Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
AGR091W8.258ON41041022240.0
Ecym_43128.258ON41141118410.0
SAKL0H17138g8.258ON41941615140.0
ZYRO0C01738g8.258ON41441114810.0
KLLA0F19063g8.258ON41541114740.0
KLTH0G13772g8.258ON42041714560.0
KAFR0B027008.258ON42041714510.0
Kwal_56.238328.258ON41941514500.0
YLR085C (ARP6)8.258ON43843414320.0
NCAS0B049908.258ON42041614210.0
TDEL0F038508.258ON41941514120.0
Skud_12.1538.258ON43843614070.0
Smik_12.1448.258ON43843514050.0
Kpol_543.368.258ON42742314030.0
NDAI0B019608.258ON43943614010.0
KNAG0G020108.258ON42442313880.0
Suva_10.1698.258ON43843413880.0
TBLA0H014608.258ON44243913780.0
CAGL0L12166g8.258ON42141513530.0
TPHA0A018308.258ON42141913091e-180
KLLA0E22925g2.117ON3804142392e-21
NDAI0G029003.161ON3913692242e-19
NCAS0C035503.161ON3923832233e-19
Ecym_63852.117ON3774162215e-19
SAKL0E11814g2.117ON3794172199e-19
TBLA0F008703.161ON3913612163e-18
Ecym_15208.23ON3763462119e-18
KLTH0F06490g3.161ON3913892111e-17
NCAS0C037008.23ON3754072111e-17
Suva_4.2203.161ON3913592111e-17
NDAI0G030408.23ON3754072101e-17
Skud_6.318.23ON3603462092e-17
TDEL0C004708.23ON3754072092e-17
CAGL0K12694g8.23ON3754072092e-17
Suva_6.188.23ON3754072092e-17
Smik_6.398.23ON3754072092e-17
YFL039C (ACT1)8.23ON3754072092e-17
KNAG0L002508.23ON3754072092e-17
KAFR0D009408.23ON3754072092e-17
ABR222W8.23ON3764072092e-17
SAKL0B00968g8.23ON3754072092e-17
TPHA0D002508.23ON3754072082e-17
YDL029W (ARP2)3.161ON3913622082e-17
KLLA0C03850g3.161ON3913882083e-17
ZYRO0F02772g8.23ON3754062073e-17
Smik_4.2063.161ON3913622073e-17
AFR051W2.117ON4054152083e-17
SAKL0C07370g3.161ON3913342074e-17
TBLA0C004408.23ON3754072065e-17
KLLA0D05357g8.23ON3754072065e-17
Kpol_1058.158.23ON3754072055e-17
CAGL0K01595g3.161ON3913312065e-17
Skud_4.2223.161ON3913592065e-17
Kwal_14.11098.23ON3603462038e-17
KLTH0G18832g8.23ON3754072048e-17
ADR316W3.161ON3913862031e-16
TDEL0D046103.161ON3913072022e-16
KAFR0C01040na 1ON3373242002e-16
Ecym_52373.161ON3913602003e-16
ZYRO0B04928g3.161ON3913001985e-16
KNAG0K01130na 1ON3933611977e-16
Kwal_33.141773.161ON3373001959e-16
Kpol_479.253.161ON3913591923e-15
Kwal_33.146422.117ON3834181905e-15
KLTH0B05940g2.117ON3834261897e-15
NCAS0B071302.117ON3814211871e-14
NDAI0B044602.117ON3814131852e-14
ZYRO0G05676g2.117ON3814051801e-13
ZYRO0G01936g1.514ON4614121811e-13
KLLA0B13904g1.514ON4563691782e-13
TPHA0A009203.161ON3913711764e-13
TBLA0B010702.117ON3834191746e-13
TPHA0O010401.514ON4583631756e-13
TDEL0B048102.117ON3734051729e-13
YHR129C (ARP1)2.117ON3844041711e-12
CAGL0H09042g2.117ON3873731711e-12
KNAG0B001701.514ON4533591659e-12
TPHA0I013002.117ON3793801649e-12
KNAG0I018602.248ON7531381651e-11
Kpol_1056.161.514ON4603661632e-11
SAKL0D12804g1.514ON4563661622e-11
NCAS0A122701.514ON4543671605e-11
Skud_8.1902.117ON3844041586e-11
KAFR0D037001.514ON4493691588e-11
TBLA0D036801.514ON4583341571e-10
CAGL0F00517g1.514ON4543841571e-10
NDAI0A039701.514ON4623681561e-10
KNAG0H036502.117ON3874071551e-10
Smik_8.2102.117ON3844071551e-10
Ecym_31531.514ON4583661552e-10
Smik_10.3551.514ON4493671542e-10
Skud_10.2891.514ON4493671533e-10
TDEL0F004701.514ON4613591524e-10
Suva_15.3262.117ON3844041515e-10
Suva_12.1541.514ON4493721515e-10
KAFR0F005902.117ON3864111505e-10
YJR065C (ARP3)1.514ON4493671506e-10
AFR419C1.514ON4553661507e-10
KLTH0C02508g1.514ON4513631507e-10
Kwal_27.99581.514ON4453371498e-10
SAKL0E08602g2.248ON7471411508e-10
Kpol_1023.188.23ON3192641479e-10
KLTH0G09482g2.248ON7451391472e-09
TPHA0C031602.248ON7551321472e-09
KLLA0F03421g2.248ON7471461463e-09
Kwal_23.48482.248ON7451391454e-09
Kpol_1003.162.248ON7491371411e-08
ADL253C2.248ON7511381402e-08
TDEL0C041402.248ON7491381383e-08
NDAI0D010602.248ON7531621322e-07
Smik_14.2672.248ON7551421312e-07
Suva_14.2812.248ON7551381312e-07
KAFR0J011602.248ON7511381303e-07
YNL059C (ARP5)2.248ON7551421284e-07
Ecym_32852.248ON7461461251e-06
ZYRO0A01584g2.248ON7481351251e-06
Skud_14.2722.248ON7551731223e-06
TBLA0E038602.248ON7591441205e-06
Kpol_282.41.287ON5011151186e-06
CAGL0J10054g2.248ON7541361187e-06
NDAI0G055801.287ON5151491178e-06
AFR105C1.287ON4793251098e-05
TBLA0D053601.287ON5961411071e-04
YJL081C (ARP4)1.287ON4892091044e-04
TPHA0I010301.287ON5031061034e-04
Kwal_14.23771.287ON4811121025e-04
Suva_6.1541.287ON4891461018e-04
KLTH0H09702g1.287ON4811051009e-04
Ecym_63301.287ON4801141000.001
CAGL0M03201g1.287ON493156980.002
Smik_10.1611.287ON489209970.002
Skud_10.1321.287ON488206940.005
ZYRO0G21428g1.287ON483105940.006
TDEL0D015501.287ON48089930.006
SAKL0D05874g1.287ON497115930.007
KNAG0B019201.287ON505221910.010
KAFR0A015601.287ON485214880.024
ACR184C7.448ON40186880.026
NCAS0B060601.287ON497156870.032
KLLA0D02288g1.287ON520150850.065
NCAS0G030502.248ON743126840.10
NDAI0A013007.448ON565149820.15
SAKL0F13772g7.448ON422300790.34
ZYRO0G17182g7.448ON465319780.39
TDEL0C031207.448ON438207780.42
NDAI0E003908.824ON117089770.69
NDAI0H019507.21ON856173741.7
ZYRO0G19954g2.441ON700105722.4
Kpol_1030.38.394ON659129722.5
KLLA0E06315g7.448ON43865703.7
KLLA0E03213g5.477ON788154687.2
AEL042C1.432ON547102687.4
YGR266W5.39ON70155687.8
TPHA0B014607.448ON485191679.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AGR091W
         (410 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AGR091W Chr7 (907238..908470) [1233 bp, 410 aa] {ON} Syntenic ho...   861   0.0  
Ecym_4312 Chr4 (671413..672648) [1236 bp, 411 aa] {ON} similar t...   713   0.0  
SAKL0H17138g Chr8 (1515123..1516382) [1260 bp, 419 aa] {ON} high...   587   0.0  
ZYRO0C01738g Chr3 (135066..136310) [1245 bp, 414 aa] {ON} simila...   575   0.0  
KLLA0F19063g Chr6 complement(1756529..1757776) [1248 bp, 415 aa]...   572   0.0  
KLTH0G13772g Chr7 (1188875..1190137) [1263 bp, 420 aa] {ON} simi...   565   0.0  
KAFR0B02700 Chr2 complement(543626..544888) [1263 bp, 420 aa] {O...   563   0.0  
Kwal_56.23832 s56 (726199..727458) [1260 bp, 419 aa] {ON} YLR085...   563   0.0  
YLR085C Chr12 complement(300673..301989) [1317 bp, 438 aa] {ON} ...   556   0.0  
NCAS0B04990 Chr2 complement(916170..917432) [1263 bp, 420 aa] {O...   551   0.0  
TDEL0F03850 Chr6 complement(707880..709139) [1260 bp, 419 aa] {O...   548   0.0  
Skud_12.153 Chr12 complement(284046..285362) [1317 bp, 438 aa] {...   546   0.0  
Smik_12.144 Chr12 complement(280513..281829) [1317 bp, 438 aa] {...   545   0.0  
Kpol_543.36 s543 complement(80922..82205) [1284 bp, 427 aa] {ON}...   545   0.0  
NDAI0B01960 Chr2 complement(477552..478871) [1320 bp, 439 aa] {O...   544   0.0  
KNAG0G02010 Chr7 complement(447621..448895) [1275 bp, 424 aa] {O...   539   0.0  
Suva_10.169 Chr10 complement(305734..307050) [1317 bp, 438 aa] {...   539   0.0  
TBLA0H01460 Chr8 complement(323962..325290) [1329 bp, 442 aa] {O...   535   0.0  
CAGL0L12166g Chr12 complement(1308681..1309946) [1266 bp, 421 aa...   525   0.0  
TPHA0A01830 Chr1 (369897..371162) [1266 bp, 421 aa] {ON} Anc_8.2...   508   e-180
KLLA0E22925g Chr5 complement(2040279..2041421) [1143 bp, 380 aa]...    97   2e-21
NDAI0G02900 Chr7 (671423..671444,671694..672847) [1176 bp, 391 a...    91   2e-19
NCAS0C03550 Chr3 (709102..709123,709273..710429) [1179 bp, 392 a...    91   3e-19
Ecym_6385 Chr6 complement(749508..750641) [1134 bp, 377 aa] {ON}...    90   5e-19
SAKL0E11814g Chr5 complement(984199..985338) [1140 bp, 379 aa] {...    89   9e-19
TBLA0F00870 Chr6 complement(222947..224100,224325..224346) [1176...    88   3e-18
Ecym_1520 Chr1 (1071497..1071506,1072543..1073663) [1131 bp, 376...    86   9e-18
KLTH0F06490g Chr6 complement(561947..563100,563192..563213) [117...    86   1e-17
NCAS0C03700 Chr3 complement(745133..746250,746901..746910) [1128...    86   1e-17
Suva_4.220 Chr4 (389822..389843,389967..391120) [1176 bp, 391 aa...    86   1e-17
NDAI0G03040 Chr7 complement(708715..709832,710590..710599) [1128...    86   1e-17
Skud_6.31 Chr6 complement(56454..57536) [1083 bp, 360 aa] {ON} Y...    85   2e-17
TDEL0C00470 Chr3 complement(72546..73663,73929..73938) [1128 bp,...    85   2e-17
CAGL0K12694g Chr11 (1258451..1258460,1259340..1260457) [1128 bp,...    85   2e-17
Suva_6.18 Chr6 complement(26677..27794,28152..28161) [1128 bp, 3...    85   2e-17
Smik_6.39 Chr6 complement(68673..69790,70076..70085) [1128 bp, 3...    85   2e-17
YFL039C Chr6 complement(53260..54377,54687..54696) [1128 bp, 375...    85   2e-17
KNAG0L00250 Chr12 complement(32595..33712,34194..34203) [1128 bp...    85   2e-17
KAFR0D00940 Chr4 complement(198280..199397,199945..199954) [1128...    85   2e-17
ABR222W Chr2 (818719..818728,819032..820152) [1131 bp, 376 aa] {...    85   2e-17
SAKL0B00968g Chr2 complement(89966..91083,91524..91533) [1128 bp...    85   2e-17
TPHA0D00250 Chr4 complement(34030..35147,35712..35721) [1128 bp,...    85   2e-17
YDL029W Chr4 (399340..399361,399485..400638) [1176 bp, 391 aa] {...    85   2e-17
KLLA0C03850g Chr3 complement(351772..352947) [1176 bp, 391 aa] {...    85   3e-17
ZYRO0F02772g Chr6 complement(235322..236439,236524..236533) [112...    84   3e-17
