
           Putative kinase
          Length = 715

 Score =  597 bits (1540), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 290/518 (55%), Positives = 364/518 (70%), Gaps = 9/518 (1%)

Query: 8   QYYVGVDVGTEFARACIIDKSGAILATTQNPISRSQPKHDHITQSSSEIWGAVCKSVRAA 67
           ++YVGVDVGT  ARAC+ID+SG +L+  + PI R Q   + ITQSS EIW AVC  VR  
Sbjct: 38  KFYVGVDVGTGSARACVIDQSGNMLSLAEKPIKREQLISNFITQSSREIWNAVCYCVRTV 97

Query: 68  VAESQVAVDEVAGINFDATCSLVVLDEDSDGEVAVGPDFSDNRQNVILWMDHRAVAEASE 127
           V ES V  + V GI FDATCSLVV+   +  E+AVGPDF++N QN+ILWMDHRA+ E  E
Sbjct: 98  VEESGVDPERVRGIGFDATCSLVVVSATNFEEIAVGPDFTNNDQNIILWMDHRAMKETEE 157

Query: 128 INSTGHSVLRYVGGKMSVEMQMPKIKWLQRHMPRGEFAKCKFYDLPDFLTYQATGIESRS 187
           INS+G   L+YVGG+MSVEM++PKIKWL+ ++  G F  CKF+DLPD+LT++ATG E+RS
Sbjct: 158 INSSGDKCLKYVGGQMSVEMEIPKIKWLKNNLEAGIFQDCKFFDLPDYLTFKATGKENRS 217

Query: 188 FCSTVCKMGLVPNGVDSSTSGWSREFLEQIGLEELCEDGFRRLGGALDEPGSEFRSAGEP 247
           FCS VCK G +P GV+ S  GWS+EFL  IGL EL ++ F RLGG+L E    F +AGE 
Sbjct: 218 FCSAVCKQGFLPVGVEGSDIGWSKEFLNSIGLSELTKNDFERLGGSLREK-KNFLTAGEC 276

Query: 248 VXXXXXXXXXXXXXTPRCVVGSGVIDAYAGWVGTVGASPDGARESGGVEE--------LA 299
           +             T  CVV SG+IDAYAGWVGTV A P+ A +     E          
Sbjct: 277 ISPLDKKAACQLGLTEHCVVSSGIIDAYAGWVGTVAAKPESAVKGLAETENYKKDFNGAI 336

Query: 300 GRLAAVAGTSTCLIMLSQTPHFVEGVWGPYRDVLARGYWCTEGGQSCTGALLAHTLHTHP 359
           GRLAAVAGTSTC I+LS+ P FV GVWGPYRDVLARG+W  EGGQSCTG LL H + THP
Sbjct: 337 GRLAAVAGTSTCHILLSKNPIFVHGVWGPYRDVLARGFWAAEGGQSCTGVLLDHLITTHP 396

Query: 360 AYTELHQAAQQRGLTDFDYINWRLDKLRAETGARSIRALAKHRFLYGDYHGNRSPLADPS 419
           A+TEL   A   G++ F+Y+N  L+ L  +   RS+ +LAKH F YGDYHGNRSP+ADP+
Sbjct: 397 AFTELSHMANLAGVSKFEYLNKILETLVEKRKVRSVISLAKHLFFYGDYHGNRSPIADPN 456

Query: 420 MRAAMVGLSMDVSQDDLALAVLTAFEFIALQARHILDHMAAAGLHVDTVYLSGGQARNPL 479
           MRA ++G SMD S +DLA+  L+A EFI+ Q R I++ M  +G  ++ +++SGGQ RN L
Sbjct: 457 MRACIIGQSMDNSIEDLAVMYLSACEFISQQTRQIIEVMLKSGHEINAIFMSGGQCRNSL 516

Query: 480 LTQLLADAVRRPVVTPRHVGAAVVFGSALLAAAAVENY 517
           L +LLAD    P+V PR+V AAVVFGSALL AAA E++
Sbjct: 517 LMRLLADCTGLPIVIPRYVDAAVVFGSALLGAAASEDF 554

 Score = 59.3 bits (142), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 24/55 (43%), Positives = 37/55 (67%)

Query: 541 LWQIMSRLTVPGNVVSPSPDADPDIRLLEAKYKVFLEMAEAQKLYRKLVDDVENT 595
           LW++M  LT    +V+P+    PD  LL+ KY++FL+M E Q+ YR++VD VE +
Sbjct: 658 LWKVMQELTGNARIVNPNEKTHPDRILLDTKYQIFLDMIETQRKYRRMVDKVEGS 712

>ZYRO0C01782g Chr3 (137232..139424) [2193 bp, 730 aa] {ON} similar
           to uniprot|Q04585 Saccharomyces cerevisiae YDR109C
           Hypothetical ORF
          Length = 730

 Score =  591 bits (1523), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 295/528 (55%), Positives = 369/528 (69%), Gaps = 12/528 (2%)

Query: 9   YYVGVDVGTEFARACIIDKSGAILATTQNPISRSQPKHDHITQSSSEIWGAVCKSVRAAV 68
           YY+GVDVGT  ARAC+ID  G I++  + PI R + K  +ITQSS EIW A+C  V+  V
Sbjct: 33  YYIGVDVGTGSARACLIDSMGNIMSLAEKPIQREELKPTYITQSSKEIWSAICYCVKTVV 92

Query: 69  AESQVAVDEVAGINFDATCSLVVLDEDSDGEVAVGPDFSDNRQNVILWMDHRAVAEASEI 128
            +S V ++ + GI FDATCSLV ++     +V VGPDF +  QN+ILWMDHRAV E +EI
Sbjct: 93  RDSGVDIERIHGIGFDATCSLVAVNSKDGADVPVGPDFENPDQNIILWMDHRAVQETAEI 152

Query: 129 NSTGHSVLRYVGGKMSVEMQMPKIKWLQRHMPRGEFAKCKFYDLPDFLTYQATGIESRSF 188
           NST H VL+YVGG+MS+EM++PKIKWL+ HMPR +F    F+DL DFLTY+ATG+ +RSF
Sbjct: 153 NSTNHPVLKYVGGQMSIEMEIPKIKWLKNHMPREKFNDTVFFDLADFLTYKATGLGTRSF 212

Query: 189 CSTVCKMGLVPNGVDSSTSGWSREFLEQIGLEELCEDGFRRLGGALDEPG----SEFRSA 244
            S+VCK GL+P GV+ S +GWS EFL  I L EL  + F +LGG++   G    S F SA
Sbjct: 213 NSSVCKQGLLPLGVEGSNNGWSGEFLNLIDLPELVANDFAKLGGSVKPKGDDHRSNFLSA 272

Query: 245 GEPVXXXXXXXXXXXXXTPRCVVGSGVIDAYAGWVGTVGAS-----PDGAR-ESG--GVE 296
           G+ V                CVVGSGVIDAYAGWVGTV A      P+ A+ E G  GV+
Sbjct: 273 GQYVGALSPEAAADLGLADHCVVGSGVIDAYAGWVGTVAAQTDEEIPELAKCEKGKLGVD 332

Query: 297 ELAGRLAAVAGTSTCLIMLSQTPHFVEGVWGPYRDVLARGYWCTEGGQSCTGALLAHTLH 356
           +  GRLAAVAGTSTC + LS+ P FV GVWGPYRDV+A G+WC EGGQSCTGALLAH L 
Sbjct: 333 KATGRLAAVAGTSTCHVALSRDPIFVPGVWGPYRDVMAPGFWCAEGGQSCTGALLAHVLS 392

Query: 357 THPAYTELHQAAQQRGLTDFDYINWRLDKLRAETGARSIRALAKHRFLYGDYHGNRSPLA 416
           THPAYT+L   ++  GL+ FDY+N RL+ L      RS+ ALAKH F YGDYHGNRSP+A
Sbjct: 393 THPAYTDLEHLSESAGLSKFDYLNSRLEYLVNARKERSVVALAKHLFFYGDYHGNRSPIA 452

Query: 417 DPSMRAAMVGLSMDVSQDDLALAVLTAFEFIALQARHILDHMAAAGLHVDTVYLSGGQAR 476
           D +MRAA++G SMD S DDLAL  L A EFIA Q R I++ M  +G ++ ++++SGGQ R
Sbjct: 453 DNTMRAAIIGQSMDNSVDDLALQYLGACEFIAQQTRQIVEIMCKSGHNISSIFMSGGQCR 512

Query: 477 NPLLTQLLADAVRRPVVTPRHVGAAVVFGSALLAAAAVENYLANTNAT 524
           N LL +LLAD    P++ PR++ AAVVFGSALL A A E+Y A+   T
Sbjct: 513 NGLLMRLLADCTGLPIIIPRYIDAAVVFGSALLGAVASESYNAHHTKT 560

 Score = 65.5 bits (158), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 28/53 (52%), Positives = 37/53 (69%)

Query: 541 LWQIMSRLTVPGNVVSPSPDADPDIRLLEAKYKVFLEMAEAQKLYRKLVDDVE 593
           LW++M  +T  G VV P+PD +PD  LL AKYK+FL+MA  Q+ YR  +D VE
Sbjct: 669 LWKVMYDMTGGGKVVRPNPDTNPDRVLLNAKYKIFLDMANTQRQYRSAIDRVE 721

>NCAS0B03870 Chr2 (689411..691201) [1791 bp, 596 aa] {ON} Anc_8.257
          Length = 596

 Score =  583 bits (1504), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 285/602 (47%), Positives = 393/602 (65%), Gaps = 31/602 (5%)

Query: 5   EMKQYYVGVDVGTEFARACIIDKSGAILATTQNPISRSQPKHDHITQSSSEIWGAVCKSV 64
           E   YYVG+DVGT   RAC++D  G +L+  +  I+R + K + ITQS+ EIW A C  V
Sbjct: 12  EQTGYYVGIDVGTGSVRACVVDSCGNMLSLVEKSINREELKPNFITQSTREIWQACCFCV 71

Query: 65  RAAVAESQVAVDEVAGINFDATCSLVVLDEDSDGEVAVGPDFSDNRQNVILWMDHRAVAE 124
           + A+ + +V    V GI FDATCSLV +++ +D +V VGP+F +   NVILWMDHRAV E
Sbjct: 72  KTAIEQCKVDKSLVLGIGFDATCSLVAIEKGTDKQVGVGPNFENRDMNVILWMDHRAVKE 131

Query: 125 ASEINSTGHSVLRYVGGKMSVEMQMPKIKWLQRHMPRGEFAKCKFYDLPDFLTYQATGIE 184
           A+EIN+T    L+YVGG MSVEM +PKIKWL+ +M    F KC+F++L D+LT++ATG  
Sbjct: 132 ANEINATNDKCLKYVGGAMSVEMDIPKIKWLKNNMDPNMFKKCEFFELADYLTFKATGKR 191

Query: 185 SRSFCSTVCKMGLVPNGVDSSTSGWSREFLEQIGLEELCEDGFRRLGGAL-DEPGSEFRS 243
           +RSFCS VCK G +PNGV+ S+ GWS+EFL  IGLE+L  + +  LGGAL ++    F+S
Sbjct: 192 TRSFCSVVCKQGFLPNGVEGSSEGWSKEFLSSIGLEDLAGNSYDSLGGALKNDSQDNFQS 251

Query: 244 AGEPVXXXXXXXXXXXXXTPRCVVGSGVIDAYAGWVGTVGASPDGARE-----SGGVEEL 298
           +G+ +             +  CVVG+G+IDAYAG +GT+ A+ +G+ +     S G++  
Sbjct: 252 SGKCLGPLSNEAVIELGLSENCVVGAGIIDAYAGLIGTIAATSEGSHQIKNDSSIGLQNA 311

Query: 299 AGRLAAVAGTSTCLIMLSQTPHFVEGVWGPYRDVLARGYWCTEGGQSCTGALLAHTLHTH 358
            GRLA+VAGTSTC ++LS+ P FV GVWGPYRDV+A GYWC EGGQ+CTG LL++ L  H
Sbjct: 312 IGRLASVAGTSTCHLLLSKDPVFVPGVWGPYRDVVADGYWCAEGGQTCTGELLSYVLSIH 371

Query: 359 PAYTELHQAAQQRGLTDFDYINWRLDKLRAETGARSIRALAKHRFLYGDYHGNRSPLADP 418
           PA+ EL  A+    +  F Y+N  LD+L  +    S   LAKH F YGDY GNRSP ADP
Sbjct: 372 PAFKELINASGVAKIDKFQYLNNMLDELTIKHKVNSKLQLAKHIFFYGDYRGNRSPYADP 431

Query: 419 SMRAAMVGLSMDVSQDDLALAVLTAFEFIALQARHILDHMAAAGLHVDTVYLSGGQARNP 478
            M AA++G SM+ + ++LA+  L A EFIA Q R I++ +  AG HV  +Y+SGGQ RN 
Sbjct: 432 MMSAAIIGQSMNHNLENLAVTYLAACEFIAQQTRQIVETIRKAGTHVSYIYMSGGQCRNK 491

Query: 479 LLTQLLADAVRRPVVTPRHVGAAVVFGSALLAAAAVENYLANTNATASSILPSSASRAPM 538
           LL +LL+D    P++ P++V AAVVFG+A+L A A                   ASR  +
Sbjct: 492 LLMKLLSDCTGLPIMLPKYVDAAVVFGAAILGATA------------------DASRKSV 533

Query: 539 H-------RLWQIMSRLTVPGNVVSPSPDADPDIRLLEAKYKVFLEMAEAQKLYRKLVDD 591
                    LW+ M R+T  G ++ P+    PD +LL+ KY++FL+MAE Q+ YR++VDD
Sbjct: 534 EIECDFGFMLWETMDRMTPHGTLLEPNDVNHPDRKLLDVKYQIFLDMAETQRKYRQMVDD 593

Query: 592 VE 593
           ++
Sbjct: 594 ID 595

>TBLA0E04400 Chr5 complement(1119643..1121412) [1770 bp, 589 aa]
           {ON} Anc_8.257 YDR109C
          Length = 589

 Score =  583 bits (1502), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/595 (49%), Positives = 386/595 (64%), Gaps = 23/595 (3%)

Query: 9   YYVGVDVGTEFARACIIDKSGAILATTQNPISRSQPKHDHITQSSSEIWGAVCKSVRAAV 68
           YY+GVDVGT  ARAC+ID +G IL+  +  I R + K  +ITQS+++IW  +C  +R  +
Sbjct: 3   YYIGVDVGTGSARACLIDLNGDILSIKELAIDRQELKPGYITQSTNQIWNNICICIRNIL 62

Query: 69  AESQV--AVDEVAGINFDATCSLVVLDEDSDGEVAVGPDFSDNRQNVILWMDHRAVAEAS 126
            ES V     ++ GI FDATCSLVVL+  +D EVAVGP+F DN QNVILWMDHRA+ E  
Sbjct: 63  QESNVDDISSKIKGIGFDATCSLVVLNSKTDQEVAVGPNFEDNDQNVILWMDHRALIETV 122

Query: 127 EINSTGHSVLRYVGGKMSVEMQMPKIKWLQRHMPRGEFAKCKFYDLPDFLTYQATGIESR 186
           EINST    L+YVGG+MSVEM++PKIKWL+ +M    +  CKF DLPDFLTY+ATG   R
Sbjct: 123 EINSTDSKCLKYVGGQMSVEMEIPKIKWLKNNMNPAVYKDCKFLDLPDFLTYKATGNSIR 182

Query: 187 SFCSTVCKMGLVPNGVDSSTSGWSREFLEQIGLEELCEDGFRRLGGAL--DEPGS-EFRS 243
           SFCS VCK GL+P GV+ ST GW+ EFL  IGLE+L ED F +LGG +  D  G   F +
Sbjct: 183 SFCSAVCKQGLLPLGVEGSTKGWTEEFLLNIGLEDLMEDNFVKLGGPVKQDSQGKVSFST 242

Query: 244 AGEPVXXXXXXXXXXXXXTPRCVVGSGVIDAYAGWVGTVGASPDGARES--------GGV 295
           AGE +             + +C V SG+IDAYAGW+GT+ AS     E          G+
Sbjct: 243 AGEFIGYLSDKSSKIMGISSKCAVSSGIIDAYAGWIGTIAASTKEPIEQLNNFQDNLNGM 302

Query: 296 EELAGRLAAVAGTSTCLIMLSQTPHFVEGVWGPYRDVLARGYWCTEGGQSCTGALLAHTL 355
              +GRLA VAGTSTC I L+  P FV GVWGPYRDVL   +WC EGGQSCTGALL H L
Sbjct: 303 ICSSGRLAVVAGTSTCHISLTNKPIFVPGVWGPYRDVLGHNFWCAEGGQSCTGALLQHVL 362

Query: 356 HTHPAYTELHQAAQQRGLTDFDYINWRLDKLRAETGARSIRALAKHRFLYGDYHGNRSPL 415
            THPAY EL   ++Q+ ++ F+ +N ++ +L  +        L K+ F YGD+HGNRSP+
Sbjct: 363 ETHPAYKELCAISKQQDISVFEVLNNKIRELTHQRDLIDEVHLIKNLFFYGDFHGNRSPV 422

Query: 416 ADPSMRAAMVGLSMDVSQDDLALAVLTAFEFIALQARHILDHMAAAGLHVDTVYLSGGQA 475
           AD +MR  ++GLSMD S +DL    L A EFIA Q RHI+D M  +G ++ ++Y+SGGQ 
Sbjct: 423 ADEAMRGNIIGLSMDSSLNDLCRMYLGACEFIAQQTRHIVDIMTKSGYNLHSLYMSGGQC 482

Query: 476 RNPLLTQLLADAVRRPVVTPRHVGAAVVFGSALLAAAAVENYLANTNATASSILPSSASR 535
           RN LL QL+++ V  PVV P+++  AVVFGSAL+ A A E  L+ ++        S  ++
Sbjct: 483 RNELLMQLISNCVGLPVVIPKNIDTAVVFGSALMGACASE--LSKSH--------SDNTK 532

Query: 536 APMHRLWQIMSRLTVPGNVVSPSPDADPDIRLLEAKYKVFLEMAEAQKLYRKLVD 590
            P   LW +M ++T  G VVSP   +    +LL  KY+++L+M   QK YR +V+
Sbjct: 533 KPDQILWDVMCKMTGQGIVVSPQDPSSQVCKLLTVKYQIYLDMIATQKRYRSMVN 587

>Suva_2.269 Chr2 complement(467973..470150) [2178 bp, 725 aa] {ON}
           YDR109C (REAL)
          Length = 725

 Score =  587 bits (1514), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 287/517 (55%), Positives = 357/517 (69%), Gaps = 9/517 (1%)

Query: 7   KQYYVGVDVGTEFARACIIDKSGAILATTQNPISRSQPKHDHITQSSSEIWGAVCKSVRA 66
           ++++VGVDVGT   RACIID+ G IL+  + PI R + + + ITQSS EIW AVC  V+A
Sbjct: 41  EKFHVGVDVGTGSTRACIIDQFGKILSLAEKPIKREEVRSNFITQSSKEIWDAVCHCVKA 100

Query: 67  AVAESQVAVDEVAGINFDATCSLVVLDEDSDGEVAVGPDFSDNRQNVILWMDHRAVAEAS 126
            + ES+V   +V GI FDATCSLVV+       +AVGPDFS+N QN+ILWMDHRA+ E  
Sbjct: 101 VLQESEVDPKKVHGIGFDATCSLVVVSATDLKGIAVGPDFSNNDQNIILWMDHRAMKETE 160

Query: 127 EINSTGHSVLRYVGGKMSVEMQMPKIKWLQRHMPRGEFAKCKFYDLPDFLTYQATGIESR 186
           EINSTG   L+YVGG+MSVEM +PKIKWL+ ++    F  CKF++LPD+LT++ATG E+R
Sbjct: 161 EINSTGDKCLKYVGGQMSVEMDIPKIKWLKNNLEAEIFKDCKFFNLPDYLTFKATGKENR 220

Query: 187 SFCSTVCKMGLVPNGVDSSTSGWSREFLEQIGLEELCEDGFRRLGGALDEPGSEFRSAGE 246
           SF S VCK G +P GV+SS  GWS EFL  IGL EL  + F RLGG+L +    F SAGE
Sbjct: 221 SFASAVCKQGFLPAGVESSKLGWSEEFLNSIGLSELTTNDFERLGGSLRDK-KNFLSAGE 279

Query: 247 PVXXXXXXXXXXXXXTPRCVVGSGVIDAYAGWVGTVGASPDGA--------RESGGVEEL 298
            V             T  C+VGSG+IDAYAGWVGTV A P  A         E   +   
Sbjct: 280 CVGFLDVNSACELGLTQHCIVGSGIIDAYAGWVGTVAAKPSSAIPGLSENEHEKNDINSA 339

Query: 299 AGRLAAVAGTSTCLIMLSQTPHFVEGVWGPYRDVLARGYWCTEGGQSCTGALLAHTLHTH 358
            GRLAAVAGTSTC I+LS+ P FV GVWGPYRDVLAR +W  EGGQSCTGALLAH + TH
Sbjct: 340 IGRLAAVAGTSTCHILLSKDPIFVHGVWGPYRDVLARNFWTAEGGQSCTGALLAHVIKTH 399

Query: 359 PAYTELHQAAQQRGLTDFDYINWRLDKLRAETGARSIRALAKHRFLYGDYHGNRSPLADP 418
           PA+TEL Q A    ++ F+Y+N  L+ L  +   RS+ +LAKH F YGDYHGNRSP+ADP
Sbjct: 400 PAFTELSQLADAASISIFEYLNSMLETLVQKRNERSVVSLAKHFFFYGDYHGNRSPIADP 459

Query: 419 SMRAAMVGLSMDVSQDDLALAVLTAFEFIALQARHILDHMAAAGLHVDTVYLSGGQARNP 478
           +MRA ++G SMD S +DLA+  L A EFI+ Q R I++ M   G  +D +++SGGQ RN 
Sbjct: 460 NMRACIIGQSMDNSVEDLAVTYLGACEFISQQTRQIIEAMLENGHRIDAIFMSGGQCRNG 519

Query: 479 LLTQLLADAVRRPVVTPRHVGAAVVFGSALLAAAAVE 515
           LL +LLAD    P++ PR++ AAVVFGSALL AAA E
Sbjct: 520 LLMRLLADCTGLPIMIPRYIDAAVVFGSALLGAAASE 556

 Score = 60.1 bits (144), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 36/53 (67%)

Query: 541 LWQIMSRLTVPGNVVSPSPDADPDIRLLEAKYKVFLEMAEAQKLYRKLVDDVE 593
           LW++M  LT    VV+P+    PD  LL+ KY++FL+MAE Q+ YR +VD VE
Sbjct: 665 LWKVMQELTGEAKVVNPNDKTHPDRILLDTKYQIFLDMAENQRKYRNMVDRVE 717

>Smik_4.355 Chr4 complement(634853..636967) [2115 bp, 704 aa] {ON}
           YDR109C (REAL)
          Length = 704

 Score =  569 bits (1466), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 280/523 (53%), Positives = 358/523 (68%), Gaps = 13/523 (2%)

Query: 8   QYYVGVDVGTEFARACIIDKSGAILATTQNPISRSQPKHDHITQSSSEIWGAVCKSVRAA 67
           ++YVGVDVGT   RACIIDKSG IL+  + PI R +   + ITQSS EIW AVC  VR  
Sbjct: 29  KFYVGVDVGTGSTRACIIDKSGNILSLAEKPIKREELLSNFITQSSREIWNAVCYCVRKV 88

Query: 68  VAESQVAVDEVAGINFDATCSLVVLDEDSDGEVAVGPDFSDNRQNVILWMDHRAVAEASE 127
           + E+ V    + GI FDATCSLVV+      E+AVGPDF++N QN+ILWMDHRA+ E  E
Sbjct: 89  IQEAGVDPARIHGIGFDATCSLVVVSATDFKEIAVGPDFTNNDQNIILWMDHRAMKETEE 148

Query: 128 INSTGHSVLRYVGGKMSVEMQMPKIKWLQRHMPRGEFAKCKFYDLPDFLTYQATGIESRS 187
           IN +G++ L+YVGG+MSVEM++PKIKWL+ ++  G F  CKF+DLPD+LT++ATG E+RS
Sbjct: 149 INFSGNTCLKYVGGQMSVEMEIPKIKWLKNNLESGIFQDCKFFDLPDYLTFRATGKENRS 208

Query: 188 FCSTVCKMGLVPNGVDSSTSGWSREFLEQIGLEELCEDGFRRLGGALDEPGSEFRSAGEP 247
           F S VCK G +P GV+ S  GWS++FL+ IGL EL ++ F +LGG+L      F SAGE 
Sbjct: 209 FSSVVCKQGFLPEGVEGSNLGWSKQFLDSIGLSELTDNDFEKLGGSLRNQ-KNFLSAGEC 267

Query: 248 VXXXXXXXXXXXXXTPRCVVGSGVIDAYAGWVGTVGASPDGARESGGVEE---------- 297
           +             T  CVV SG+IDAYAGWVGTV A P+   E  G+ E          
Sbjct: 268 IGPLDGKAARQLGLTEYCVVSSGIIDAYAGWVGTVAAKPES--EIKGLTENEDYKHDFNG 325

Query: 298 LAGRLAAVAGTSTCLIMLSQTPHFVEGVWGPYRDVLARGYWCTEGGQSCTGALLAHTLHT 357
             GRLAAVAGTSTC I+LS++  FV G+WGPYRDVLARG+W  EGGQSCTG LL H + T
Sbjct: 326 AIGRLAAVAGTSTCHILLSKSSIFVHGIWGPYRDVLARGFWAAEGGQSCTGVLLDHVITT 385