Smik_4.206 Chr4 (379506..379527,379652..380805) [1176 bp, 391 aa...    84   3e-17
AFR051W Chr6 (522829..524046) [1218 bp, 405 aa] {ON} Syntenic ho...    85   3e-17
SAKL0C07370g Chr3 complement(680403..681556,681672..681693) [117...    84   4e-17
TBLA0C00440 Chr3 complement(81591..82708,83412..83421) [1128 bp,...    84   5e-17
KLLA0D05357g Chr4 (461726..461735,462516..463633) [1128 bp, 375 ...    84   5e-17
Kpol_1058.15 s1058 complement(49082..50199,50349..50358) [1128 b...    84   5e-17
CAGL0K01595g Chr11 (141618..141639,141971..143124) [1176 bp, 391...    84   5e-17
Skud_4.222 Chr4 (394174..394195,394321..395474) [1176 bp, 391 aa...    84   5e-17
Kwal_14.1109 s14 complement(199181..200263) [1083 bp, 360 aa] {O...    83   8e-17
KLTH0G18832g Chr7 (1626178..1626187,1626854..1627971) [1128 bp, ...    83   8e-17
ADR316W Chr4 (1261691..1262866) [1176 bp, 391 aa] {ON} Syntenic ...    83   1e-16
TDEL0D04610 Chr4 complement(846092..847245,847317..847338) [1176...    82   2e-16
KAFR0C01040 Chr3 complement(212570..213583) [1014 bp, 337 aa] {O...    82   2e-16
Ecym_5237 Chr5 complement(489181..490356) [1176 bp, 391 aa] {ON}...    82   3e-16
ZYRO0B04928g Chr2 complement(398291..399444,399538..399559) [117...    81   5e-16
KNAG0K01130 Chr11 (220520..220541,220822..221981) [1182 bp, 393 ...    80   7e-16
Kwal_33.14177 s33 complement(557522..558535) [1014 bp, 337 aa] {...    80   9e-16
Kpol_479.25 s479 complement(49227..50402) [1176 bp, 391 aa] {ON}...    79   3e-15
Kwal_33.14642 s33 (753758..754909) [1152 bp, 383 aa] {ON} YHR129...    78   5e-15
KLTH0B05940g Chr2 complement(485135..486286) [1152 bp, 383 aa] {...    77   7e-15
NCAS0B07130 Chr2 complement(1354064..1355209) [1146 bp, 381 aa] ...    77   1e-14
NDAI0B04460 Chr2 complement(1115478..1116623) [1146 bp, 381 aa] ...    76   2e-14
ZYRO0G05676g Chr7 (452257..453402) [1146 bp, 381 aa] {ON} simila...    74   1e-13
ZYRO0G01936g Chr7 complement(144085..145470) [1386 bp, 461 aa] {...    74   1e-13
KLLA0B13904g Chr2 complement(1218228..1219598) [1371 bp, 456 aa]...    73   2e-13
TPHA0A00920 Chr1 (181205..182380) [1176 bp, 391 aa] {ON} Anc_2.1...    72   4e-13
TBLA0B01070 Chr2 (236811..237962) [1152 bp, 383 aa] {ON} Anc_2.1...    72   6e-13
TPHA0O01040 Chr15 (196178..197554) [1377 bp, 458 aa] {ON} Anc_1....    72   6e-13
TDEL0B04810 Chr2 (849529..850650) [1122 bp, 373 aa] {ON} Anc_2.1...    71   9e-13
YHR129C Chr8 complement(362999..364153) [1155 bp, 384 aa] {ON}  ...    70   1e-12
CAGL0H09042g Chr8 (884592..885755) [1164 bp, 387 aa] {ON} simila...    70   1e-12
KNAG0B00170 Chr2 (18478..19839) [1362 bp, 453 aa] {ON} Anc_1.514...    68   9e-12
TPHA0I01300 Chr9 (295950..297089) [1140 bp, 379 aa] {ON} Anc_2.1...    68   9e-12
KNAG0I01860 Chr9 (364390..366651) [2262 bp, 753 aa] {ON} Anc_2.2...    68   1e-11
Kpol_1056.16 s1056 (36274..37656) [1383 bp, 460 aa] {ON} (36274....    67   2e-11
SAKL0D12804g Chr4 complement(1066058..1067428) [1371 bp, 456 aa]...    67   2e-11
NCAS0A12270 Chr1 complement(2428834..2430198) [1365 bp, 454 aa] ...    66   5e-11
Skud_8.190 Chr8 complement(336365..337519) [1155 bp, 384 aa] {ON...    65   6e-11
KAFR0D03700 Chr4 complement(718438..719787) [1350 bp, 449 aa] {O...    65   8e-11
TBLA0D03680 Chr4 (914687..916063) [1377 bp, 458 aa] {ON} Anc_1.5...    65   1e-10
CAGL0F00517g Chr6 (54743..56107) [1365 bp, 454 aa] {ON} highly s...    65   1e-10
NDAI0A03970 Chr1 (895219..896607) [1389 bp, 462 aa] {ON} Anc_1.514     65   1e-10
KNAG0H03650 Chr8 complement(678598..679761) [1164 bp, 387 aa] {O...    64   1e-10
Smik_8.210 Chr8 complement(339093..340247) [1155 bp, 384 aa] {ON...    64   1e-10
Ecym_3153 Chr3 (288213..289589) [1377 bp, 458 aa] {ON} similar t...    64   2e-10
Smik_10.355 Chr10 complement(546673..548022) [1350 bp, 449 aa] {...    64   2e-10
Skud_10.289 Chr10 complement(515300..516649) [1350 bp, 449 aa] {...    64   3e-10
TDEL0F00470 Chr6 (80760..82145) [1386 bp, 461 aa] {ON} Anc_1.514...    63   4e-10
Suva_15.326 Chr15 complement(565392..566546) [1155 bp, 384 aa] {...    63   5e-10
Suva_12.154 Chr12 complement(235605..236954) [1350 bp, 449 aa] {...    63   5e-10
KAFR0F00590 Chr6 (120359..121519) [1161 bp, 386 aa] {ON} Anc_2.1...    62   5e-10
YJR065C Chr10 complement(557809..559158) [1350 bp, 449 aa] {ON} ...    62   6e-10
AFR419C Chr6 complement(1186951..1188318) [1368 bp, 455 aa] {ON}...    62   7e-10
KLTH0C02508g Chr3 (224722..226077) [1356 bp, 451 aa] {ON} highly...    62   7e-10
Kwal_27.9958 s27 (139638..140975) [1338 bp, 445 aa] {ON} YJR065C...    62   8e-10
SAKL0E08602g Chr5 (702206..704449) [2244 bp, 747 aa] {ON} simila...    62   8e-10
Kpol_1023.18 s1023 complement(36072..36143,36193..36201,36244..3...    61   9e-10
KLTH0G09482g Chr7 complement(789233..791470) [2238 bp, 745 aa] {...    61   2e-09
TPHA0C03160 Chr3 complement(699424..701691) [2268 bp, 755 aa] {O...    61   2e-09
KLLA0F03421g Chr6 complement(321000..323243) [2244 bp, 747 aa] {...    61   3e-09
Kwal_23.4848 s23 complement(892162..894399) [2238 bp, 745 aa] {O...    60   4e-09
Kpol_1003.16 s1003 complement(43655..45904) [2250 bp, 749 aa] {O...    59   1e-08
ADL253C Chr4 complement(255550..257805) [2256 bp, 751 aa] {ON} S...    59   2e-08
TDEL0C04140 Chr3 (732580..734829) [2250 bp, 749 aa] {ON} Anc_2.2...    58   3e-08
NDAI0D01060 Chr4 complement(238631..240892) [2262 bp, 753 aa] {O...    55   2e-07
Smik_14.267 Chr14 complement(493008..495275) [2268 bp, 755 aa] {...    55   2e-07
Suva_14.281 Chr14 complement(511583..513850) [2268 bp, 755 aa] {...    55   2e-07
KAFR0J01160 Chr10 (212425..214680) [2256 bp, 751 aa] {ON} Anc_2....    55   3e-07
YNL059C Chr14 complement(512668..514935) [2268 bp, 755 aa] {ON} ...    54   4e-07
Ecym_3285 Chr3 complement(539184..541424) [2241 bp, 746 aa] {ON}...    53   1e-06
ZYRO0A01584g Chr1 complement(130119..132365) [2247 bp, 748 aa] {...    53   1e-06
Skud_14.272 Chr14 complement(502920..505187) [2268 bp, 755 aa] {...    52   3e-06
TBLA0E03860 Chr5 complement(969721..972000) [2280 bp, 759 aa] {O...    51   5e-06
Kpol_282.4 s282 (8483..9988) [1506 bp, 501 aa] {ON} (8483..9988)...    50   6e-06
CAGL0J10054g Chr10 complement(985402..987666) [2265 bp, 754 aa] ...    50   7e-06
NDAI0G05580 Chr7 complement(1374852..1376399) [1548 bp, 515 aa] ...    50   8e-06
AFR105C Chr6 complement(625098..626537) [1440 bp, 479 aa] {ON} S...    47   8e-05
TBLA0D05360 Chr4 (1321243..1323033) [1791 bp, 596 aa] {ON} Anc_1...    46   1e-04
YJL081C Chr10 complement(283802..285271) [1470 bp, 489 aa] {ON} ...    45   4e-04
TPHA0I01030 Chr9 complement(236150..237661) [1512 bp, 503 aa] {O...    44   4e-04
Kwal_14.2377 s14 complement(733179..734624) [1446 bp, 481 aa] {O...    44   5e-04
Suva_6.154 Chr6 (266531..268000) [1470 bp, 489 aa] {ON} YJL081C ...    44   8e-04
KLTH0H09702g Chr8 complement(835255..836700) [1446 bp, 481 aa] {...    43   9e-04
Ecym_6330 Chr6 (632900..634342) [1443 bp, 480 aa] {ON} similar t...    43   0.001
CAGL0M03201g Chr13 complement(364771..366252) [1482 bp, 493 aa] ...    42   0.002
Smik_10.161 Chr10 complement(275455..276924) [1470 bp, 489 aa] {...    42   0.002
Skud_10.132 Chr10 complement(251748..253214) [1467 bp, 488 aa] {...    41   0.005
ZYRO0G21428g Chr7 (1766725..1768176) [1452 bp, 483 aa] {ON} high...    41   0.006
TDEL0D01550 Chr4 complement(305973..307415) [1443 bp, 480 aa] {O...    40   0.006
SAKL0D05874g Chr4 complement(479873..481366) [1494 bp, 497 aa] {...    40   0.007
KNAG0B01920 Chr2 complement(362300..363817) [1518 bp, 505 aa] {O...    40   0.010
KAFR0A01560 Chr1 complement(311746..313203) [1458 bp, 485 aa] {O...    39   0.024
ACR184C Chr3 complement(669411..670616) [1206 bp, 401 aa] {ON} S...    39   0.026
NCAS0B06060 Chr2 complement(1146248..1147741) [1494 bp, 497 aa] ...    38   0.032
KLLA0D02288g Chr4 complement(194724..196286) [1563 bp, 520 aa] {...    37   0.065
NCAS0G03050 Chr7 complement(560525..562756) [2232 bp, 743 aa] {O...    37   0.10 
NDAI0A01300 Chr1 complement(280662..282359) [1698 bp, 565 aa] {O...    36   0.15 
SAKL0F13772g Chr6 (1099703..1100971) [1269 bp, 422 aa] {ON} simi...    35   0.34 
ZYRO0G17182g Chr7 (1417793..1419190) [1398 bp, 465 aa] {ON} simi...    35   0.39 
TDEL0C03120 Chr3 (558606..559922) [1317 bp, 438 aa] {ON} Anc_7.4...    35   0.42 
NDAI0E00390 Chr5 complement(61806..65318) [3513 bp, 1170 aa] {ON...    34   0.69 
NDAI0H01950 Chr8 complement(474375..476945) [2571 bp, 856 aa] {O...    33   1.7  
ZYRO0G19954g Chr7 (1653353..1655455) [2103 bp, 700 aa] {ON} high...    32   2.4  
Kpol_1030.3 s1030 complement(4345..6324) [1980 bp, 659 aa] {ON} ...    32   2.5  
KLLA0E06315g Chr5 complement(567309..568625) [1317 bp, 438 aa] {...    32   3.7  
KLLA0E03213g Chr5 complement(299014..301380) [2367 bp, 788 aa] {...    31   7.2  
AEL042C Chr5 complement(557191..558834) [1644 bp, 547 aa] {ON} S...    31   7.4  
YGR266W Chr7 (1022656..1024761) [2106 bp, 701 aa] {ON} Protein o...    31   7.8  
TPHA0B01460 Chr2 complement(325847..327304) [1458 bp, 485 aa] {O...    30   9.8  