Query: 358 HPAYTELHQAAQQRGLTDFDYINWRLDKLRAETGARSIRALAKHRFLYGDYHGNRSPLAD 417
           HPA+++L Q A    ++ F+Y+N  L+ L  +   RS+  LAKH F YGDY GNRSP+AD
Sbjct: 386 HPAFSKLSQLADAANVSKFEYLNSVLENLVEKRKERSVIFLAKHLFFYGDYRGNRSPIAD 445

Query: 418 PSMRAAMVGLSMDVSQDDLALAVLTAFEFIALQARHILDHMAAAGLHVDTVYLSGGQARN 477
           P+MRA ++G SMD S DDLA+  L A EFI+ Q R I++ M  +G  ++ V++SGGQ RN
Sbjct: 446 PNMRACIIGQSMDNSIDDLAVIYLGACEFISQQTRQIIEVMLKSGHAINAVFMSGGQCRN 505

Query: 478 PLLTQLLADAVRRPVVTPRHVGAAVVFGSALLAAAAVENYLAN 520
            LL +LLAD    P+V PR++  AVVFGSALL AAA + +  N
Sbjct: 506 GLLMRLLADCTGLPIVIPRYIDGAVVFGSALLGAAASKVFDLN 548

 Score = 60.5 bits (145), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 36/55 (65%)

Query: 541 LWQIMSRLTVPGNVVSPSPDADPDIRLLEAKYKVFLEMAEAQKLYRKLVDDVENT 595
           LW++M  LT    V+ P+    PD  LL+ KY++FL+M E Q+ YR++VD VE T
Sbjct: 647 LWKVMQELTGNAKVICPNTKTHPDRILLDTKYQIFLDMVETQRNYRRMVDKVEET 701

>TPHA0B03240 Chr2 (743153..744910) [1758 bp, 585 aa] {ON} Anc_8.257
           YDR109C
          Length = 585

 Score =  536 bits (1382), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 270/589 (45%), Positives = 370/589 (62%), Gaps = 15/589 (2%)

Query: 10  YVGVDVGTEFARACIIDKSGAILATTQNPISRSQPKHDHITQSSSEIWGAVCKSVRAAVA 69
           Y+GVDVGT  ARACI +K+G ILA     IS+ + +   ITQSS+EIW A+   ++  + 
Sbjct: 4   YIGVDVGTGSARACITNKNGEILAVEVKDISKQELQLGFITQSSNEIWDAILDIIKRVID 63

Query: 70  ESQVAVDEVAGINFDATCSLVVLDEDSDGEVAVGPDFSDNRQNVILWMDHRAVAEASEIN 129
            S V    + GI FDATCSLVV D++S   +AVGP+F D+ QN+ILWMDHRA +E   IN
Sbjct: 64  ISNVDPSSIDGIAFDATCSLVVFDKNSLEPIAVGPNFDDSNQNIILWMDHRAASETDLIN 123

Query: 130 STGHSVLRYVGGKMSVEMQMPKIKWLQRHMPRGEFAKCKFYDLPDFLTYQATGIESRSFC 189
           ST    L+YVGGKMSVE ++PKIKWL+ H+    F +C F DL DFLTY+ATG    SF 
Sbjct: 124 STNDKRLKYVGGKMSVEFELPKIKWLKDHLSPETFHRCVFLDLADFLTYKATGKIVHSFS 183

Query: 190 STVCKMGLVPNGVDSSTSGWSREFLEQIGLEELCEDGFRRLGGALDEPGSEFRSAGEPVX 249
           S VCK GL+P GV+ S  GWS+EFLE+IGLEEL  + F +LGG+++     F   G+ V 
Sbjct: 184 SAVCKQGLLPTGVEGSKLGWSKEFLEKIGLEELSTNNFEKLGGSINLKEGNFLIPGDLVG 243

Query: 250 XXXXXXXXXXXXTPRCVVGSGVIDAYAGWVGTVGAS------PDGARESGGVEELAGRLA 303
                          CVVG+GVIDAY+GWVGTV +        D  +E   +E   GR+A
Sbjct: 244 HVDKKFAGLANLPNHCVVGTGVIDAYSGWVGTVASDVSDRVCSDSPQELNKIEGSLGRIA 303

Query: 304 AVAGTSTCLIMLSQTPHFVEGVWGPYRDVLARGYWCTEGGQSCTGALLAHTLHTHPAYTE 363
            V+GTSTC I+LS+ P F+ GVWGPYRDVLA   W TEGGQS TGALL + + THPAY E
Sbjct: 304 VVSGTSTCHIVLSKQPLFISGVWGPYRDVLAENMWATEGGQSFTGALLDNIIETHPAYQE 363

Query: 364 LHQAAQQRGLTDFDYINWRLDKLRAETGARSIRALAKHRFLYGDYHGNRSPLADPSMRAA 423
           L +   ++    F Y++ +L++LR      S+  L K+ F+YGDY+GNRSPLADP M   
Sbjct: 364 LERITSRQNKNIFVYLDEKLEELRVNRKLDSVFYLTKNMFIYGDYYGNRSPLADPLMSGM 423

Query: 424 MVGLSMDVSQDDLALAVLTAFEFIALQARHILDHMAAAGLHVDTVYLSGGQARNPLLTQL 483
           ++G +MD S +DLA+  L A EFIALQ RHI+D +   G  +  +Y+SGG  +N LL +L
Sbjct: 424 IIGQTMDSSINDLAIKYLAACEFIALQTRHIIDTLVTHGHGITAIYMSGGHCKNKLLMEL 483

Query: 484 LADAVRRPVVTPRHVGAAVVFGSALLAAAAVENYLANTNATASSILPSSASRAPMHRLWQ 543
           +++    P+V  +++ ++VVFG+A+L + A     A  N+   + L  S +      LW 
Sbjct: 484 ISNCCVLPLVLSKYIDSSVVFGAAILGSVA-----AKINSMKENKLEYSLNDV----LWS 534

Query: 544 IMSRLTVPGNVVSPSPDADPDIRLLEAKYKVFLEMAEAQKLYRKLVDDV 592
            M  +T  G ++ P  +     + L+AKY+V+L+M +    YRK +++V
Sbjct: 535 QMKLMTPKGTLMMPKSEKSVLRKYLQAKYEVYLDMIDTNIKYRKKMEEV 583

>Suva_14.93 Chr14 complement(174204..175835) [1632 bp, 543 aa] {ON}
           YNL249C (REAL)
          Length = 543

 Score =  194 bits (492), Expect = 6e-54,   Method: Compositional matrix adjust.
 Identities = 158/600 (26%), Positives = 251/600 (41%), Gaps = 84/600 (14%)

Query: 11  VGVDVGTEFARACIIDK-SGAILATTQNPISRSQPKHDHITQSSSEIWGA---VCKSVRA 66
           +G+D+G+  AR  I D  +  +LA  Q P+    P +   ++ S + W     + K+++ 
Sbjct: 9   IGIDIGSSSARVGIYDYYNDVLLAMAQEPV----PYYHDSSKKSWKFWQKSTEIIKALQN 64

Query: 67  AVAESQVAVDEVAGINFDATCSLVVLDED-SDGEVAVGPDFSDNRQNVILWMDHRAVAEA 125
              E ++    V      ATCSL +  +D ++G +   P    N  NVI WMD  AV E 
Sbjct: 65  CFQELKITQYNVRSCGVSATCSLAIFQKDLTNGNLIPYP----NEDNVIFWMDSSAVDEC 120

Query: 126 SEINST-GHSVLRYVGGKMSVEMQMPKIKWLQRHMPRGEFAKCKFYDLPDFLTYQATGIE 184
             +N      +L Y+GGK   EM +PK+K+        +  +   +DL  ++ Y+   + 
Sbjct: 121 EWLNEKCSQQLLDYLGGKFIPEMGIPKLKYFLNEHSHNQEKQFHIFDLHQYIAYELGRLY 180

Query: 185 SRSFCSTVCKMGLVPNGVDSSTSGWSREFLEQIGLEELCEDGFRRLGGALDEPGSEFRSA 244
             +      +  +   G D   SGWS  F   I                           
Sbjct: 181 RWNTDELSARENINGIGNDGEASGWSSSFYNDI--------------------------M 214

Query: 245 GEPVXXXXXXXXXXXXXTPRCVVGSGVIDAYAGWVGTVGASPDGARESGGVEELAGRLAA 304
             P              +         ID+YA W     +SP+          L   L  
Sbjct: 215 KLPSNVTIGLTGLNSNNSSSTTTVCSCIDSYASWFAV--SSPN----------LEASLFM 262

Query: 305 VAGTSTCLIMLSQ-TPHFVEGVWGPYRDVLARG--YWCTEGGQSCTGALLAHTLHTHPAY 361
           +AGTSTC +  S  T   + GVWGP+  +L     Y     GQSCTG L+ H   +HPA 
Sbjct: 263 IAGTSTCYMYGSPVTTTKIPGVWGPFDTILETNGNYSVYTAGQSCTGKLIEHLFKSHPAA 322

Query: 362 TELHQAAQQRGLTDFDYINWRLDKLRAETGARSIRALAKHRFLYGDYHGNRSPLADPSMR 421
            ++    Q+ G   ++ +   +  +  +   +SI  LAKH F YGDY GNR+P AD  MR
Sbjct: 323 RKI----QRSGEDIYEVLENSIQDIEKKN-RKSIHILAKHMFFYGDYEGNRTPFADSQMR 377

Query: 422 AAMVGLSMDVSQDDLALAVLTAFEFIALQARHILDHMAA--AGLHVDTVYLSGGQARNPL 479
            + +G S D S  +L    ++  EF++ Q + I+D      +G  ++ + +SG QA+N  
Sbjct: 378 GSFIGESTDTSILNLTYKYVSMLEFLSFQTKLIIDTFQGQNSGARIEELRVSGSQAKNGR 437

Query: 480 LTQLLA-----DAVRRPVVTPRHVGAAVVFGSALLAAAAVENYLANTNATASSILPSSAS 534
           L  L++       ++RP     ++    V G+ +L  +      AN       I+    +
Sbjct: 438 LLSLISLVNDGIKIKRP---NENIDLMGVMGAYMLGKS------ANEKKQIIDIIRERDA 488

Query: 535 RAPMHRLWQIMSRLTVPGNVVSPSPDADPDIRLLEAKYKVFLEMAEAQKLYRKLVDDVEN 594
            A         S    P        D     RLL  KY++ L+MA+ Q+ Y +LVD+  N
Sbjct: 489 NAD--------SEEFEPFGTYQLGNDCILLKRLLSVKYRIHLDMAKQQQQYHRLVDEALN 540

>Skud_14.89 Chr14 complement(168159..169868) [1710 bp, 569 aa] {ON}
           YNL249C (REAL)
          Length = 569

 Score =  189 bits (479), Expect = 7e-52,   Method: Compositional matrix adjust.
 Identities = 152/595 (25%), Positives = 255/595 (42%), Gaps = 78/595 (13%)

Query: 11  VGVDVGTEFARACIID-KSGAILATTQNPISRSQPKHDHITQSSSEIW---GAVCKSVRA 66
           +G+DVG+  AR  I + ++ A+L   Q P+    P +   +++S + W     + K+++ 
Sbjct: 34  IGIDVGSSSARVGIYNYENDALLGMAQEPV----PYYQDSSRTSWKFWQRSTEIIKALQK 89

Query: 67  AVAESQVAVDEVAGINFDATCSLVVLDEDS-DGEVAVGPDFSDNRQNVILWMDHRAVAEA 125
            + + ++    V      ATCSL + ++D  +G +   P    N  NVI WMD  A+ E 
Sbjct: 90  CLQKLKITEYNVKSCGVSATCSLAIFEKDKRNGSLIPYP----NEDNVIFWMDSSAIDEC 145

Query: 126 SEINS-TGHSVLRYVGGKMSVEMQMPKIKWLQRHMPRGEFAKCKFYDLPDFLTYQATGIE 184
            ++N+     +L ++GG    EM +PK+K+        +  +   +DL  ++ Y+ + + 
Sbjct: 146 KQLNAECSQQLLDFLGGSFVPEMGIPKLKYFLNEYSHNQDKQFHIFDLHQYIAYELSHLY 205

Query: 185 SRSFCSTVCKMGLVPNGVDSSTSGWSREFLEQIGLEELCEDGFRRLGGALDEPGSEFRSA 244
             +    + +      GVD   SGWS  F E I                           
Sbjct: 206 QWNNEVLLKRENNKMVGVDGEASGWSPSFYENI--------------------------M 239

Query: 245 GEPVXXXXXXXXXXXXXTPRCVVGSGVIDAYAGWVGTVGASPDGARESGGVEELAGRLAA 304
             P                   +    ID+YA W     +SP           L   L  
Sbjct: 240 HLPSNVIIGSNGATCKKIASSAIVRSCIDSYASWFAV--SSP----------HLETSLFM 287