>AGR091W Chr7 (907238..908470) [1233 bp, 410 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR085C (ARP6)
          Length = 410

 Score =  861 bits (2224), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 410/410 (100%), Positives = 410/410 (100%)

Query: 1   MRVPLLMENGSYEIKFGPANLETPYRARNCLTRDRYGRYHLSNQMDQIRDISHCHIRRPS 60
           MRVPLLMENGSYEIKFGPANLETPYRARNCLTRDRYGRYHLSNQMDQIRDISHCHIRRPS
Sbjct: 1   MRVPLLMENGSYEIKFGPANLETPYRARNCLTRDRYGRYHLSNQMDQIRDISHCHIRRPS 60

Query: 61  ELGQLISWELEEQIWDYCLFNPDEFGWELKDSKDVDLIASETCMTIPEISKNMDQVVFEE 120
           ELGQLISWELEEQIWDYCLFNPDEFGWELKDSKDVDLIASETCMTIPEISKNMDQVVFEE
Sbjct: 61  ELGQLISWELEEQIWDYCLFNPDEFGWELKDSKDVDLIASETCMTIPEISKNMDQVVFEE 120

Query: 121 YEFGSMMKCPVAQFVPFDRARDYDIVGGAGEVVEAKSGYNNFQLVVDSGFNCTWVMPVIK 180
           YEFGSMMKCPVAQFVPFDRARDYDIVGGAGEVVEAKSGYNNFQLVVDSGFNCTWVMPVIK
Sbjct: 121 YEFGSMMKCPVAQFVPFDRARDYDIVGGAGEVVEAKSGYNNFQLVVDSGFNCTWVMPVIK 180

Query: 181 GVPYYKATKKLDIGGRFLNGLLKETISFRHYNVMDETILINNIKEQCCFMPPVSYFDSFQ 240
           GVPYYKATKKLDIGGRFLNGLLKETISFRHYNVMDETILINNIKEQCCFMPPVSYFDSFQ
Sbjct: 181 GVPYYKATKKLDIGGRFLNGLLKETISFRHYNVMDETILINNIKEQCCFMPPVSYFDSFQ 240

Query: 241 RKEETRVEYILPDFQTSLIGYVRQPKQAIPKTSQILRLEDELFTVPETFFHPEISNILKP 300
           RKEETRVEYILPDFQTSLIGYVRQPKQAIPKTSQILRLEDELFTVPETFFHPEISNILKP
Sbjct: 241 RKEETRVEYILPDFQTSLIGYVRQPKQAIPKTSQILRLEDELFTVPETFFHPEISNILKP 300

Query: 301 GLVETILECVSMVPEVLRPLLVSNIVAVGGNFNIANFATRLATELQRQCPTDWKVRVHQP 360
           GLVETILECVSMVPEVLRPLLVSNIVAVGGNFNIANFATRLATELQRQCPTDWKVRVHQP
Sbjct: 301 GLVETILECVSMVPEVLRPLLVSNIVAVGGNFNIANFATRLATELQRQCPTDWKVRVHQP 360

Query: 361 KLDAALQGWKSMRQFSQTDSYKNSRVTRSEYLEHGADWCTKHRFGYEQWI 410
           KLDAALQGWKSMRQFSQTDSYKNSRVTRSEYLEHGADWCTKHRFGYEQWI
Sbjct: 361 KLDAALQGWKSMRQFSQTDSYKNSRVTRSEYLEHGADWCTKHRFGYEQWI 410

>Ecym_4312 Chr4 (671413..672648) [1236 bp, 411 aa] {ON} similar to
           Ashbya gossypii AGR091W
          Length = 411

 Score =  713 bits (1841), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 323/411 (78%), Positives = 369/411 (89%), Gaps = 1/411 (0%)

Query: 1   MRVPLLMENGSYEIKFGPANLETPYRARNCLTRDRYGRYHLSNQMDQIRDISHCHIRRPS 60
           M VP++++NGSYEIKFGP++L++PYRA NCL RD+YGRYHLSNQM QIR++S+CH+RRP 
Sbjct: 1   MGVPIIIDNGSYEIKFGPSSLKSPYRALNCLARDKYGRYHLSNQMKQIREVSNCHVRRPF 60

Query: 61  ELGQLISWELEEQIWDYCLFNPDEFGWELKDSKDVDLIASETCMTIPEISKNMDQVVFEE 120
           ELGQL+SWELEE IWDYCLFN DEF W+LKDSKDVDLI SETCM+IPEISK+MDQVVFEE
Sbjct: 61  ELGQLVSWELEEHIWDYCLFNSDEFSWDLKDSKDVDLIVSETCMSIPEISKHMDQVVFEE 120

Query: 121 YEFGSMMKCPVAQFVPFDRARDYDIVGGAG-EVVEAKSGYNNFQLVVDSGFNCTWVMPVI 179
           YEFGS+MKCPVAQ++PFD   DY + G  G  VV  K  YN+FQLVVDSGFNCTWV+PVI
Sbjct: 121 YEFGSLMKCPVAQYIPFDNMADYKVYGSDGLPVVRKKDDYNDFQLVVDSGFNCTWVIPVI 180

Query: 180 KGVPYYKATKKLDIGGRFLNGLLKETISFRHYNVMDETILINNIKEQCCFMPPVSYFDSF 239
           KGVPYYKA KKLDIGGRFL GLLKET+SFRHYN+MDETIL NNIKEQCCFMPPVSYFDSF
Sbjct: 181 KGVPYYKAVKKLDIGGRFLTGLLKETVSFRHYNLMDETILANNIKEQCCFMPPVSYFDSF 240

Query: 240 QRKEETRVEYILPDFQTSLIGYVRQPKQAIPKTSQILRLEDELFTVPETFFHPEISNILK 299
           Q+K ETR++Y+LPDFQTSLIGYVRQPKQAIP+ SQ L LEDELFT+PETFFHPEI+NILK
Sbjct: 241 QKKAETRIDYVLPDFQTSLIGYVRQPKQAIPEDSQTLNLEDELFTIPETFFHPEIANILK 300

Query: 300 PGLVETILECVSMVPEVLRPLLVSNIVAVGGNFNIANFATRLATELQRQCPTDWKVRVHQ 359
           PGL+ET+LE +SM+PE++RPL+VSNI  +GGNFNI+NFA+RLATELQRQCPTDW VRVH 
Sbjct: 301 PGLIETVLESISMLPELIRPLMVSNIAVIGGNFNISNFASRLATELQRQCPTDWSVRVHL 360

Query: 360 PKLDAALQGWKSMRQFSQTDSYKNSRVTRSEYLEHGADWCTKHRFGYEQWI 410
           PK D  LQGWK+M +FS TDSYK  RVTR+EYLEHG DWCTK+RFGYEQWI
Sbjct: 361 PKGDTELQGWKAMMRFSNTDSYKQGRVTRAEYLEHGVDWCTKYRFGYEQWI 411

>SAKL0H17138g Chr8 (1515123..1516382) [1260 bp, 419 aa] {ON} highly
           similar to uniprot|Q74ZV8 Ashbya gossypii AGR091W ARP6
           Actin-like protein ARP6 and similar to uniprot|Q12509
           Saccharomyces cerevisiae YLR085C ARP6 Nuclear actin-
           related protein involved in chromatin remodeling
           component of chromatin-remodeling enzyme complexes
          Length = 419

 Score =  587 bits (1514), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 271/416 (65%), Positives = 333/416 (80%), Gaps = 8/416 (1%)

Query: 3   VPLLMENGSYEIKFGPANLETPYRARNCLTRDRYGRYHLSNQMDQIRDISHCHIRRPSEL 62
            P++++NGSYE+KFGPA   TP+RA N L RD+YG  HLSNQ+ +++DIS+   RRP EL
Sbjct: 4   TPIIIDNGSYEVKFGPATNSTPFRALNALARDKYGNPHLSNQVSRLKDISNVQFRRPHEL 63

Query: 63  GQLISWELEEQIWDYCLFNPDEFGWELKDSKDVDLIASETCMTIPEISKNMDQVVFEEYE 122
           GQL SWEL+  IWDYCL+NPDEF WE+ ++K   L+ SE CM++PE+SK  DQVVFEEYE
Sbjct: 64  GQLTSWELQSCIWDYCLYNPDEFNWEIGNTKGKHLVLSEMCMSMPELSKGTDQVVFEEYE 123

Query: 123 FGSMMKCPVAQFVPFD-RARDYDIVGGAGEVVEAKSG------YNNFQLVVDSGFNCTWV 175
           FGS  K PVA FVPF+ +A +++++    + V  K        YN+FQLV+DSGFNCTWV
Sbjct: 124 FGSCFKGPVAGFVPFNWQALEHNMIYAKEDSVYRKDSTGERNEYNDFQLVIDSGFNCTWV 183

Query: 176 MPVIKGVPYYKATKKLDIGGRFLNGLLKETISFRHYNVMDETILINNIKEQCCFMPPVSY 235
           +P++KG+PYYKA KKLDIGGRFLNG LKET+SFRHYNVMDETIL+NNIKE+C FM PVSY
Sbjct: 184 VPIVKGIPYYKAIKKLDIGGRFLNGFLKETLSFRHYNVMDETILVNNIKEKCLFMSPVSY 243

Query: 236 FDSFQRKEETRVEYILPDFQTSLIGYVRQPKQAIPKTSQILRLEDELFTVPETFFHPEIS 295
           F+SFQ+KE+T  EY+LPDFQTS  GYV+Q KQ IP+ SQ ++L DELF++PETFFHPEI+
Sbjct: 244 FNSFQKKEDTTAEYVLPDFQTSFQGYVKQQKQKIPEDSQTIKLYDELFSIPETFFHPEIA 303

Query: 296 NILKPGLVETILECVSMVPEVLRPLLVSNIVAVGGNFNIANFATRLATELQRQCPTDWKV 355
           ++LKPG+VETILE +SM+PE +RPL+VSN V  GGNFNI NFA RLATELQRQCPTDW V
Sbjct: 304 SLLKPGIVETILESISMLPEAIRPLMVSNTVVTGGNFNIRNFARRLATELQRQCPTDWDV 363

Query: 356 RVHQPKL-DAALQGWKSMRQFSQTDSYKNSRVTRSEYLEHGADWCTKHRFGYEQWI 410
            V  P   D AL GW SMRQFSQT +Y+ +RVTR EY EHG DWCTK RFGY++W+
Sbjct: 364 CVSVPNASDTALFGWDSMRQFSQTTAYQQTRVTREEYYEHGVDWCTKQRFGYQKWL 419

>ZYRO0C01738g Chr3 (135066..136310) [1245 bp, 414 aa] {ON} similar
           to uniprot|Q12509 Saccharomyces cerevisiae YLR085C ARP6
           Nuclear actin-related protein involved in chromatin
           remodeling component of chromatin-remodeling enzyme
           complexes
          Length = 414

 Score =  575 bits (1481), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 268/411 (65%), Positives = 320/411 (77%), Gaps = 5/411 (1%)

Query: 4   PLLMENGSYEIKFGPANLETPYRARNCLTRDRYGRYHLSNQMDQIRDISHCHIRRPSELG 63
           P++++NGSYEIKFG  +LETP+RA N L RD++G Y+LSNQ+  I+DIS    RRP E G
Sbjct: 5   PIVVDNGSYEIKFGTPDLETPHRAFNALARDKFGSYYLSNQIKTIKDISSVVFRRPHEFG 64

Query: 64  QLISWELEEQIWDYCLFNPDEF-GWELKDSKDVDLIASETCMTIPEISKNMDQVVFEEYE 122
           QL SWELE  IWDYC FNPDEF G++LKDSK   L+ SETCMTIPE+SKNMDQVVFEEYE
Sbjct: 65  QLTSWELESAIWDYCFFNPDEFNGFDLKDSKGQHLVVSETCMTIPELSKNMDQVVFEEYE 124

Query: 123 FGSMMKCPVAQFVPFDRARDYDIVGGAGEVVEAKS---GYNNFQLVVDSGFNCTWVMPVI 179
           F SM K P+A F PF R     I G   +    K+    Y  FQLV+D GFNCTWV+PVI
Sbjct: 125 FASMFKSPIAGFAPFGRP-SIAISGKGDDQPNRKAEPDAYEPFQLVIDVGFNCTWVVPVI 183

Query: 180 KGVPYYKATKKLDIGGRFLNGLLKETISFRHYNVMDETILINNIKEQCCFMPPVSYFDSF 239
           KG+PYYKA KKLDIGGRFLNGLLKET+SFRHYNVMDETIL+NNIKE C F+ PVSYF+SF
Sbjct: 184 KGIPYYKAVKKLDIGGRFLNGLLKETLSFRHYNVMDETILVNNIKENCLFVSPVSYFESF 243

Query: 240 QRKEETRVEYILPDFQTSLIGYVRQPKQAIPKTSQILRLEDELFTVPETFFHPEISNILK 299
           + KE+T VEY+LPDFQTS +GYV+ PK+ +P+ SQ + L+DELF+VPETFFHPEI  +LK
Sbjct: 244 KHKEQTAVEYVLPDFQTSFLGYVKDPKKPLPQDSQTVELKDELFSVPETFFHPEIPQLLK 303

Query: 300 PGLVETILECVSMVPEVLRPLLVSNIVAVGGNFNIANFATRLATELQRQCPTDWKVRVHQ 359
           PG++ETILE +S++PE LRPL++ NIV  GGNFN+ NFATRLATELQRQ PTDW   VH 
Sbjct: 304 PGIIETILESLSILPEQLRPLMLGNIVCTGGNFNLPNFATRLATELQRQLPTDWTCTVHL 363

Query: 360 PKLDAALQGWKSMRQFSQTDSYKNSRVTRSEYLEHGADWCTKHRFGYEQWI 410
           P     L GW SM  F+ +  Y ++RVTR EY EHG DWCT+HRFGY+ W+
Sbjct: 364 PSGPKELYGWSSMASFTNSPLYSDARVTREEYFEHGVDWCTRHRFGYQNWM 414

>KLLA0F19063g Chr6 complement(1756529..1757776) [1248 bp, 415 aa]
           {ON} similar to uniprot|Q12509 Saccharomyces cerevisiae
           YLR085C ARP6 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin-remodeling
           enzyme complexes
          Length = 415

 Score =  572 bits (1474), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 264/411 (64%), Positives = 327/411 (79%), Gaps = 6/411 (1%)

Query: 5   LLMENGSYEIKFGPANLETPYRARNCLTRDRYGRYHLSNQMDQIRDISHCHIRRPSELGQ 64
           L+++NGSYEIKFG +  + P RA NCLT+D+Y R+HLSNQ  ++RDIS   IRRP ELGQ
Sbjct: 6   LVIDNGSYEIKFGESGWDQPLRALNCLTKDKYSRFHLSNQTKKMRDISQALIRRPHELGQ 65

Query: 65  LISWELEEQIWDYCLFNPDEFGWEL---KDSKDVDLIASETCMTIPEISKNMDQVVFEEY 121
           L+SWELE ++WDYC +N D+F W L    D+KD  L+ SET MTIPE+SKNMDQV+FEEY
Sbjct: 66  LVSWELESEVWDYCFYNEDDFHWNLTHDNDTKDHHLVVSETLMTIPELSKNMDQVIFEEY 125

Query: 122 EFGSMMKCPVAQFVPFDRARDYDIVGGAGEVVEAKSGYNNFQLVVDSGFNCTWVMPVIKG 181
           +F SM K PVAQ++PF + +  D    A E  +  S Y +FQLV+DSGFNCTW +P+IKG
Sbjct: 126 DFKSMFKGPVAQYIPFYQGQYQDDAMTAAED-KKTSSYKDFQLVIDSGFNCTWAVPIIKG 184

Query: 182 VPYYKATKKLDIGGRFLNGLLKETISFRHYNVMDETILINNIKEQCCFMPPVSYFDSFQR 241
           VPYYKA KKLDIGGRFL GLL+ETISFRHYNVM+ETIL+NNIKEQC F+PP SYF SF  
Sbjct: 185 VPYYKAIKKLDIGGRFLTGLLQETISFRHYNVMEETILVNNIKEQCTFVPPESYFSSFHN 244

Query: 242 KEETRVEYILPDFQTSLIGYVRQP-KQAIPKTSQILRLEDELFTVPETFFHPEISNILKP 300
           K  T+VEY+LPDFQTS +GYV++P K+ +   +Q L L DE+F+VPETFFHPEI+ ILKP
Sbjct: 245 KMNTKVEYVLPDFQTSFLGYVKKPGKEKLTDDAQTLLLTDEVFSVPETFFHPEIAQILKP 304

Query: 301 GLVETILECVSMVPEVLRPLLVSNIVAVGGNFNIANFATRLATELQRQCPTDWKVRVHQP 360
           G+VETILEC++M PEV+RPLLV+NIV  GGNFNI NF  RL TELQRQCP DW  +VH P
Sbjct: 305 GIVETILECINMCPEVVRPLLVANIVCTGGNFNIPNFHERLQTELQRQCPIDWSCKVHSP 364