Query: 305 VAGTSTCLIMLSQTPHF-VEGVWGPYRDVLARG--YWCTEGGQSCTGALLAHTLHTHPAY 361
           +AGTSTC +  +      + GVWGP+  +L     +     GQSCTG L+ H   THP  
Sbjct: 288 IAGTSTCYMYGTPITDIKIPGVWGPFDSILDSNSHFSVYAAGQSCTGKLIEHLFVTHPCA 347

Query: 362 TELHQAAQQRGLTDFDYINWRLDKLRAETGARSIRALAKHRFLYGDYHGNRSPLADPSMR 421
            E+     +RG   +  +   +  +  + G +S+    K  F YGDY GNR+P ADP M+
Sbjct: 348 KEI----LKRGADIYQVLERTIHDIEKQNG-QSVHVFTKDIFFYGDYEGNRTPFADPRMK 402

Query: 422 AAMVGLSMDVSQDDLALAVLTAFEFIALQARHILDHMA--AAGLHVDTVYLSGGQARNPL 479
            + +G + D S  +L    +   EF++ Q R I+D       G+ +  + +SG QA+N  
Sbjct: 403 GSFIGETTDTSILNLIHKYICILEFLSFQTRLIIDTFKRQNIGMCIQELRISGSQAKNKR 462

Query: 480 LTQLLADAVRRPVVT-PR-HVGAAVVFGSALLAAAAVENYLANTNATASSILPSSASRAP 537
           L  L++       +  P+ +V    V G+ LLA +A E                +    P
Sbjct: 463 LLSLISLVNNGITINKPKDNVDLMGVRGAYLLAKSANEGKQIIDVIRERDTSDDNEKFEP 522

Query: 538 MHRLWQIMSRLTVPGNVVSPSPDADPDIRLLEAKYKVFLEMAEAQKLYRKLVDDV 592
           +   +Q+++             D+    RLL AKY++ L+MA+ Q+ Y KL+D+V
Sbjct: 523 LPE-YQLLN-------------DSSLLRRLLWAKYRIHLDMAKQQQRYHKLIDEV 563

>YNL249C Chr14 complement(179394..181022) [1629 bp, 542 aa] {ON}
           MPA43Putative protein of unknown function; the
           authentic, non-tagged protein is detected in highly
           purified mitochondria in high-throughput studies
          Length = 542

 Score =  183 bits (465), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 158/598 (26%), Positives = 250/598 (41%), Gaps = 84/598 (14%)

Query: 11  VGVDVGTEFARACIIDK-SGAILATTQNPISRSQPKHDHITQSSSEIWGA---VCKSVRA 66
           +G+DVG+  AR  + +  + A+L   Q P+    P +   ++ S + W     + K+++ 
Sbjct: 9   IGIDVGSSSARIGVYNYYNDALLEMAQEPV----PYYQDSSKKSWKFWQKSTEIIKALQK 64

Query: 67  AVAESQVAVDEVAGINFDATCSLVVLDEDSDGEVAVGPDFSDNRQNVILWMDHRAVAEAS 126
            + +  +   EV      ATCSL + + D    + +      N  NVI WMD  AV E  
Sbjct: 65  CLQKLNIREYEVKSCGVSATCSLAIFERDRTSNMLIP---YPNEDNVIFWMDSSAVNECQ 121

Query: 127 EIN-STGHSVLRYVGGKMSVEMQMPKIKWLQRHMPRGEFAKCKFYDLPDFLTYQATGIES 185
            +N      +L Y+GGK   EM +PK+K+               +DL  ++ Y+ + +  
Sbjct: 122 WLNMQCPQQLLDYLGGKFVPEMGVPKLKYFLDEYSHLRDKHFHIFDLHQYIAYELSRLYE 181

Query: 186 RSFCSTVCKMGLVPNGVDSSTSGWSREFLEQIGLEELCEDGFRRLGGALDEPGSEFRSAG 245
            +    + +  L   G D   SGWS  F + I                            
Sbjct: 182 WNIEGLLGRENLNGIGNDGEVSGWSSSFYKNI--------------------------IN 215

Query: 246 EPVXXXXXXXXXXXXXTPRCVVGSGVIDAYAGWVGTVGASPDGARESGGVEELAGRLAAV 305
            P                   V    ID+YA W     ASP           L   L  +
Sbjct: 216 LPSNVSIGTTSLVANKHISTTVVRSCIDSYASWFAV--ASP----------HLETSLFMI 263

Query: 306 AGTSTCLIM---LSQTPHFVEGVWGPYRDVL-ARG-YWCTEGGQSCTGALLAHTLHTHPA 360
           AGTS+C +    +S T   + GVWGP+  +L  RG +     GQSCTG L+ H   +HP 
Sbjct: 264 AGTSSCYMYGTTISDTR--IPGVWGPFDTILDNRGDFSVYAAGQSCTGKLIEHLFESHPC 321

Query: 361 YTELHQAAQQRGLTDFDYINWRLDKLRAETGARSIRALAKHRFLYGDYHGNRSPLADPSM 420
             ++     + G   +  +   +  +    G  SI  L K  F YGDY GNR+P ADP +
Sbjct: 322 ARKI----LKDGADIYQVLEQTIRDIEKNNGL-SIHILTKDMFFYGDYEGNRTPFADPRI 376

Query: 421 RAAMVGLSMDVSQDDLALAVLTAFEFIALQARHILDHMA--AAGLHVDTVYLSGGQARNP 478
           + + +G S D S  +L    +   EF++ Q + I+D      + +H+  + +SG QA+N 
Sbjct: 377 KGSFIGESTDTSMLNLTYKYICILEFLSFQTKLIIDTFQNENSNIHIKELRISGSQAKNE 436

Query: 479 LLTQLLADAVR-RPVVTPR-HVGAAVVFGSALLAAAAVENYLANTNATASSILPSSASRA 536
            L  L++       ++ P+ +V    + G+ +LA +A E        T   I   S    
Sbjct: 437 RLLSLISLVNNGVAIIKPKENVDMMGIKGAYVLAKSAKEKKQLADVITERDISNDSEKFE 496

Query: 537 PM--HRLWQIMSRLTVPGNVVSPSPDADPDIRLLEAKYKVFLEMAEAQKLYRKLVDDV 592
            +  +RL          GN      D+    +LL  KY + L+MA+ QK Y KLVD+V
Sbjct: 497 SLAEYRL----------GN------DSILLRKLLCVKYHIHLDMAKQQKRYHKLVDEV 538

>TDEL0C05900 Chr3 (1062033..1063664) [1632 bp, 543 aa] {ON}
           Anc_1.111 YNL249C
          Length = 543

 Score =  181 bits (460), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 155/613 (25%), Positives = 257/613 (41%), Gaps = 102/613 (16%)

Query: 6   MKQYYVGVDVGTEFARACIID-KSGAILATTQNPISRSQPKHDHI---TQSSSEIWGAVC 61
           MK   +G+D+G+   R  +   +   ++   +  IS        +   TQS+ EI     
Sbjct: 1   MKDAGIGIDLGSSSVRVGLFTLEDDLMVQCVKQKISYYYHGDSALWEYTQSTDEIM---- 56

Query: 62  KSVRAAVAESQVAVDEVAGINFDATCSLVVLDEDSDGEVAVGPDFSDNRQNVILWMDHRA 121
           K +   + + ++    +      ATCS+ +  ++ +           +RQNVI WMD+ +
Sbjct: 57  KVIERCLHDLKIDEYNIKSCGVSATCSMALFIKEHNHLEPFNTISGSHRQNVIFWMDNSS 116

Query: 122 VAEASEINSTGHSVLR-YVGGKMSVEMQMPKIKWLQRHMPRGEFAK---CKFYDLPDFLT 177
             E   +N+     LR ++GGK   EM +PKI  L  ++   +  +       DL  +L 
Sbjct: 117 KTECKLLNNLCEKRLRDFMGGKFIPEMGIPKINRLINYLKSSDDLQNLSVVAMDLHRYLA 176

Query: 178 YQATGIESRSFCSTVCKMGLVPNGVDSSTSGWSREFLEQ---------IGLEELCEDGFR 228
           Y+       +F   +        G D   SGWS +F            IG E   ED F 
Sbjct: 177 YEIAKRFKWNFDRLLNTTNFNEIGHDGELSGWSSKFYIDTLKIPSNITIGPEPPLEDDFE 236

Query: 229 RLGGALDEPGSEFRSAGEPVXXXXXXXXXXXXXTPRCVVGSGVIDAYAGWVGTVGASPDG 288
              G                                  + +  ID Y+ W+     +P+ 
Sbjct: 237 YCKG----------------------------------IVASCIDCYSSWLSLCSPTPEE 262

Query: 289 ARESGGVEELAGRLAAVAGTSTCLIMLSQTPHFVEGVWGPYRDVL--ARGYWCTEGGQSC 346
           +            L  V GTSTC +  +     + GVWGP+ D+L  +  Y   EGGQSC
Sbjct: 263 S------------LFIVGGTSTCYLYATTRMKTIPGVWGPFTDILDNSNTYAVYEGGQSC 310

Query: 347 TGALLAHTLHTHPAYTELHQAAQQRGLTDFDYINWRLDKLRAETGARSIRALAKHRFLYG 406
           TG L+ H L THPA + +   A+       + I   +  +  +TG RSI    KH F YG
Sbjct: 311 TGKLIEHLLQTHPASSSI---AKDDWPLLLEKIEQEISAIEEQTG-RSIHFKTKHMFFYG 366

Query: 407 DYHGNRSPLADPSMRAAMVGLSMDVSQDDLALAVLTAFEFIALQARHILD--HMAAAGLH 464
           D+ GNR+P ADP M    +G + DVS ++L L  +   EF+A Q ++++   + A     
Sbjct: 367 DFQGNRTPYADPEMSGMTIGETTDVSFNNLILRYICILEFLAFQIKYMISIFNKAQGQDK 426

Query: 465 VDTVYLSGGQARNPLLTQLLA-----DAVRRPVVTPRHVGAAVVFGSALLAAAAVENYLA 519
           +  + + G QA+N  L  L++       ++ P       G +   G+ LL  +A+ N   
Sbjct: 427 ITEIRICGSQAKNKRLLSLISLLHEGGTIKLPKTDVELSGVS---GAFLLGKSALLN--- 480

Query: 520 NTNATASSILPSSASRAPMHRLWQIMSRLTVPGNVVSPSPDADPDIRLLEAKYKVFLEMA 579
                          ++P+  + +   +  V     +PS    P   LLEAKY++ L+MA
Sbjct: 481 ---------------KSPLDLIQEKDDQKQV-DIFETPSSINQPLSMLLEAKYEIHLDMA 524

Query: 580 EAQKLYRKLVDDV 592
           + Q +YR++++ +
Sbjct: 525 KQQLIYREMINKI 537

>Smik_14.86 Chr14 complement(158487..160118) [1632 bp, 543 aa] {ON}
           YNL249C (REAL)
          Length = 543

 Score =  175 bits (443), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 151/599 (25%), Positives = 248/599 (41%), Gaps = 86/599 (14%)

Query: 11  VGVDVGTEFARACIIDK-SGAILATTQNPISRSQPKHDHITQSSSEIWGA---VCKSVRA 66
           +G+D+G+  AR  I    + A+L   Q P+    P +   T+ S + W     + ++++ 
Sbjct: 9   IGIDLGSSSARVGIYSYYNDALLGMAQEPV----PYYQDFTKKSWKFWQKSTEIIEALQK 64

Query: 67  AVAESQVAVDEVAGINFDATCSLVVLDEDSDGEVAVGPDFSDNRQNVILWMDHRAVAEAS 126
              + ++    V      ATCSL + +     E  +      N  NVI WMD  A  E  
Sbjct: 65  CFQKLKITEYNVKSCGVSATCSLAIFERVHTSEALIP---YPNENNVIFWMDSSATDECE 121

Query: 127 EINS-TGHSVLRYVGGKMSVEMQMPKIKWLQRHMPRGEFAKCKFYDLPDFLTYQATGIES 185
            +N+     +L Y+GG+   EM +PK+K+        +  +   +DL  ++ Y+   +  
Sbjct: 122 WLNAECSKQLLDYLGGRFVPEMGIPKLKYFLNEYSHRQDKRFHIFDLHQYIAYELGRLYQ 181

Query: 186 RSFCSTVCKMGLVPNGVDSSTSGWSREFLEQIGLEELCEDGFRRLGGALDEPGSEFRSAG 245
            +    +    +   G D   SGWS  F + I                            
Sbjct: 182 WNIDGLLRGENINGIGNDGEASGWSSSFYKNI--------------------------MN 215

Query: 246 EPVXXXXXXXXXXXXXTPRCVVGSGVIDAYAGWVGTVGASPDGARESGGVEELAGRLAAV 305
            P                   V    ID+YA W      SP     S         L  +
Sbjct: 216 IPSNVIIGPVGLVSKKVISTTVVRSCIDSYASWFA---VSPPFLERS---------LFMI 263

Query: 306 AGTSTCLIM---LSQTPHFVEGVWGPYRDVLA-RG-YWCTEGGQSCTGALLAHTLHTHPA 360
           AGTS+C +    +S T   + GVWGP+ ++L  +G +     GQSCTG L+ H   +HP 
Sbjct: 264 AGTSSCYMYGTPVSNTK--IPGVWGPFNNILDDKGDFSVYAAGQSCTGKLIEHLFESHPC 321