Query: 361 K-LDAALQGWKSMRQFSQTDSYKNSRVTRSEYLEHGADWCTKHRFGYEQWI 410
           +  D +L GW+SM+ F+ +D ++++RVTR EYLEHG DWCTK+RFGY+QW+
Sbjct: 365 QEKDKSLHGWESMKDFANSDQFRSARVTREEYLEHGLDWCTKNRFGYQQWL 415

>KLTH0G13772g Chr7 (1188875..1190137) [1263 bp, 420 aa] {ON} similar
           to uniprot|Q12509 Saccharomyces cerevisiae YLR085C ARP6
           Nuclear actin-related protein involved in chromatin
           remodeling component of chromatin-remodeling enzyme
           complexes
          Length = 420

 Score =  565 bits (1456), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 260/417 (62%), Positives = 320/417 (76%), Gaps = 9/417 (2%)

Query: 3   VPLLMENGSYEIKFGPANLETPYRARNCLTRDRYGRYHLSNQMDQIRDISHCHIRRPSEL 62
            P++++NGSYEIKFG A+   P+ A N + +D+YG YHLSNQ+  I+DIS     RP +L
Sbjct: 4   APIVIDNGSYEIKFGTASSNEPFTALNSIAKDKYGNYHLSNQVRSIKDISSVTFNRPHKL 63

Query: 63  GQLISWELEEQIWDYCLFNPDEF-GWELKDSKDVDLIASETCMTIPEISKNMDQVVFEEY 121
           GQL+SWELE QIWDYCLFNPDEF GW L  +K+  LIASE+CMT+PE+SKNMDQVVFEEY
Sbjct: 64  GQLVSWELESQIWDYCLFNPDEFDGWSLDTTKNKHLIASESCMTLPELSKNMDQVVFEEY 123

Query: 122 EFGSMMKCPVAQFVPFDRARDYDIVGGAGEVVEAKSG--------YNNFQLVVDSGFNCT 173
           E+ S+ K PV  FVPF+   D   +  A E  +  +         Y +++LV+DSGFNCT
Sbjct: 124 EYDSLFKAPVPVFVPFNAEGDTTHILVAKEDADVVASDHPSDNKDYRDYELVIDSGFNCT 183

Query: 174 WVMPVIKGVPYYKATKKLDIGGRFLNGLLKETISFRHYNVMDETILINNIKEQCCFMPPV 233
           WV+PVIKGVPYYKA KKLDIGGRFLNG L+E +SFRHYNVMDETIL+N+IKE+C FM P 
Sbjct: 184 WVVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHYNVMDETILVNSIKEKCLFMSPN 243

Query: 234 SYFDSFQRKEETRVEYILPDFQTSLIGYVRQPKQAIPKTSQILRLEDELFTVPETFFHPE 293
           SYFDSFQ + +T  EY+LPDF TS  GY+R+P Q +P+ SQ + L+DELF VPETFFHPE
Sbjct: 244 SYFDSFQSRLKTAKEYVLPDFSTSFQGYLRKPGQTLPEDSQTIILQDELFAVPETFFHPE 303

Query: 294 ISNILKPGLVETILECVSMVPEVLRPLLVSNIVAVGGNFNIANFATRLATELQRQCPTDW 353
           I+++L PG++E ILE +SM+PE LRPLLV N+V  GGNFNI NFA+RLATELQRQCPTDW
Sbjct: 304 IASLLNPGIIEAILESISMLPEALRPLLVGNVVVTGGNFNIPNFASRLATELQRQCPTDW 363

Query: 354 KVRVHQPKLDAALQGWKSMRQFSQTDSYKNSRVTRSEYLEHGADWCTKHRFGYEQWI 410
             RV  P  DA L GWK M++FS+T +Y+ SRV+R EY EHG DWCT  RFGY+ W+
Sbjct: 364 SCRVSVPTGDARLYGWKCMQKFSETQAYRESRVSREEYYEHGVDWCTSKRFGYQAWL 420

>KAFR0B02700 Chr2 complement(543626..544888) [1263 bp, 420 aa] {ON}
           Anc_8.258 YLR085C
          Length = 420

 Score =  563 bits (1451), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 264/417 (63%), Positives = 326/417 (78%), Gaps = 9/417 (2%)

Query: 3   VPLLMENGSYEIKFGPANLETPYRARNCLTRDRYGRYHLSNQMDQIRDISHCHIRRPSEL 62
            P++++NGSY +KFGPA+LE PY A N +  D+Y   +LSNQ+  I+DIS   I+RP  L
Sbjct: 4   TPVVIDNGSYRVKFGPASLEAPYCALNAIANDKYDASYLSNQIKSIKDISSVSIKRPHTL 63

Query: 63  GQLISWELEEQIWDYCLFNPDEF-GWELKDSKDVDLIASETCMTIPEISKNMDQVVFEEY 121
           GQL SWE++  IWDYCL+NPDEF G+ + D+K   LI SETCMT+PE+ KNMDQV+FEEY
Sbjct: 64  GQLTSWEMQTLIWDYCLYNPDEFNGFNIGDTKSKHLITSETCMTLPELGKNMDQVIFEEY 123

Query: 122 EFGSMMKCPVAQFVPFDRARDYDIVGGAGEV---VEAKSG--YNNFQLVVDSGFNCTWVM 176
           EFGS+MK PVA ++PF R     I+ G  +    VE  S   Y +FQLVVDSGFNCTW++
Sbjct: 124 EFGSLMKSPVAGYMPFLRNTKDQIIIGERDTEPFVETPSTEEYRDFQLVVDSGFNCTWII 183

Query: 177 PVIKGVPYYKATKKLDIGGRFLNGLLKETISFRHYNVMDETILINNIKEQCCFMPPVSYF 236
           PVIKG+PYYKA KKLDIGGRFLNGLLKET+SFRHYNVMDETIL+NNIKE+C F+ P SYF
Sbjct: 184 PVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHYNVMDETILVNNIKEKCLFVSPASYF 243

Query: 237 DSFQRKEETRVEYILPDFQTSLIGYVR---QPKQAIPKTSQILRLEDELFTVPETFFHPE 293
           DSF+ K+ T  EY+LPDFQTS +GYVR   +  + +P+ SQ + L+DELF VPETFFHPE
Sbjct: 244 DSFKNKDITSREYVLPDFQTSFLGYVRPSNEQGKPLPEDSQSITLKDELFAVPETFFHPE 303

Query: 294 ISNILKPGLVETILECVSMVPEVLRPLLVSNIVAVGGNFNIANFATRLATELQRQCPTDW 353
           IS ILKPGLVETILE +SM+PEV+RPL+VSNI+ +GGNFN+ +FA+R+A ELQRQ PTDW
Sbjct: 304 ISQILKPGLVETILESLSMIPEVIRPLMVSNIMCIGGNFNLPHFASRVAKELQRQLPTDW 363

Query: 354 KVRVHQPKLDAALQGWKSMRQFSQTDSYKNSRVTRSEYLEHGADWCTKHRFGYEQWI 410
           K R+   K ++ L GWK+M  F+ TD YK +RVTR EY EHG DWCTKHRFGY+ W+
Sbjct: 364 KCRITISKGNSELSGWKAMSSFASTDIYKATRVTREEYYEHGIDWCTKHRFGYQNWV 420

>Kwal_56.23832 s56 (726199..727458) [1260 bp, 419 aa] {ON} YLR085C
           (ARP6) - Actin-related protein [contig 172] FULL
          Length = 419

 Score =  563 bits (1450), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 262/415 (63%), Positives = 317/415 (76%), Gaps = 8/415 (1%)

Query: 4   PLLMENGSYEIKFGPANLETPYRARNCLTRDRYGRYHLSNQMDQIRDISHCHIRRPSELG 63
           PL+++NGSYEIKFG  + + P+RA N + +D+YG YHLSNQ+  I+DIS     RP ELG
Sbjct: 5   PLIIDNGSYEIKFGSGSEKEPHRALNSIAKDKYGNYHLSNQVRSIKDISSVVFNRPHELG 64

Query: 64  QLISWELEEQIWDYCLFNPDEF-GWELKDSKDVDLIASETCMTIPEISKNMDQVVFEEYE 122
           QL+SWELE QIWDYCLFNPD+F GW +  +K   LI SE+CMTIPE+SKNMDQVVFEEYE
Sbjct: 65  QLVSWELETQIWDYCLFNPDDFNGWSIDTTKGKHLITSESCMTIPELSKNMDQVVFEEYE 124

Query: 123 FGSMMKCPVAQFVPFDRARDYDIVGGAGEVVEA-------KSGYNNFQLVVDSGFNCTWV 175
           F +M K PV  FVPF+  +    +  A E  E           YN+FQLV+DSGFNC+W+
Sbjct: 125 FETMFKAPVPVFVPFNTGKKSTHMLVAKEDSEVEESEVAPAKNYNDFQLVIDSGFNCSWI 184

Query: 176 MPVIKGVPYYKATKKLDIGGRFLNGLLKETISFRHYNVMDETILINNIKEQCCFMPPVSY 235
           +PVIKGVPYYKA KKLDIGGRFLNG L+E +SFRHYNVMDETIL+N+IKE C FM P +Y
Sbjct: 185 VPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHYNVMDETILVNSIKENCLFMSPNAY 244

Query: 236 FDSFQRKEETRVEYILPDFQTSLIGYVRQPKQAIPKTSQILRLEDELFTVPETFFHPEIS 295
           F+SFQ + +T  EY+LPDF TS  GY+R+P Q +P  SQ + L+DELF VPETFFHPEI+
Sbjct: 245 FESFQSRSKTAKEYVLPDFNTSFQGYLRKPGQVLPAESQTIVLQDELFAVPETFFHPEIA 304

Query: 296 NILKPGLVETILECVSMVPEVLRPLLVSNIVAVGGNFNIANFATRLATELQRQCPTDWKV 355
           ++L  G+VETILE +SM+PE +RPL+V NIV  GGNFNI NFA+RLATELQRQCPTDW  
Sbjct: 305 SLLNSGIVETILESISMLPEAIRPLMVGNIVITGGNFNIPNFASRLATELQRQCPTDWSC 364

Query: 356 RVHQPKLDAALQGWKSMRQFSQTDSYKNSRVTRSEYLEHGADWCTKHRFGYEQWI 410
           RV  PK DA L GWK M++FS+T+ Y  SRVTR EY EHG DWCT  RFGY+ W+
Sbjct: 365 RVSLPKGDAGLYGWKCMQKFSETEDYHESRVTRQEYYEHGVDWCTAKRFGYQAWL 419

>YLR085C Chr12 complement(300673..301989) [1317 bp, 438 aa] {ON}
           ARP6Actin-related protein that binds nucleosomes; a
           component of the SWR1 complex, which exchanges histone
           variant H2AZ (Htz1p) for chromatin-bound histone H2A
          Length = 438

 Score =  556 bits (1432), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 262/434 (60%), Positives = 327/434 (75%), Gaps = 27/434 (6%)

Query: 4   PLLMENGSYEIKFGPANLETPYRARNCLTRDRYGRYHLSNQMDQIRDISHCHIRRPSELG 63
           P++++NGSYEIKFGP+  + P+RA N L +D++G  +LSN +  I+DIS    RRP ELG
Sbjct: 5   PIVIDNGSYEIKFGPSTNKKPFRALNALAKDKFGTSYLSNHIKNIKDISSITFRRPHELG 64

Query: 64  QLISWELEEQIWDYCLFNPDEF-GWELKDSKDVDLIASETCMTIPEISKNMDQVVFEEYE 122
           QL  WELE  IWDYCLFNP EF G++LK+ K   L+ASE+CMT+PE+SK+ DQV+FEEYE
Sbjct: 65  QLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLPELSKHADQVIFEEYE 124

Query: 123 FGSMMKCPVAQFVPFDRA------------RDYDIVGGA-----------GEVVEAKSGY 159
           F S+ K PVA FVPF ++             D DIV G                ++ S Y
Sbjct: 125 FDSLFKSPVAVFVPFTKSYKGEMRTISGKDEDIDIVRGNSDSTNSTSSESKNAQDSGSDY 184

Query: 160 NNFQLVVDSGFNCTWVMPVIKGVPYYKATKKLDIGGRFLNGLLKETISFRHYNVMDETIL 219
           ++FQLV+DSGFNCTW++PV+KG+PYYKA KKLDIGGRFL GLLKET+SFRHYN+MDETIL
Sbjct: 185 HDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHYNMMDETIL 244

Query: 220 INNIKEQCCFMPPVSYFDSFQRKEETRVEYILPDFQTSLIGYVRQPKQ---AIPKTSQIL 276
           +NNIKEQC F+ PVSYFDSF+ K++  +EY+LPDFQTS +GYVR P++    +P+ +QI+
Sbjct: 245 VNNIKEQCLFVSPVSYFDSFKTKDKHALEYVLPDFQTSFLGYVRNPRKENVPLPEDAQII 304

Query: 277 RLEDELFTVPETFFHPEISNILKPGLVETILECVSMVPEVLRPLLVSNIVAVGGNFNIAN 336
            L DELFT+PETFFHPEIS I KPG+VE ILE +SM+PE++RPL+V NIV  GGNFN+ N
Sbjct: 305 TLTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVRPLMVGNIVCTGGNFNLPN 364

Query: 337 FATRLATELQRQCPTDWKVRVHQPKLDAALQGWKSMRQFSQTDSYKNSRVTRSEYLEHGA 396
           FA RLA ELQRQ PTDW   V  P+ D AL GW+ M QF++TDSY+ +RVTR EY EHG 
Sbjct: 365 FAQRLAAELQRQLPTDWTCHVSVPEGDCALFGWEVMSQFAKTDSYRKARVTREEYYEHGP 424

Query: 397 DWCTKHRFGYEQWI 410
           DWCTKHRFGY+ WI
Sbjct: 425 DWCTKHRFGYQNWI 438

>NCAS0B04990 Chr2 complement(916170..917432) [1263 bp, 420 aa] {ON}
           Anc_8.258 YLR085C
          Length = 420

 Score =  551 bits (1421), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 259/416 (62%), Positives = 318/416 (76%), Gaps = 9/416 (2%)

Query: 4   PLLMENGSYEIKFGPANLETPYRARNCLTRDRYGRYHLSNQMDQIRDISHCHIRRPSELG 63
           P+ ++NGSYEIKFG  +L +PYRA N    D+Y   +LSNQ+  I+DI+    RRP ELG
Sbjct: 5   PIAIDNGSYEIKFGTTDLSSPYRAINAFAIDKYHTTYLSNQIKNIKDITSVTFRRPHELG 64

Query: 64  QLISWELEEQIWDYCLFNPDEF-GWELKDSKDVDLIASETCMTIPEISKNMDQVVFEEYE 122
           QL SWELE  IWDY LFNPDEF G++L D K   LIASETCMT+PE+SKNMDQVVFEEYE
Sbjct: 65  QLTSWELESSIWDYALFNPDEFPGFDLNDLKGKHLIASETCMTLPELSKNMDQVVFEEYE 124

Query: 123 FGSMMKCPVAQFVPFDRARDYDIVGGAGE-------VVEAKSG-YNNFQLVVDSGFNCTW 174
           F S  K  +A F+ F   ++  I+ G  E       V + +   YN++QLV+DSGFNCTW
Sbjct: 125 FDSYYKSSIAGFIQFADDKNTKIISGKTEEDISLDSVNQVREKEYNDYQLVIDSGFNCTW 184

Query: 175 VMPVIKGVPYYKATKKLDIGGRFLNGLLKETISFRHYNVMDETILINNIKEQCCFMPPVS 234
           ++PVIKGVPYYKA KKLDIGGRFL+GLLKET+SFRHY+VMDETIL+NNIKE C F+ P S
Sbjct: 185 IIPVIKGVPYYKAVKKLDIGGRFLDGLLKETLSFRHYDVMDETILVNNIKENCLFVSPTS 244

Query: 235 YFDSFQRKEETRVEYILPDFQTSLIGYVRQPKQAIPKTSQILRLEDELFTVPETFFHPEI 294
           YFDSF+ K ET VEY+LP+FQT+ +G+VR   + +P+ +Q ++L DELF+VPETFFHPEI
Sbjct: 245 YFDSFKNKNETAVEYVLPNFQTTFLGHVRDKTKPLPENTQTIKLYDELFSVPETFFHPEI 304

Query: 295 SNILKPGLVETILECVSMVPEVLRPLLVSNIVAVGGNFNIANFATRLATELQRQCPTDWK 354
           + ILKPGLVETILE +SMVPE+LRPLLV N+V  GGNFN+ +FATRL +ELQRQ PTDW 
Sbjct: 305 ARILKPGLVETILESLSMVPELLRPLLVGNLVCTGGNFNLPHFATRLTSELQRQLPTDWI 364

Query: 355 VRVHQPKLDAALQGWKSMRQFSQTDSYKNSRVTRSEYLEHGADWCTKHRFGYEQWI 410
            R   P  +  L GWK+M QF+ T+SY+ +RVTR EY EHG DW TK+RFGY+ WI
Sbjct: 365 CRTSVPTKECELFGWKAMAQFASTESYRKTRVTREEYYEHGTDWLTKNRFGYQNWI 420

>TDEL0F03850 Chr6 complement(707880..709139) [1260 bp, 419 aa] {ON}
           Anc_8.258 YLR085C
          Length = 419

 Score =  548 bits (1412), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 252/415 (60%), Positives = 322/415 (77%), Gaps = 8/415 (1%)

Query: 4   PLLMENGSYEIKFGPANLETPYRARNCLTRDRYGRYHLSNQMDQIRDISHCHIRRPSELG 63
           PL+++NGSYE+KFG +    P+RA N L RD++G  +LSNQ++QI+DIS    +RP E G
Sbjct: 5   PLVVDNGSYEVKFGYSTTSQPFRALNALARDKFGATYLSNQINQIKDISSVSFKRPHEYG 64

Query: 64  QLISWELEEQIWDYCLFNPDEF-GWELKDSKDVDLIASETCMTIPEISKNMDQVVFEEYE 122
           QL SWEL+  +WDYC FNP+EF G++LKDSK   LIASETCMT+PE+SKNMDQVVFEEYE
Sbjct: 65  QLTSWELQSCVWDYCFFNPNEFDGFDLKDSKGQHLIASETCMTLPELSKNMDQVVFEEYE 124

Query: 123 FGSMMKCPVAQFVPFDR-ARDYDIVGGAGEVVEAKS-----GYNNFQLVVDSGFNCTWVM 176
           F S++K P++ F+PF +   +  ++ G G+     S      Y  FQ+V+DSGFNCTWV+
Sbjct: 125 FDSLLKAPISGFMPFSKHTENTKVISGKGDSESGTSTSETKDYEPFQMVIDSGFNCTWVV 184

Query: 177 PVIKGVPYYKATKKLDIGGRFLNGLLKETISFRHYNVMDETILINNIKEQCCFMPPVSYF 236
           P+IKGVP+YKA KKLD+GGRF+NGLLKET+SFRHYNVMDETIL+NNIKE+C FM PVSYF
Sbjct: 185 PIIKGVPFYKAVKKLDLGGRFINGLLKETLSFRHYNVMDETILVNNIKEKCLFMSPVSYF 244

Query: 237 DSFQRKEETRVEYILPDFQTSLIGYVRQPKQAIPKTSQILRLEDELFTVPETFFHPEISN 296
           DSF +K++T VEY+LPDFQT+ +GYV   K    K +Q + L DELF+VPETFFHPEI+ 
Sbjct: 245 DSFAKKDQTAVEYVLPDFQTTFLGYVADRKNPPSKDAQTVTLRDELFSVPETFFHPEIAQ 304

Query: 297 ILKPGLVETILECVSMVPEVLRPLLVSNIVAVGGNFNIANFATRLATELQRQCPTDWKVR 356
           +LKPG++ETILE +S+VPE LRPL+VSNI+  GGNFN+ +F  RLATELQRQ PTDW  +
Sbjct: 305 LLKPGIIETILESLSLVPEPLRPLMVSNILCTGGNFNLPHFPERLATELQRQLPTDWSAK 364

Query: 357 VHQPKLDAA-LQGWKSMRQFSQTDSYKNSRVTRSEYLEHGADWCTKHRFGYEQWI 410
           ++ P+  +  L GW SM  F+ TD YK +RV+R EY EHG +W TK+RFGY+ WI
Sbjct: 365 IYLPQPKSCELAGWCSMSAFASTDLYKAARVSRQEYYEHGVEWTTKNRFGYQNWI 419

>Skud_12.153 Chr12 complement(284046..285362) [1317 bp, 438 aa] {ON}
           YLR085C (REAL)
          Length = 438

 Score =  546 bits (1407), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 256/436 (58%), Positives = 322/436 (73%), Gaps = 27/436 (6%)