Query: 361 YTELHQAAQQRGLTDFDYINWRLDKLRAETGARSIRALAKHRFLYGDYHGNRSPLADPSM 420
             ++ ++    G   +  +   +  +  + G  SI  LAK  F YGDY GNR+P ADP M
Sbjct: 322 ARKILKS----GADIYQVLEQTIHGIEKKKGL-SIHILAKDMFFYGDYEGNRTPFADPRM 376

Query: 421 RAAMVGLSMDVSQDDLALAVLTAFEFIALQARHILDHMAA--AGLHVDTVYLSGGQARNP 478
           + + +G + D S  +L    ++  EF++ Q + I+D   +  A + +  + +SG QARN 
Sbjct: 377 KGSFIGETTDTSILNLTYKYISILEFLSFQTKLIIDTFQSQKACIRIQELRISGSQARNE 436

Query: 479 LLTQLLA-----DAVRRPVVTPRHVGAAVVFGSALLAAAAVENYLANTNATASSILPSSA 533
            L  L++      ++ RP      +G   + G+ +LA +A E            +   + 
Sbjct: 437 RLLSLISLVNNGMSINRPRDNVDMMG---IKGAYILAKSANEKKQLVDVIRERDVGDDNE 493

Query: 534 SRAPMHRLWQIMSRLTVPGNVVSPSPDADPDIRLLEAKYKVFLEMAEAQKLYRKLVDDV 592
              P+             GN      D+     LL  KY++ L+MA+ QK Y KLVD+V
Sbjct: 494 KFQPLSEY--------CLGN------DSTLLKNLLCVKYRIHLDMAKQQKYYYKLVDEV 538

>KLTH0F03080g Chr6 complement(268621..270222) [1602 bp, 533 aa] {ON}
           similar to uniprot|P53583 Saccharomyces cerevisiae
           YNL249C MPA43
          Length = 533

 Score =  174 bits (442), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 160/602 (26%), Positives = 248/602 (41%), Gaps = 99/602 (16%)

Query: 11  VGVDVGTEFARACIID-KSGAILATTQNPISRSQPKHDHITQSSSEIWGAVCKSVRAAVA 69
           +G+D+G+   R  I D K+  ++     P+  +    + +TQSS++I  A+       + 
Sbjct: 11  LGIDLGSTAVRVGIYDLKTDKLIDIVAKPVPYTNHGGNRVTQSSTDIMSAI----HGCIQ 66

Query: 70  ESQVAVDEVAGINFDATCSLVVLDEDSDGEVAVGPDFSDNRQ----NVILWMDHRAVAEA 125
           +    +  V      ATCSL V  +D +    +  D    +Q    NV+ WMD  A  E 
Sbjct: 67  DLNPDLKSVLSCGVAATCSLAVFTQDIEDLKPL--DIHGVKQEPCHNVVFWMDSSATLEC 124

Query: 126 SEINSTGHSVLRYVGGKMSVEMQMPKIKWLQRHMPRGEFAKCKFYDLPDFLTYQATGIES 185
             +N T   +  ++GG    EM +PK+  + +  P  E  K + +DL  ++ Y+      
Sbjct: 125 EIVNKTAGRLKEFMGGSFVPEMGIPKLASIFKK-PEAEGHKLEVFDLHSYIAYELAIKYG 183

Query: 186 RSFCSTVCKMGLVPNGVDSSTSGWSREFLEQIGLEELCEDGFRRLGGALDEPGSEFRSAG 245
                 + K      G D    GW   F   +                L  P +      
Sbjct: 184 WDTSRIINKPNENRIGHDGELKGWDAGFYNDV----------------LKLPAN------ 221

Query: 246 EPVXXXXXXXXXXXXXTPRCVVGSGVIDAYAGWVGTVGASPDGARESGGVEELAGRLAAV 305
                           T   V  +  ID Y+ W     +SP+ +            L   
Sbjct: 222 ------VKIGPIHALNTESPVRVASCIDCYSNWFSMCSSSPNNS------------LFMA 263

Query: 306 AGTSTC-LIMLSQTPHFVEGVWGPYRDVL----ARGYWCTEGGQSCTGALLAHTLHTHPA 360
           AGTSTC L   ++    + GVWGP+ ++L    A+ +   E GQS TG L+ H   THPA
Sbjct: 264 AGTSTCYLYANTENKGCIPGVWGPFTNILDGSEAKEWSVYEAGQSTTGKLIEHLFETHPA 323

Query: 361 YTELHQAAQQRGLTDFDYINWRLDKLRAETGARSIRALAKHRFLYGDYHGNRSPLADPSM 420
                +A        F  I   ++KL  + G  S+   +KH F YG+  GNR+P  D SM
Sbjct: 324 ----ARAYSMDKSKLFSAIESAIEKLEQDFG-ESVHFRSKHMFTYGELQGNRTPYCDSSM 378

Query: 421 RAAMVGLSMDVSQDDLALAVLTAFEFIALQARHILDHMAAAGLHVDTVYLSGGQARNPLL 480
               +G + D S  DL L  +T  EF+A Q +HI +   A    +  + ++G QA+N  L
Sbjct: 379 SGMFIGETTDTSFQDLVLKYVTILEFLAFQVKHIKECFKA---EIKDIRIAGSQAKNTRL 435

Query: 481 TQLLA-----DAVRRPVVTPRHVGAAVVFGSALLAAAAVEN-----YLANTNATASSILP 530
             L +       V+ P     ++G   V G+ LL  AA +N      +   +   S IL 
Sbjct: 436 LTLFSLVNDQITVKIPAQRTDYMG---VEGAYLLGKAAHKNINIIDLIDKRDRLQSHIL- 491

Query: 531 SSASRAPMHRLWQIMSRLTVPGNVVSPSPDADPDIRLLEAKYKVFLEMAEAQKLYRKLVD 590
                 PM +L    ++L                 +LLEAKYK++L+MA+ Q  YR +VD
Sbjct: 492 ---ELGPM-KLGNHNTKLK----------------QLLEAKYKIYLDMAQTQMRYRAMVD 531

Query: 591 DV 592
            V
Sbjct: 532 SV 533

>Kwal_33.13530 s33 complement(268296..269900) [1605 bp, 534 aa] {ON}
           YNL249C (MPA43) - Overexpression leads to increased
           levels of the lyase PDC1 [contig 116] FULL
          Length = 534

 Score =  170 bits (431), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 160/612 (26%), Positives = 251/612 (41%), Gaps = 121/612 (19%)

Query: 11  VGVDVGTEFARA----CIIDKSGAILATTQNPISRSQPKHDHITQSSSEIWGAVCKSVRA 66
           +G+D+G+   R        D+  A+++ T N   + + ++   TQSS+EI  A+ +   +
Sbjct: 8   LGIDLGSTGVRVGAYNLETDEPIAVVSRTVNYYEQEKGRY---TQSSAEIMRAIVECFES 64

Query: 67  AVAESQVAVDEVAGINFDATCSLVVLDEDSDGEVAVGPDFSD----NRQNVILWMDHRAV 122
                 + +  V      ATCSL V   +S   +     + D    N QNV+ WMD  A+
Sbjct: 65  L----NIDIWAVQSCGVAATCSLAVFIRNSTKGLQPFGVYEDLRPLNDQNVVFWMDSNAI 120

Query: 123 AEASEINSTGHSVLRYVGGKMSVEMQMPKIKWLQRHMPRGEFAKCKFYDLPDFLTYQAT- 181
            E S IN    +   Y GG    EM +PK+    +   +   +  + +DL  ++ Y    
Sbjct: 121 EECSNINDLAINEKAYFGGSFIPEMGVPKLASFLKSCSKNN-SDFEVFDLHTYVAYDLAN 179

Query: 182 --GIESRSFCSTVCKMGLVPNGVDSSTSGWSREFLEQ-------IGLEELCEDGFRRLGG 232
             G ++    +     G+   G D    GW  EF E+       + +  LC +  RR   
Sbjct: 180 RYGWDASFLINRPNHNGI---GHDGEIKGWKDEFYEKTLKLPPNVRIGPLCIN--RRFS- 233

Query: 233 ALDEPGSEFRSAGEPVXXXXXXXXXXXXXTPRCVVGSGVIDAYAGWVGTVGASPDGARES 292
                         PV                    +  ID Y+ W     ++P+ +   
Sbjct: 234 --------------PVKV------------------ASCIDCYSSWFSMFSSTPERS--- 258

Query: 293 GGVEELAGRLAAVAGTSTCLIMLSQTP-HFVEGVWGPYRDVLAR----GYWCTEGGQSCT 347
                    L   AGTSTC +  +  P   + G+WGP+ D+L       +   E GQS T
Sbjct: 259 ---------LFMAAGTSTCYLYANNKPSECLPGIWGPFTDILDSKDPPSWSVYEAGQSTT 309

Query: 348 GALLAHTLHTHPA---YTELHQAAQQRGLTDFDYINWRLDKLRAETGARSIRALAKHRFL 404
           G L+ H   +HPA   Y E       R  T+ + I         +  A S+    KH F 
Sbjct: 310 GKLIEHLFESHPAAKPYLEDRNVLFNRLETEINLI--------EQQSAESVHFKTKHMFN 361

Query: 405 YGDYHGNRSPLADPSMRAAMVGLSMDVSQDDLALAVLTAFEFIALQARHILDHMAAAGLH 464
           YG+  GNR+P  DP M    +G S D S  DL L  +T  EF+A Q RHI + + A    
Sbjct: 362 YGELQGNRTPYCDPEMSGMFIGESADTSFRDLTLKYVTVLEFLAFQVRHIKECLGAP--- 418

Query: 465 VDTVYLSGGQARNPLLTQLLA-----DAVRRPVVTPRHVGAAVVFGSALLAAAAVENYLA 519
           ++ + ++G QA+N  L  L++       VR P     +VG   V G+ LL  A    +L 
Sbjct: 419 INDIRVAGSQAKNNRLLSLISFVNHGSRVRIPATRADYVG---VQGAYLLGKAK---HLG 472

Query: 520 NTNATASSILPSSASRAPMHRLWQIMSRLTVPGNVVSPSPDADPDIR-LLEAKYKVFLEM 578
                   I   +   +PM  +             V    + +  +R L E KYK++L M
Sbjct: 473 LN--VVELITQENGGESPMKDI------------EVRIEKNEENKLRALFEIKYKIYLNM 518

Query: 579 AEAQKLYRKLVD 590
           A+ Q+ YR++V+
Sbjct: 519 AQTQRQYREMVN 530

>ZYRO0F16016g Chr6 (1313995..1315623) [1629 bp, 542 aa] {ON} similar
           to uniprot|P53583 Saccharomyces cerevisiae YNL249C MPA43
           Mitochondrial protein
          Length = 542

 Score =  157 bits (397), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 151/597 (25%), Positives = 242/597 (40%), Gaps = 89/597 (14%)

Query: 11  VGVDVGTEFARACIID-KSGAILATTQNPIS---RSQPKHDHITQSSSEIWGAVCKSVRA 66
           +G+D+G+   R  + + ++  I+A     +      +  +   TQSS EI  A+ +  + 
Sbjct: 10  IGIDLGSSSVRVSLFNFQNDQIIAYKIKTVPYYFTPESTNWKYTQSSREILTAIDQCFQ- 68

Query: 67  AVAESQVAVDEVAGINFDATCSLVVLDEDSDGEVAVGPDFSDNRQNVILWMDHRAVAEAS 126
              E  +   E+      ATCSL +     +  +    D  D  +NV+ WMD  A+ E  
Sbjct: 69  ---ELNIDKHEIKSCGVGATCSLAIFQTKDNALIPWNLD--DPDKNVVFWMDSIAIKETQ 123

Query: 127 EINSTGH-SVLRYVGGKMSVEMQMPKIKWLQRHMPRGEFAKCKFYDLPDFLTYQATGIES 185
           E+N      V  ++GG    EM +PK++     +   +      +++ D   Y A  +  
Sbjct: 124 EVNKLATPEVQAHMGGSFVPEMAVPKLRHFIDILKNTD--NNSTFEIIDLHRYIAMSLAQ 181

Query: 186 RS--FCSTVCKM-GLVPNGVDSSTSGWSREFLEQIGLEELCEDGFRRLGGALDEPGSEFR 242
           ++    + VC    L   G D   +GWS  F E +                         
Sbjct: 182 QNGWDYTNVCNFPNLNEIGHDGELAGWSSAFYENV------------------------- 216

Query: 243 SAGEPVXXXXXXXXXXXXXTPRCVVGSGVIDAYAGWVGTVGASPDGARESGGVEELAGRL 302
               P              + + +  S  ID Y+ W   + ++            L   L
Sbjct: 217 -LQLPPNIVIGPTKHSQHSSKQGLKVSSCIDCYSNWFALLPSN------------LQNSL 263

Query: 303 AAVAGTSTC-LIMLSQTPHFVEGVWGPYRDVLARG--YWCTEGGQSCTGALLAHTLHTHP 359
             V GTSTC L   S+  H + GVWGP+ ++  R   +   E GQSCTG L+ H   THP
Sbjct: 264 FIVGGTSTCYLYASSEFSHHIPGVWGPFSNIFDRSDQFSIYEAGQSCTGKLIEHLFKTHP 323

Query: 360 AYTELHQAAQQRGLTDFDYINWRLDKLRAETGARSIRALAKHRFLYGDYHGNRSPLADPS 419
           A + +           F  IN  ++K+   T   SI    KH F YGD  GNR+P ADPS
Sbjct: 324 ASSHIDTRDWPHL---FSQINDFIEKVEQNT-QDSIHMQTKHMFFYGDLDGNRTPYADPS 379

Query: 420 MRAAMVGLSMDVSQDDLALAVLTAFEFIALQARHILD--HMAAAGLHVDTVYLSGGQARN 477
           M    +G + D S  +L    ++  EFIA Q +H+L   +       +  +   G  A+N
Sbjct: 380 MSGMFIGETTDTSFRNLVYKYVSILEFIAFQIKHMLAIFNTLNGDEDISNLQFCGSLAKN 439

Query: 478 PLLTQLLADAVRRPVVTPRHVGAAVV--FGSALLAAAAVENYLANTNATASSILPSSASR 535
             L  LLA    R  +    +  A++  +GS L+  A+  +          SI+  + ++
Sbjct: 440 KRLLNLLALLNPRLRIAMPEMDVALMGAYGSYLMGKASTSD---------KSIVEVAHNQ 490

Query: 536 APMHRLWQIMSRLTVPGNVVSPSPDADPDIRLLEAKYKVFLEMAEAQKLYRKLVDDV 592
              +R                P       + LLE KY+++  MAE Q+ YRK V++V
Sbjct: 491 TYSYR---------------PPEKTDGLLVELLEVKYQIYFNMAEQQRKYRKQVNNV 532

>KNAG0F00660 Chr6 complement(114441..116048) [1608 bp, 535 aa] {ON}
           Anc_1.111 YNL249C
          Length = 535

 Score =  154 bits (389), Expect = 9e-40,   Method: Compositional matrix adjust.
 Identities = 151/597 (25%), Positives = 248/597 (41%), Gaps = 92/597 (15%)

Query: 11  VGVDVGTEFARACIID-KSGAILATTQNPISRSQPKHD----HITQSSSEIWGAVCKSVR 65
           +G+D+G+   R  I      ++L     P+      +       TQ S+EI  A+ +   
Sbjct: 8   IGIDLGSSSVRVGIYSLHDDSLLGVFSKPVPYYYESNRTSLWEYTQDSAEILTAIKECFD 67

Query: 66  AAVAESQVAVDEVAGINFDATCSLVVLDEDSDGEVAVGPDFSDNRQNVILWMDHRAVAEA 125
            A  +      +V      ATCSLV+ +   D           + +NV+ WMD  A  E 
Sbjct: 68  MADLQKY----DVKSCGVAATCSLVLCERSGDDTFQ---HCEGDSRNVVFWMDSMAKEET 120

Query: 126 SEINS-TGHSVLRYVGGKMSVEMQMPKIKWLQRHM---PRGEFAKCKFYDLPDFLTYQAT 181
           + +N+     +L ++GG    EM +PK+    + +   P+G   + + +DL  ++ Y+  
Sbjct: 121 NSLNARCPQDILGHMGGGFIPEMGIPKLSRFLKSISDEPKGNI-QWEVFDLHKYVAYKL- 178

Query: 182 GIESRSFCSTVCKMGLVPN----GVDSSTSGWSREFLEQIGLEELCEDGFRRLGGALDEP 237
              ++ +C    ++   PN    G D   +GWS+ F ++I           RL   +   
Sbjct: 179 ---AQEYCWNTERLSNHPNSNGIGHDGELAGWSKSFYDKI----------VRLPPNV--- 222

Query: 238 GSEFRSAGEPVXXXXXXXXXXXXXTPRCVVGSGVIDAYAGWVGTVGASPDGARESGGVEE 297
                + G P                  V+    ID Y+ W   + +             
Sbjct: 223 -----TIGCP---------KTIENEDSLVIVDSCIDCYSSWFSPLQSLNKNT-------- 260

Query: 298 LAGRLAAVAGTSTCLIM---LSQTPHFVEGVWGPYRDVLARGYWCTEGGQSCTGALLAHT 354
               L  VAGTSTC I      +T   V+G+WGP+ D+L       E G SC+G L+ H 
Sbjct: 261 ----LFLVAGTSTCYIYSPGTMKTETSVKGIWGPFTDILGANKVVYESGSSCSGKLIEHL 316

Query: 355 LHTHPAYTELHQAAQQRGLTDFDYINWRLDKLRAETGARSIRALAKHRFLYGDYHGNRSP 414
             +HP+   L+ +  Q      + IN     +     A SI   A + FLYGD  GNR+P
Sbjct: 317 FTSHPSAISLNLSTGQLISKLEEEIN-----IWETQNATSIHFEACNNFLYGDLDGNRTP 371

Query: 415 LADPSMRAAMVGLSMDVSQDDLALAVLTAFEFIALQARHILDHMAAAGLHVDTVYLSGGQ 474
             DP MR   +G S D S  DL +  +   E +A Q + ++D+       ++ +++ G Q
Sbjct: 372 FGDPYMRGMFIGESPDTSFRDLLVKYVCILECLAFQTKLMVDNFEKLN-SINELFICGSQ 430

Query: 475 ARNPLLTQLLADAVRRP-VVTPRHVGAAV-VFGSALLAAAAVENYLANTNATASSILPSS 532
           A+N  L +L++       ++ P+     + V G+ LL  A    YL     T+  ++P S
Sbjct: 431 AKNTRLLKLISLINDNALILVPKEKEDLMGVEGAYLLGKAG---YL----GTSVDLVPVS 483

Query: 533 ASRAPMHRLWQIMSRLTVPGNVVSPSPDADPDIRLLEAKYKVFLEMAEAQKLYRKLV 589
             R            ++V     S         +LL  KY + LEMAE Q+ +RK+V
Sbjct: 484 EPR----------EYISVKYTNDSDKIQQTKLYKLLLTKYIIHLEMAEQQQRFRKMV 530

>SAKL0C03432g Chr3 complement(325502..327145) [1644 bp, 547 aa] {ON}
           similar to uniprot|P53583 Saccharomyces cerevisiae
           YNL249C MPA43 Mitochondrial protein of unknown function
          Length = 547

 Score =  154 bits (389), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 174/611 (28%), Positives = 252/611 (41%), Gaps = 108/611 (17%)

Query: 11  VGVDVGTEFARACIID-KSGAILATTQNPISR-SQPKHDHITQSSSEIWGAVCKSVRAAV 68
           VGVD+G+   R  I   ++ ++L   + P+   S       TQS+ EI  A+        
Sbjct: 13  VGVDLGSSSVRVGIYSLENDSLLHVVERPVRYYSCGSSGRFTQSTGEIMAAL-------- 64

Query: 69  AESQVAVDE---------VAGINFDATCSLVVLD-EDSDGEVA----VGPDFSDNRQNVI 114
              Q  +DE         +      ATCS+ V   E  DG +A     G D S ++ NV+
Sbjct: 65  ---QECLDELGLRPGGRSIVSCGVAATCSMAVFTVEAGDGSLAPLDMSGLDGSSDK-NVV 120

Query: 115 LWMDHRA--VAEASEINSTGHSVLRYVGGKMSVEMQMPKIKWLQRHMPRGEFAKCKFYDL 172
            WMD  A    +A +   + H      GG +  EM +PK+  L    P       + +DL
Sbjct: 121 FWMDSVASEACDALDKRVSTHVKAALCGGFIP-EMGVPKLLHLVGQFPGRSL---EVFDL 176

Query: 173 PDFLTYQATGIESRSFCSTVCKMGLVPN----GVDSSTSGWSREFLEQIGLEELCEDGFR 228
             ++ Y      +R +   +  +   PN    G D    GW +EF   +          +
Sbjct: 177 HKYIAYDL----ARRYGWDMAALANRPNSNGIGHDGEVGGWPQEFYRNV---------LK 223

Query: 229 RLGGALDEPGSEFRSAGEPVXXXXXXXXXXXXXTPRCVVGSGVIDAYAGWVGTVGASPDG 288
                   P S F+                     R  V S  ID YA W G     P+ 
Sbjct: 224 LPATVAVGPASTFKGQ-------------------RVGVAS-CIDCYASWFGVCSTQPEQ 263

Query: 289 ARESGGVEELAGRLAAVAGTSTCLIMLSQTPHFV-EGVWGPYRDVL--ARGYWCT-EGGQ 344
           +            L  VAGTSTC +  S     V  G+WGP+ ++L      W   E GQ
Sbjct: 264 S------------LFLVAGTSTCYLYASAASKTVLPGMWGPFTNLLDGEEARWSVYEAGQ 311

Query: 345 SCTGALLAHTLHTHPAYTELHQAAQQRGLTDFDYINWRLDKLRAETGARSIRALAKHRFL 404
           S TG LL H   THPA  + +     R   D +    R+  + A++G  SI  LA+H FL
Sbjct: 312 STTGRLLEHLFETHPAARD-YAGDTGRLFKDLED---RIADMEADSGC-SIHHLARHMFL 366

Query: 405 YGDYHGNRSPLADPSMRAAMVGLSMDVSQDDLALAVLTAFEFIALQARHILDHM-AAAGL 463
           YG+  GNR+P ADP M    VG + D S  +LAL  +   EF+A Q R I++     A  
Sbjct: 367 YGELQGNRTPYADPRMCGMFVGETTDTSFANLALKYVVVLEFLAFQTRQIVEGFRTGAAA 426

Query: 464 HVDTVYLSGGQARNPLLTQLLADAV-RRPVVTP-RHVGAAVVFGSALLAAAAVENYLANT 521
            +  + ++G QARN  L  L++      PV  P R    A V G+ LL  A    YL   
Sbjct: 427 AIGELRVAGSQARNRRLLSLMSLVNGNMPVRVPARAAPLAGVRGAYLLGKA---RYL--- 480

Query: 522 NATASSILPSSASRAPMHRLWQIMSRLTVPGNVVSPSPDADPDIRLLEAKYKVFLEMAEA 581
           + +   ++    +  P          +T   N  +     +   RLLEAKY + L+MA+ 
Sbjct: 481 DVSLLDVVRKPGATIPT-------VEVTESSNYPACGATKENLRRLLEAKYAIHLDMAQV 533

Query: 582 QKLYRKLVDDV 592
           Q+ YR  +D V
Sbjct: 534 QQRYRSEIDAV 544

>KLLA0C02937g Chr3 complement(265205..266755) [1551 bp, 516 aa] {ON}
           similar to uniprot|P53583 Saccharomyces cerevisiae
           YNL249C MPA43 Mitochondrial protein of unknown function
           and similar to uniprot|Q04585 Saccharomyces cerevisiae
           YDR109C Hypothetical ORF
          Length = 516

 Score =  120 bits (302), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 119/503 (23%), Positives = 202/503 (40%), Gaps = 92/503 (18%)

Query: 6   MKQYYVGVDVGTEFARACIIDK-SGAILATTQNPISRSQPKHDHITQSSSEIWGAVCKSV 64
           M+   +GVD+G+   R  I D  + +++  T+  +   +  +  ITQ +S+I  AV K+ 
Sbjct: 1   MQDVGIGVDLGSTEFRIGIFDYYTDSLVKETKEKVPYFRHGNGIITQCTSDILTAVEKAF 60

Query: 65  RAAVAESQVAVDEVAGINFDATCSLVVLDEDSDGEVAVG--PDFSDNRQNVILWMDHRAV 122
                +       +  +   ATCS+VV  +  +  +      D +    ++I WM   A+
Sbjct: 61  NTLYIQEY----NICSLGVGATCSMVVGKQKDENLIPFNLIHDKNGRYHDIIFWMHSAAI 116

Query: 123 AEASEINS-TGHSVLRYVGGKMSVEMQMPKIKWLQRHMPRGEFAKCKFYDLPDFLTYQAT 181
            E   +N+ T  S+L + GGK   EM +PK+  L +             DL  +L ++ +
Sbjct: 117 EETEYLNNITDESILCHFGGKFFPEMAIPKLLHLNKLYKDDGLT---VLDLHIWLLWKIS 173

Query: 182 GIESRSFCSTVCKMG---LVP------NGV--DSSTSGWSREFLEQIGLEELCEDGFRRL 230
                       K+G   L+P      NG+  D    GWS+EF E + L ++        
Sbjct: 174 -----------LKLGHKELMPVQEPNSNGIGHDGELFGWSKEFYEHLQLNKIFIGN---- 218