Query: 2   RVPLLMENGSYEIKFGPANLETPYRARNCLTRDRYGRYHLSNQMDQIRDISHCHIRRPSE 61
           R P++++NGSYEIKF P+  E P+RA N L +D++G  +LSN +  I+DIS    RRP E
Sbjct: 3   RSPIVIDNGSYEIKFAPSTNEMPFRALNALAKDKFGTSYLSNHIKNIKDISSITFRRPHE 62

Query: 62  LGQLISWELEEQIWDYCLFNPDEF-GWELKDSKDVDLIASETCMTIPEISKNMDQVVFEE 120
           LGQL  WELE  IWDYC FNP EF G++LK+ K   L+ASE+CMT+PE+SK+ DQV+FEE
Sbjct: 63  LGQLTLWELESCIWDYCFFNPSEFRGFDLKEGKGHHLVASESCMTLPELSKHADQVIFEE 122

Query: 121 YEFGSMMKCPVAQFVPFDRA------------RDYDIVGG-----------AGEVVEAKS 157
           YEF S+ K PVA FVPF ++             + D+V              G    + S
Sbjct: 123 YEFDSLFKSPVAVFVPFTKSYKGKLKTISGKDEEADVVTSNSGITTFTSRECGSAQNSDS 182

Query: 158 GYNNFQLVVDSGFNCTWVMPVIKGVPYYKATKKLDIGGRFLNGLLKETISFRHYNVMDET 217
            Y++FQLV+DSGFNCTW++PV+KG+PYYKA KKLDIGGRFL GLLKET+SFRHYN+MDET
Sbjct: 183 DYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHYNMMDET 242

Query: 218 ILINNIKEQCCFMPPVSYFDSFQRKEETRVEYILPDFQTSLIGYVRQPKQ---AIPKTSQ 274
           IL+NN+KE+C F+ PVSYFDSF+ K++  +EY+LPDFQTS IGYVR P++    +P+ +Q
Sbjct: 243 ILVNNVKEKCLFVSPVSYFDSFKAKDKHALEYVLPDFQTSFIGYVRNPREENSPLPEDAQ 302

Query: 275 ILRLEDELFTVPETFFHPEISNILKPGLVETILECVSMVPEVLRPLLVSNIVAVGGNFNI 334
            + L DELFT+PETFFHPEIS I KPG+VE ILE +SM+PE++RPL+V NIV  GGNFN+
Sbjct: 303 TIALTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVRPLMVGNIVCTGGNFNL 362

Query: 335 ANFATRLATELQRQCPTDWKVRVHQPKLDAALQGWKSMRQFSQTDSYKNSRVTRSEYLEH 394
            NFA RLA ELQRQ PTDW   V  P  D AL GW+ M QF++T+SY+ +RVTR EY EH
Sbjct: 363 PNFAQRLAAELQRQLPTDWTCHVSVPIGDCALFGWEVMSQFAKTESYRRARVTRDEYYEH 422

Query: 395 GADWCTKHRFGYEQWI 410
           G DWCTK RFGY+ WI
Sbjct: 423 GPDWCTKQRFGYQNWI 438

>Smik_12.144 Chr12 complement(280513..281829) [1317 bp, 438 aa] {ON}
           YLR085C (REAL)
          Length = 438

 Score =  545 bits (1405), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 256/435 (58%), Positives = 321/435 (73%), Gaps = 27/435 (6%)

Query: 3   VPLLMENGSYEIKFGPANLETPYRARNCLTRDRYGRYHLSNQMDQIRDISHCHIRRPSEL 62
            P++++NGSYEIKFGP+  E P+RA N L +D++G  +LSN +  I+DIS    RRP EL
Sbjct: 4   APIVIDNGSYEIKFGPSTNEKPFRALNALAKDKFGTSYLSNHIKNIKDISSVTFRRPHEL 63

Query: 63  GQLISWELEEQIWDYCLFNPDEF-GWELKDSKDVDLIASETCMTIPEISKNMDQVVFEEY 121
           GQL  WELE  IWDYC FNP EF G++LK+ K   L+ASE+CMT+PE+SK+ DQV+FEEY
Sbjct: 64  GQLTLWELESCIWDYCFFNPIEFDGFDLKEGKGHHLVASESCMTLPELSKHADQVIFEEY 123

Query: 122 EFGSMMKCPVAQFVPFDRA------------RDYDIVGGAGEVVEAKSG----------- 158
           EF S+ K PVA FVPF ++             D DIV       +  S            
Sbjct: 124 EFDSLFKSPVAAFVPFTKSYKSKMKAISGKDEDADIVVSKSNEADMPSNNPRDTQKFDSD 183

Query: 159 YNNFQLVVDSGFNCTWVMPVIKGVPYYKATKKLDIGGRFLNGLLKETISFRHYNVMDETI 218
           Y++FQLV+DSGFNCTW++PV+KG+PYYKA KKLD+GGRFL GLLKET+SFRHYN+MDETI
Sbjct: 184 YHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDVGGRFLTGLLKETLSFRHYNMMDETI 243

Query: 219 LINNIKEQCCFMPPVSYFDSFQRKEETRVEYILPDFQTSLIGYVRQPKQ---AIPKTSQI 275
           L+NNIKE+C F+ PVSYFDSF+ K++  +EY+LPDFQTS +GYVR  ++    + + +Q 
Sbjct: 244 LVNNIKEKCLFVSPVSYFDSFKVKDKHALEYVLPDFQTSFLGYVRNRRKENSPLAEDAQT 303

Query: 276 LRLEDELFTVPETFFHPEISNILKPGLVETILECVSMVPEVLRPLLVSNIVAVGGNFNIA 335
           + L DELFT+PETFFHPEI+ I KPG+VE ILE +SM+PE++RPL+V NIV  GGNFN+ 
Sbjct: 304 ITLTDELFTIPETFFHPEIAQITKPGIVEAILESLSMLPEIVRPLMVGNIVCTGGNFNLP 363

Query: 336 NFATRLATELQRQCPTDWKVRVHQPKLDAALQGWKSMRQFSQTDSYKNSRVTRSEYLEHG 395
           NFA RLA ELQRQ PTDW   V  P+ D AL GW+ M QFS T SY+N+RVTR EY EHG
Sbjct: 364 NFAQRLAAELQRQLPTDWTCHVSVPESDCALFGWEVMSQFSSTASYRNARVTREEYYEHG 423

Query: 396 ADWCTKHRFGYEQWI 410
           +DWCTKHRFGY+ WI
Sbjct: 424 SDWCTKHRFGYQNWI 438

>Kpol_543.36 s543 complement(80922..82205) [1284 bp, 427 aa] {ON}
           complement(80922..82205) [1284 nt, 428 aa]
          Length = 427

 Score =  545 bits (1403), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 255/423 (60%), Positives = 325/423 (76%), Gaps = 16/423 (3%)

Query: 4   PLLMENGSYEIKFGPANLETPYRARNCLTRDRYGRYHLSNQMDQIRDISHCHIRRPSELG 63
           P++++NGSYE+KFG ++ + P RA N L +D+YG ++LSNQM+ I+DIS   IRRP ELG
Sbjct: 5   PIVIDNGSYEVKFGYSDAKVPNRALNALAKDKYGAWYLSNQMNNIKDISSVTIRRPHELG 64

Query: 64  QLISWELEEQIWDYCLFNPDEF-GWELKDSKDVDLIASETCMTIPEISKNMDQVVFEEYE 122
           QL+SWELE  +WDYC FNPDEF  + LK++K   L+ SETCMT+PE+S NMDQV+FEEYE
Sbjct: 65  QLVSWELEGTVWDYCFFNPDEFPNFNLKETKGHHLVVSETCMTLPELSANMDQVMFEEYE 124

Query: 123 FGSMMKCPVAQFVPFDRARD-YDIVGGAGEVV-----------EAKSGYNNFQLVVDSGF 170
           F S+ K PVA FVPF   +D   ++ G G+ V             K+ Y++F LV+DSGF
Sbjct: 125 FESLFKSPVAGFVPFLNLQDNMKMICGKGDDVMGDLISNMDSQNIKNPYSDFNLVIDSGF 184

Query: 171 NCTWVMPVIKGVPYYKATKKLDIGGRFLNGLLKETISFRHYNVMDETILINNIKEQCCFM 230
           NCTW++P+IKGVPYYKA KK+++GGRFLNGL KETIS+RHY+V DETIL+NNIKE+C FM
Sbjct: 185 NCTWIIPIIKGVPYYKAVKKMEMGGRFLNGLFKETISYRHYDVTDETILVNNIKEKCLFM 244

Query: 231 PPVSYFDSFQRKEETRVEYILPDFQTSLIGYVRQPK--QAIPKTSQILRLEDELFTVPET 288
            P SY DSF+ K+   V+Y+LPDFQTS IGYV+  K    +P+ SQ++ L DELF+VPET
Sbjct: 245 SPTSYMDSFKNKDRYSVDYVLPDFQTSFIGYVKDKKSNSQLPENSQVITLTDELFSVPET 304

Query: 289 FFHPEISNILKPGLVETILECVSMVPEVLRPLLVSNIVAVGGNFNIANFATRLATELQRQ 348
            FHPE++ +LKPG+VETILE +S+VPE +RPLLV+NIV VGGNFN+ NF +RLATELQRQ
Sbjct: 305 IFHPEMAKLLKPGIVETILESLSIVPETIRPLLVNNIVCVGGNFNMPNFGSRLATELQRQ 364

Query: 349 CPTDWKVRVHQPKLDAALQGWKSMRQFSQ-TDSYKNSRVTRSEYLEHGADWCTKHRFGYE 407
            PTDW   ++ P+ D  LQGWKSM QF+Q TD YK +R++R EY EHG DW TK RFGY+
Sbjct: 365 LPTDWVCNIYIPEKDCELQGWKSMSQFAQNTDIYKKARISREEYYEHGTDWTTKKRFGYQ 424

Query: 408 QWI 410
            WI
Sbjct: 425 NWI 427

>NDAI0B01960 Chr2 complement(477552..478871) [1320 bp, 439 aa] {ON}
           Anc_8.258 YLR085C
          Length = 439

 Score =  544 bits (1401), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 257/436 (58%), Positives = 324/436 (74%), Gaps = 28/436 (6%)

Query: 3   VPLLMENGSYEIKFGPANLETPYRARNCLTRDRYGRYHLSNQMDQIRDISHCHIRRPSEL 62
            PL+++NGSYEIKFG +N E PYRA N    D+YG  +LSNQM +I+++S   +RRP EL
Sbjct: 4   TPLVLDNGSYEIKFGLSNSERPYRALNGFAVDKYGSAYLSNQMKKIQEVSEVTLRRPHEL 63