Query: 231 GGALDEPGSEFRSAGEPVXXXXXXXXXXXXXTPRCVVGSGVIDAYAGWVGTVGASPDGAR 290
             A+ +   +F                          G   ID YA W            
Sbjct: 219 -NAVIKKNEQF--------------------------GDSCIDCYASWF----------- 240

Query: 291 ESGGVEELAGRLAAVAGTSTCLIMLSQT-PHFVEGVWGPYRDVLAR--------GYWCTE 341
           +      L   L  VAGTSTC +  S     F+ G+WGP++D+L           Y   E
Sbjct: 241 QCWSTAMLNRTLFVVAGTSTCFLYASDCFESFIPGIWGPFKDILVNRKHISKHDNYSVYE 300

Query: 342 GGQSCTGALLAHTLHTHPAYTELHQAAQQRGLTDFDYINWRLDKLRAETGARSIRALAKH 401
            G S TG LL   L THPA        +   +   + +  ++D L  ++  +SI  + K+
Sbjct: 301 AGISRTGVLLEKLLSTHPA-------VKDSDVNFLETVEHKID-LIEQSDTQSIHLMIKN 352

Query: 402 RFLYGDYHGNRSPLADPSMRAAMVGLSMDVSQDDLALAVLTAFEFIALQARHILDHMAAA 461
            F + DY    S         +++    + +  DLAL  +   E +A Q   +++     
Sbjct: 353 TFFHEDYEEFESSFVQKDTSGSILKEGYNPTLKDLALKYVVIIETLAFQIVDVINAFEEG 412

Query: 462 GLHVDTVYLSGGQARNPLLTQLL 484
            + +  + ++G QA+N  L Q+L
Sbjct: 413 HITISKLLITGSQAKNSRLLQIL 435

>NCAS0A00780 Chr1 complement(152317..153966) [1650 bp, 549 aa] {ON}
           Anc_1.111 YNL249C
          Length = 549

 Score = 62.4 bits (150), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 110/511 (21%), Positives = 191/511 (37%), Gaps = 89/511 (17%)

Query: 11  VGVDVGTEFARACIID-KSGAILAT-TQNPISRSQP--KHDHITQSSSEIWGAVCKSVRA 66
           +G+DVG+   R  I + + G  + T  +  + + +P  K  H TQ++  +  ++  ++  
Sbjct: 5   IGIDVGSTSVRIGIFNYEDGTTIKTIVKEMLYKHEPDSKLWHYTQNAFVMRDSIFTALEE 64

Query: 67  AVAESQVAVDEVAGINFDATCSLVVLDEDSDGE----VAVGPDFSDNRQNVILWMDHRAV 122
               S +   ++ G++  ATCS+V L  DS  +    + +  + ++N  ++I W DH A 
Sbjct: 65  LHVNSYIV--KICGVS--ATCSMVFLQRDSPADHLRPLTIIHEETNNTDSIIFWKDHTAQ 120

Query: 123 AEASEINS-----------TGHSVLRYVGGKMSV--EMQMPKIKWLQRHMPRGEFAKCKF 169
            EA  +N+             + +L  +G +     EM +PK+  L   +  G +     
Sbjct: 121 PEAQRLNNKLRTANEGLSGKENKILSTLGSRSGFIGEMAIPKLSRLINLIKEGFYETPHI 180

Query: 170 YDLPDFLTYQATGIESRSFCSTVCKMGLVPN----GVDSSTSGWSREFLEQIGLEELCED 225
            ++ D   Y A  +  +   +TV  +   PN    G+D    GW   F     +  L E 
Sbjct: 181 LEVYDLHVYIAQTLAQKYDWNTV-HLQNKPNVNGIGIDGELQGWDLSFY----VWALPET 235

Query: 226 GFRRLGGALDEPGSEFRSAGEPVXXXXXXXXXXXXXTPRCVVGSGVIDAYAGWVGTVGAS 285
            F    G    P                            V     ID YA W  T   +
Sbjct: 236 SFPICIG----PSKVINETS-------------------IVRPKSCIDCYASWFSTDACT 272

Query: 286 PDGARESGGVEELAGRLAAVAGTSTCLIML---SQTPHFVEG------VWGPYRDVLARG 336
            D              L   AGTSTC +     S   +F E        WGP+ +VL + 
Sbjct: 273 KDDT------------LFMAAGTSTCCLYAMPRSALEYFGEQQQPLSLFWGPFTNVLDKD 320

Query: 337 YWCT-EGGQSCTGALLAHTLHTHPAYTELHQAAQQRGLTDFDYINWRLDKLRAETGARSI 395
              + E G S TG LL    + H         A        +Y+  ++  +     + SI
Sbjct: 321 KKSSFEIGFSETGILLEKLFNKHQI------TASWSVAESINYVENQI-AIYERKKSHSI 373

Query: 396 RALAKHRFLYGDYHGNRSPLADPSMRAAMVGLSMDVSQDDLALAV--LTAFEFIALQARH 453
             L    +L+  Y     P    +     +  +  V+   L L    +   E++A Q  +
Sbjct: 374 Y-LEPEIYLFLKYLTLNKPSGRDTPDTPDLFGNDGVTDSTLGLIFKYIAILEYLAYQVSN 432

Query: 454 ILDHMAAAGLHVDTVYLSGGQARNPLLTQLL 484
           ++       + ++ + LSG QA+N  L  L+
Sbjct: 433 LILQFQKEKIIINHLVLSGSQAQNKRLLDLI 463

>NCAS0C05900 Chr3 (1214812..1216923) [2112 bp, 703 aa] {ON} Anc_4.9
           YHL032C
          Length = 703

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 38/146 (26%), Positives = 63/146 (43%), Gaps = 25/146 (17%)

Query: 379 INWRLDKLRAETGARSIRALAKHRFLYGD------YHGNRSPLADPSMRAAMVGLSMDVS 432
           + W  D LR    +  I  LA      G       ++G  +P  DP  RA ++G+S   +
Sbjct: 474 VQWLRDNLRLIPKSEHIGPLASRVRDSGGVVFVPAFNGLFAPYWDPDTRATIMGISQSTT 533

Query: 433 QDDLALAVLTAFEFIALQARHILDHMAAAGLHVDTVY---------LSGGQARNPLLTQL 483
              +A A   A E +  Q R IL  M +  ++ D+ Y         + GG +++  + Q+
Sbjct: 534 ASHIARA---AIEGVCFQVRAILKAMGSDEVYGDSAYEKKNLATLAVDGGMSKSNEVMQI 590

Query: 484 LADAV-------RRPVVTPRHVGAAV 502
            AD +       R P+V    +GAA+
Sbjct: 591 QADILGPCIKLRRSPIVECTALGAAI 616

>NDAI0H00220 Chr8 complement(30959..33391) [2433 bp, 810 aa] {ON}
           Anc_4.9 YHL032C
          Length = 810

 Score = 40.4 bits (93), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 41/158 (25%), Positives = 69/158 (43%), Gaps = 26/158 (16%)

Query: 379 INWRLDKLRAETGARSIRALAKHRFLYGD------YHGNRSPLADPSMRAAMVGLSMDVS 432
           + W  D LR    +  +  LA      G       ++G  +P  DP  RA ++G+S   +
Sbjct: 581 VQWLRDNLRLIPKSEHVGPLASRVRDSGGVVFVPAFNGLFAPYWDPDTRATIMGISQSTT 640

Query: 433 QDDLALAVLTAFEFIALQARHILDHMAAAGLH-------VDTVYLSGGQARNPLLTQLLA 485
              +A A   A E +  Q R IL  M+   +        V T+ + GG +++  + Q+ A
Sbjct: 641 ASHIARA---AIEGVCFQVRAILKAMSGDKIEDGYEKGTVVTLSVDGGMSKSDEVMQIQA 697

Query: 486 DAV-------RRPVVTPRHVGAAVVFGSALLAAAAVEN 516
           D +       R P+V    +GAA+   +A +A   VE+
Sbjct: 698 DILGPCIKLRRSPIVECTALGAAI---AANMAYKNVED 732

>TPHA0K02280 Chr11 (490104..492107) [2004 bp, 667 aa] {ON} Anc_4.9
           YHL032C
          Length = 667

 Score = 35.8 bits (81), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 40/159 (25%), Positives = 66/159 (41%), Gaps = 25/159 (15%)

Query: 379 INWRLDKLRAETGARSIRALAKHRFLYGD------YHGNRSPLADPSMRAAMVGLSMDVS 432
           + W  D LR    A  +  LA      G       + G  +P  DP+ RA+++G+S   +
Sbjct: 437 VQWLRDNLRLFPRAEDVGPLASQVKDSGGVVFVPAFSGLFAPYWDPNARASIMGMSQYTT 496

Query: 433 QDDLALAVLTAFEFIALQARHILDHMAAAGLH-------------VDTVYLSGGQARNPL 479
              +A A   A E +  QAR IL  M++  L              + T+ + GG +R+  
Sbjct: 497 AAHIARA---AVEGVCFQARAILKAMSSDVLQESGDFEDTYEKSALSTLAVDGGMSRSDE 553

Query: 480 LTQLLADAVRRPVVTPRH--VGAAVVFGSALLAAAAVEN 516
           + Q+ A+ +  P V  R          G+A+ A    +N
Sbjct: 554 VMQIQAN-ILGPCVKVRRSPTSECTALGAAIAANMGFKN 591

>KAFR0I00590 Chr9 complement(120194..122275) [2082 bp, 693 aa] {ON}
           Anc_8.590 YBR169C
          Length = 693

 Score = 35.4 bits (80), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 24/87 (27%), Positives = 40/87 (45%)

Query: 425 VGLSMDVSQDDLALAVLTAFEFIALQARHILDHMAAAGLHVDTVYLSGGQARNPLLTQLL 484
           V +S  +++++L   V    E +       L     +   VD V L GG  R P L Q +
Sbjct: 295 VDVSSQMTREELEELVKPLLERVTDPVTRALAQANISAEEVDYVELIGGTTRIPTLKQSI 354

Query: 485 ADAVRRPVVTPRHVGAAVVFGSALLAA 511
           +DA  +P+ T  +   A+  G+A + A
Sbjct: 355 SDAFGKPLSTTLNQDEAIAKGAAFICA 381

>TDEL0G01820 Chr7 (364972..367068) [2097 bp, 698 aa] {ON} Anc_4.9
           YHL032C
          Length = 698

 Score = 34.7 bits (78), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 35/118 (29%), Positives = 48/118 (40%), Gaps = 13/118 (11%)

Query: 379 INWRLDKLRAETGARSIRALAKHR------FLYGDYHGNRSPLADPSMRAAMVGLSMDVS 432
           + W  D LR    A  I  LA              + G  +P  DP  RA ++G+S   +
Sbjct: 454 VQWLRDNLRLIPKAEDIGPLASRVPDSGGVVFVPAFSGLFAPYWDPEARATIMGMSQFTT 513

Query: 433 QDDLALAVLTAFEFIALQARHILDHMAAAGLHV-DTVYL---SGGQARNPLLTQLLAD 486
              +A A   A E +  QAR IL  M++  L   D  +L   S G     LL+ L  D
Sbjct: 514 ASHIARA---AVEGVCFQARAILKAMSSDALGTKDRDFLEEVSAGTYEKSLLSTLAVD 568

>YPL106C Chr16 complement(350194..352275) [2082 bp, 693 aa] {ON}
           SSE1ATPase that is a component of the heat shock protein
           Hsp90 chaperone complex; binds unfolded proteins; member
           of the heat shock protein 70 (HSP70) family; localized
           to the cytoplasm
          Length = 693

 Score = 34.7 bits (78), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 23/87 (26%), Positives = 40/87 (45%)

Query: 425 VGLSMDVSQDDLALAVLTAFEFIALQARHILDHMAAAGLHVDTVYLSGGQARNPLLTQLL 484
           V +S  +S+++L   V    E +       L     +   VD V + GG  R P L Q +
Sbjct: 295 VDVSSQLSREELEELVKPLLERVTEPVTKALAQAKLSAEEVDFVEIIGGTTRIPTLKQSI 354

Query: 485 ADAVRRPVVTPRHVGAAVVFGSALLAA 511
           ++A  +P+ T  +   A+  G+A + A
Sbjct: 355 SEAFGKPLSTTLNQDEAIAKGAAFICA 381

>Smik_16.131 Chr16 complement(233512..235593) [2082 bp, 693 aa] {ON}
           YPL106C (REAL)
          Length = 693

 Score = 33.5 bits (75), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 23/87 (26%), Positives = 39/87 (44%)

Query: 425 VGLSMDVSQDDLALAVLTAFEFIALQARHILDHMAAAGLHVDTVYLSGGQARNPLLTQLL 484
           V +S  +S+++L   V    E +       L         VD V + GG  R P L Q +
Sbjct: 295 VDVSSQLSREELEELVKPLLERVTEPVTKALAQANLTADEVDFVEIIGGTTRIPTLKQSI 354

Query: 485 ADAVRRPVVTPRHVGAAVVFGSALLAA 511
           ++A  +P+ T  +   A+  G+A + A
Sbjct: 355 SEAFGKPLSTTLNQDEAIAKGAAFICA 381

>KNAG0A03400 Chr1 complement(431077..433149) [2073 bp, 690 aa] {ON}
           Anc_8.590 YBR169C
          Length = 690

 Score = 33.1 bits (74), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 30/57 (52%), Gaps = 3/57 (5%)

Query: 458 MAAAGLHVDTV---YLSGGQARNPLLTQLLADAVRRPVVTPRHVGAAVVFGSALLAA 511
           +A A L VD V    + GG  R P L Q ++DA  +P+ T  +   A+  G+A + A
Sbjct: 325 LAQAKLSVDDVDFIEIIGGTTRIPTLKQSISDAFGKPLSTTLNQDEAIAKGAAFICA 381

>Skud_16.177 Chr16 complement(321628..323709) [2082 bp, 693 aa] {ON}
           YPL106C (REAL)
          Length = 693

 Score = 33.1 bits (74), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 23/87 (26%), Positives = 39/87 (44%)

Query: 425 VGLSMDVSQDDLALAVLTAFEFIALQARHILDHMAAAGLHVDTVYLSGGQARNPLLTQLL 484
           V +S  +S+++L   V    E +       L         VD V + GG  R P L Q +
Sbjct: 295 VDVSSQLSREELEEMVKPLLERVTEPVSKALAQAKLTVDEVDFVEIIGGTTRIPTLKQSI 354

Query: 485 ADAVRRPVVTPRHVGAAVVFGSALLAA 511
           ++A  +P+ T  +   A+  G+A + A
Sbjct: 355 SEAFGKPLSTTLNQDEAIAKGAAFICA 381

>NDAI0C05820 Chr3 (1336776..1338902) [2127 bp, 708 aa] {ON}
           Anc_8.590 YBR169C
          Length = 708

 Score = 32.3 bits (72), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 18/87 (20%), Positives = 41/87 (47%)

Query: 425 VGLSMDVSQDDLALAVLTAFEFIALQARHILDHMAAAGLHVDTVYLSGGQARNPLLTQLL 484
           + ++  +++++L   V    + + +   H L         +D V + GG  R P L + +
Sbjct: 297 IDVTSQMTREELEELVQPLLKRVTVPILHALKQAKLKAEDIDFVEIIGGTTRIPTLKKSI 356

Query: 485 ADAVRRPVVTPRHVGAAVVFGSALLAA 511
           +DA  +P+ +  +   A+  G+A + A
Sbjct: 357 SDAFGKPLSSTLNQDEAIAKGAAFICA 383

>KLLA0E00595g Chr5 complement(49243..51228) [1986 bp, 661 aa] {ON}
           similar to uniprot|P32190 Saccharomyces cerevisiae
           YHL032C GUT1 Glycerol kinase converts glycerol to
           glycerol- 3-phosphate glucose repression of expression
           is mediated by Adr1p and Ino2p-Ino4p derepression of
           expression on non- fermentable carbon sources is
           mediated by Opi1p and Rsf1p
          Length = 661

 Score = 32.3 bits (72), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 35/135 (25%), Positives = 53/135 (39%), Gaps = 28/135 (20%)

Query: 379 INWRLDKLRAETGARSIRALAKHRFLYGD------YHGNRSPLADPSMRAAMVGLSMDVS 432
           + W  D LR    A  +  LA      G       + G  +P  DP  RA ++G+S   +
Sbjct: 427 VQWLRDNLRLIPRAEDVGPLASAVPNSGGVVFVPAFSGLFAPYWDPDARATIMGMSQYTT 486

Query: 433 QDDLALAVLTAFEFIALQARHILDHMAAAGLH----------VDTVY---------LSGG 473
              +A A   A E +  QAR IL  M++              VD  Y         + GG
Sbjct: 487 ASHIARA---AVEGVCFQARAILKAMSSDAFGSEDKDFLEEVVDETYEKTLLSTLAVDGG 543

Query: 474 QARNPLLTQLLADAV 488
            +R+  + Q+ AD +
Sbjct: 544 MSRSDEVMQIQADIL 558

>KLLA0E24597g Chr5 (2183993..2186077) [2085 bp, 694 aa] {ON} highly
           similar to uniprot|P32589 Saccharomyces cerevisiae
           YPL106C SSE1 HSP70 family member highly homologous to
           Ssa1p and Sse2p
          Length = 694

 Score = 32.3 bits (72), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 22/87 (25%), Positives = 38/87 (43%)

Query: 425 VGLSMDVSQDDLALAVLTAFEFIALQARHILDHMAAAGLHVDTVYLSGGQARNPLLTQLL 484
           V +S  +S+++L   V +  E +       L         VD V + GG  R P L   +
Sbjct: 295 VDVSSQLSREELEELVSSLLERVTDPVTKALKQANLTAEDVDFVEIIGGTTRIPCLKDAI 354

Query: 485 ADAVRRPVVTPRHVGAAVVFGSALLAA 511
           + A  +P+ T  +   A+  G+A + A
Sbjct: 355 SKAFNKPLSTTLNQDEAIAKGAAFVCA 381

>Smik_2.310 Chr2 complement(560092..562173) [2082 bp, 693 aa] {ON}
           YBR169C (REAL)
          Length = 693

 Score = 32.0 bits (71), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 21/87 (24%), Positives = 41/87 (47%)

Query: 425 VGLSMDVSQDDLALAVLTAFEFIALQARHILDHMAAAGLHVDTVYLSGGQARNPLLTQLL 484
           + +S  +S+++L   V    E +     + L         +D V + GG  R P+L + +
Sbjct: 295 IDVSSQLSREELEELVKPLLERVTDPIFNALSQAKLTVNDIDFVEIIGGTTRIPILKKSI 354

Query: 485 ADAVRRPVVTPRHVGAAVVFGSALLAA 511
           +DA  +P+ +  +   AV  G+A + A
Sbjct: 355 SDAFGKPLSSTLNQDEAVAKGAAFICA 381

>Suva_16.206 Chr16 complement(359950..362031) [2082 bp, 693 aa] {ON}
           YPL106C (REAL)
          Length = 693

 Score = 32.0 bits (71), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 22/87 (25%), Positives = 38/87 (43%)

Query: 425 VGLSMDVSQDDLALAVLTAFEFIALQARHILDHMAAAGLHVDTVYLSGGQARNPLLTQLL 484
           V +S  ++++ L   V    E +       L         VD V + GG  R P L Q +
Sbjct: 295 VDVSSQLTRESLEELVKPLLERVTEPVTRALAQANLTAEEVDFVEIIGGTTRIPTLKQSI 354

Query: 485 ADAVRRPVVTPRHVGAAVVFGSALLAA 511
           ++A  +P+ T  +   A+  G+A + A
Sbjct: 355 SEAFGKPLSTTLNQDEAIAKGAAFICA 381

>NDAI0E02590 Chr5 complement(537501..539558) [2058 bp, 685 aa] {ON}
           Anc_8.590
          Length = 685

 Score = 32.0 bits (71), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 22/87 (25%), Positives = 39/87 (44%)

Query: 425 VGLSMDVSQDDLALAVLTAFEFIALQARHILDHMAAAGLHVDTVYLSGGQARNPLLTQLL 484
           V +S  +++D+L   V    E +     + L         VD V + GG  R P L   +
Sbjct: 295 VDVSSQLTRDELEELVKPLLERVTEPVTNALAQAKLTPEDVDFVEIIGGTTRIPTLKNSI 354

Query: 485 ADAVRRPVVTPRHVGAAVVFGSALLAA 511
           ++A  +P+ T  +   A+  G+A + A
Sbjct: 355 SEAFGKPLSTTLNQDEAIAKGAAFICA 381

>Kwal_27.12262 s27 (1151990..1154071) [2082 bp, 693 aa] {ON} YPL106C
           (SSE1) - HSP70 family member, highly homologous to Ssa1p
           and Sse2p [contig 22] FULL
          Length = 693

 Score = 31.6 bits (70), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 21/87 (24%), Positives = 40/87 (45%)

Query: 425 VGLSMDVSQDDLALAVLTAFEFIALQARHILDHMAAAGLHVDTVYLSGGQARNPLLTQLL 484
           V +S  +++++L   V    E +     + L         VD V + GG  R P+L   +
Sbjct: 295 VDVSSQLTREELEQLVKPLLERVTEPVTNALAQANLKAEDVDFVEIIGGTTRIPVLKNAI 354

Query: 485 ADAVRRPVVTPRHVGAAVVFGSALLAA 511
           ++A  +P+ T  +   A+  G+A + A
Sbjct: 355 SEAFGKPLSTTLNQDEAIAKGAAFICA 381

>CAGL0M06083g Chr13 complement(634963..637047) [2085 bp, 694 aa]
           {ON} highly similar to uniprot|P32589 Saccharomyces
           cerevisiae YPL106c SSE1 or uniprot|P32590 Saccharomyces
           cerevisiae YBR169c SSE2
          Length = 694

 Score = 31.6 bits (70), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 30/57 (52%), Gaps = 3/57 (5%)

Query: 458 MAAAGL---HVDTVYLSGGQARNPLLTQLLADAVRRPVVTPRHVGAAVVFGSALLAA 511
           +A AGL    VD V + GG  R P L   +++A  +P+ T  +   A+  G+A + A
Sbjct: 325 LAQAGLTKDDVDFVEIIGGTTRIPTLKNSISEAFGKPLSTTLNQDEAIAKGAAFICA 381

>Ecym_7227 Chr7 (469487..469510,469584..472721) [3162 bp, 1053 aa]
            {ON} similar to Ashbya gossypii AGR166W
          Length = 1053

 Score = 31.6 bits (70), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 42/182 (23%), Positives = 73/182 (40%), Gaps = 18/182 (9%)

Query: 374  TDFDYINWRLDKLRAETGARSIRALAKHRFLYGDY---HGNRSPLADPSMRAAMVGLSMD 430
            T   Y+ + L++L     A   RA  +  +++ ++   H   +  +DP +  +M+G    
Sbjct: 840  TGLPYLVYLLERLITHYKATLTRA--QFDYIFSNFFIQHYETAIASDPDLIESMIGFINK 897

Query: 431  VSQDDLALAVLTAF-------EFI-ALQARHILDHMAAAGLHVDTVYLS-----GGQARN 477
                  AL V +++       +F+  L+A+      A       TV L      GG A  
Sbjct: 898  TMDARPALVVNSSYWDAFILPQFLRYLRAKEHFTISAVTKFWTKTVKLKQQSRDGGLASA 957

Query: 478  PLLTQLLADAVRRPVVTPRHVGAAVVFGSALLAAAAVENYLANTNATASSILPSSASRAP 537
             L+T +    V   +    H   + VF  A +  A V N+  NT A  +++LPS      
Sbjct: 958  KLITSIGDQLVATTMYGLLHTHRSEVFYYAEIIRALVANHPLNTKAWLTAVLPSLCDNPT 1017

Query: 538  MH 539
             H
Sbjct: 1018 AH 1019

>Suva_4.422 Chr4 complement(743352..745433) [2082 bp, 693 aa] {ON}
           YBR169C (REAL)
          Length = 693

 Score = 31.2 bits (69), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 27/47 (57%)

Query: 465 VDTVYLSGGQARNPLLTQLLADAVRRPVVTPRHVGAAVVFGSALLAA 511
           VD V + GG  R P+L + ++DA  +P+ +  +   AV  G+A + A
Sbjct: 335 VDFVEIIGGTTRIPILKRSISDAFGKPLSSTLNQDEAVAKGAAFICA 381

>SAKL0H25938g Chr8 (2281415..2283472) [2058 bp, 685 aa] {ON} similar
           to uniprot|P32190 Saccharomyces cerevisiae YHL032C GUT1
           Glycerol kinase converts glycerol to glycerol-
           3-phosphate glucose repression of expression is mediated
           by Adr1p and Ino2p-Ino4p derepression of expression on
           non- fermentable carbon sources is mediated by Opi1p and
           Rsf1p
          Length = 685

 Score = 31.2 bits (69), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 26/88 (29%), Positives = 38/88 (43%), Gaps = 9/88 (10%)

Query: 379 INWRLDKLRAETGARSIRALAKHRFLYGD------YHGNRSPLADPSMRAAMVGLSMDVS 432
           + W  D LR    A  +  LA      G       + G  +P  DP  RA ++G+S   +
Sbjct: 443 VQWLRDNLRLIPKAEDVGPLACRVPDSGGVVFVPAFSGLFAPYWDPDARATIMGMSQYTT 502

Query: 433 QDDLALAVLTAFEFIALQARHILDHMAA 460
              +A A   A E +  QAR IL  M++
Sbjct: 503 ASHIARA---AVEGVCFQARAILKAMSS 527

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.133    0.398 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 56,251,364
Number of extensions: 2151790
Number of successful extensions: 5396
Number of sequences better than 10.0: 54
Number of HSP's gapped: 5407
Number of HSP's successfully gapped: 81
Length of query: 596
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 481
Effective length of database: 40,294,809
Effective search space: 19381803129
Effective search space used: 19381803129
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 69 (31.2 bits)