Query: 63  GQLISWELEEQIWDYCLFNPDEF-GWELKDSKDVDLIASETCMTIPEISKNMDQVVFEEY 121
           GQL SWELE  IWDYCL+NPDEF G+EL  S    LI SE CMT+PE+SKNMDQV+FEEY
Sbjct: 64  GQLTSWELESCIWDYCLYNPDEFDGFELGGSGKKHLIVSEPCMTLPELSKNMDQVIFEEY 123

Query: 122 EFGSMMKCPVAQFVPFD---------------RARDYDIVGGAGEVV-----------EA 155
           EF S+ K P A ++PF                +  D D++G +  V            + 
Sbjct: 124 EFDSLFKAPTAGYIPFGVQADDRKVLLDTISGKKNDDDMIGQSENVTISTDNLKDDKKKF 183

Query: 156 KSGYNNFQLVVDSGFNCTWVMPVIKGVPYYKATKKLDIGGRFLNGLLKETISFRHYNVMD 215
            + Y +++LV+DSGFNCTW++P+IKGVPYYKA KKLDIGGRFL GLLKET+SFRHY++MD
Sbjct: 184 SNDYQDYELVIDSGFNCTWIIPMIKGVPYYKAIKKLDIGGRFLTGLLKETLSFRHYDLMD 243

Query: 216 ETILINNIKEQCCFMPPVSYFDSFQRKEETRVEYILPDFQTSLIGYVRQPK-QAIPKTSQ 274
           ET+L+NNIKE+C F+ P SYFDSF+ KEET VEYILPD  +S +GY R+ K + +P+ SQ
Sbjct: 244 ETLLVNNIKEKCLFVSPTSYFDSFKAKEETSVEYILPDISSSYLGYTRENKSKPLPEGSQ 303

Query: 275 ILRLEDELFTVPETFFHPEISNILKPGLVETILECVSMVPEVLRPLLVSNIVAVGGNFNI 334
           +++L DELF+VPETFFHPEIS ILKPG+VETILE +SM+PE+LRPLLV+NIV  GGNFN+
Sbjct: 304 VVKLYDELFSVPETFFHPEISRILKPGIVETILESLSMIPEILRPLLVANIVCTGGNFNL 363

Query: 335 ANFATRLATELQRQCPTDWKVRVHQPKLDAALQGWKSMRQFSQTDSYKNSRVTRSEYLEH 394
            +FA RLA ELQRQ PTDW  R+  PK +  L  WKSM QF+ TDSYK +R+++ EY EH
Sbjct: 364 PHFAARLAAELQRQLPTDWTCRISVPKKECELFSWKSMCQFANTDSYKKTRISKEEYYEH 423

Query: 395 GADWCTKHRFGYEQWI 410
           G DW TKH+FGY+ W+
Sbjct: 424 GPDWLTKHKFGYQNWL 439

>KNAG0G02010 Chr7 complement(447621..448895) [1275 bp, 424 aa] {ON}
           Anc_8.258 YLR085C
          Length = 424

 Score =  539 bits (1388), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 261/423 (61%), Positives = 319/423 (75%), Gaps = 15/423 (3%)

Query: 3   VPLLMENGSYEIKFGPANLETPYRARNCLTRDRYGRYHLSNQMDQIRDISHCHIRRPSEL 62
           VP +++NGSYEIKFG ANL TP+RA N + +D+YG  +LSN M  IRDIS   IRRP EL
Sbjct: 2   VPFVIDNGSYEIKFGHANLVTPFRANNGIAKDKYGASYLSNHMKTIRDISSATIRRPHEL 61

Query: 63  GQLISWELEEQIWDYCLFNPDEF-GWELKD-SKDVDLIASETCMTIPEISKNMDQVVFEE 120
           GQL+SWELE  IWDYCL+NPDEF G+ L D +++ DLI +ETC T+PE+SKN DQVVFEE
Sbjct: 62  GQLVSWELEGCIWDYCLYNPDEFDGFHLGDNTREQDLILTETCFTLPELSKNSDQVVFEE 121

Query: 121 YEFGSMMKCPVAQFVPFDRA---RDYDIVGGAGEVVEA------KSGYNNFQLVVDSGFN 171
           YEF +M K P + F+PF      ++ + + G    V           Y +FQLV+DSGFN
Sbjct: 122 YEFATMFKSPASGFMPFANLIGNKNMEHLCGKDTAVNTDYTTATTKEYRDFQLVIDSGFN 181

Query: 172 CTWVMPVIKGVPYYKATKKLDIGGRFLNGLLKETISFRHYNVMDETILINNIKEQCCFMP 231
           CTWV+P+IKGVP+YKA KK+DIGGRFLNGLLKET+SFRHYN+MDETIL+NNIKE+C F+ 
Sbjct: 182 CTWVVPIIKGVPFYKAIKKMDIGGRFLNGLLKETLSFRHYNMMDETILLNNIKEKCLFVS 241

Query: 232 PVSYFDSFQRKEETRVEYILPDFQTSLIGYV--RQPKQAIPKTS-QILRLEDELFTVPET 288
           PVSYFDSF+ K++  VEY+LPDFQTS +GY+     ++ I + S Q + L DE F VPET
Sbjct: 242 PVSYFDSFKTKQQQAVEYVLPDFQTSFLGYLVDESNRKGIDRGSVQTITLTDERFAVPET 301

Query: 289 FFHPEISNILKPGLVETILECVSMVPEVLRPLLVSNIVAVGGNFNIANFATRLATELQRQ 348
           FFHPE++NILKPGLVETILE +SMVPE LRP+LVSNIV VGGNF + + ++RL +ELQRQ
Sbjct: 302 FFHPEMANILKPGLVETILEAISMVPEPLRPILVSNIVCVGGNFKLPHMSSRLTSELQRQ 361

Query: 349 CPTDWKVRVHQP-KLDAALQGWKSMRQFSQTDSYKNSRVTRSEYLEHGADWCTKHRFGYE 407
            PTDW  RV  P   D  L  W +M QFS TD YK +RVTR EYLEHG DWC+KHRF Y+
Sbjct: 362 LPTDWTCRVTVPSSSDCELAAWNAMAQFSSTDVYKTTRVTREEYLEHGTDWCSKHRFTYQ 421

Query: 408 QWI 410
            WI
Sbjct: 422 NWI 424

>Suva_10.169 Chr10 complement(305734..307050) [1317 bp, 438 aa] {ON}
           YLR085C (REAL)
          Length = 438

 Score =  539 bits (1388), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 255/434 (58%), Positives = 321/434 (73%), Gaps = 27/434 (6%)

Query: 4   PLLMENGSYEIKFGPANLETPYRARNCLTRDRYGRYHLSNQMDQIRDISHCHIRRPSELG 63
           P++++NGSYEIKFGP+  + P+RA N L +D++G  +LSN +  I+DIS    RRP ELG
Sbjct: 5   PIVIDNGSYEIKFGPSTNKMPFRALNALAKDKFGTSYLSNHIKNIKDISSVTFRRPHELG 64

Query: 64  QLISWELEEQIWDYCLFNPDEF-GWELKDSKDVDLIASETCMTIPEISKNMDQVVFEEYE 122
           QL  WELE  IWDYCLFNP EF G++LK+ K   L+ASE+CMT+PE+SK+ DQV+FEEYE
Sbjct: 65  QLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLPELSKHADQVIFEEYE 124

Query: 123 FGSMMKCPVAQFVPFDRA------------RDYDIVGGAGE---------VVEAKSG--Y 159
           F S+ K PVA FVPF ++             D D+     +         V E  S   Y
Sbjct: 125 FDSLFKSPVAVFVPFTKSYKGKMRTISGKDEDADVAISDSDDKTFTSKEPVDETNSNNDY 184

Query: 160 NNFQLVVDSGFNCTWVMPVIKGVPYYKATKKLDIGGRFLNGLLKETISFRHYNVMDETIL 219
           ++FQLV+DSGF+CTW++PV+KG+PYYKA KKLDIGGRFL GLLKET+SFRHYN+MDETIL
Sbjct: 185 HDFQLVIDSGFDCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHYNMMDETIL 244

Query: 220 INNIKEQCCFMPPVSYFDSFQRKEETRVEYILPDFQTSLIGYVRQPKQ---AIPKTSQIL 276
           +NNIKE+C F+ P SYFDSF+ K +  +EY+LPDFQTS IGYVR P +    +P  +Q +
Sbjct: 245 VNNIKEKCLFVSPTSYFDSFKSKNKHVLEYVLPDFQTSFIGYVRHPNEEDSPLPTDAQSI 304

Query: 277 RLEDELFTVPETFFHPEISNILKPGLVETILECVSMVPEVLRPLLVSNIVAVGGNFNIAN 336
            L DELFT+PETFFHPEIS I+KPG+VE ILE +SM+PE++RPL++ NIV  GGNFN+ N
Sbjct: 305 TLTDELFTIPETFFHPEISQIIKPGIVEAILESLSMLPEIVRPLMIGNIVCTGGNFNLPN 364

Query: 337 FATRLATELQRQCPTDWKVRVHQPKLDAALQGWKSMRQFSQTDSYKNSRVTRSEYLEHGA 396
           FA RLA ELQRQ PTDW   V  P+ D  L GW+ M QF++T+SY+ +RVTR EY EHG 
Sbjct: 365 FAQRLARELQRQLPTDWTCNVSVPEGDCTLFGWEVMSQFAKTESYQRARVTREEYYEHGP 424

Query: 397 DWCTKHRFGYEQWI 410
           DWCTKHRFGY+ WI
Sbjct: 425 DWCTKHRFGYQNWI 438

>TBLA0H01460 Chr8 complement(323962..325290) [1329 bp, 442 aa] {ON}
           Anc_8.258 YLR085C
          Length = 442

 Score =  535 bits (1378), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 242/439 (55%), Positives = 323/439 (73%), Gaps = 31/439 (7%)

Query: 3   VPLLMENGSYEIKFGPANLETPYRARNCLTRDRYGRYHLSNQMDQIRDISHCHIRRPSEL 62
           +P++++NGSYEIKFG +N   P+RA N + +D+Y   +LSNQ+  I+DIS  + RRP EL
Sbjct: 4   LPIVIDNGSYEIKFGVSNSRIPFRAINAIAKDKYNTVYLSNQIKGIKDISSVNFRRPYEL 63

Query: 63  GQLISWELEEQIWDYCLFNPDEF-GWELKDSKDVDLIASETCMTIPEISKNMDQVVFEEY 121
           GQL SWELE  IWDYC +NP+EF G++L+D+    L+ SETC+++PE S+N+D ++FEEY
Sbjct: 64  GQLTSWELESAIWDYCFYNPEEFDGFQLEDTSKKHLVISETCLSLPEFSRNIDHIIFEEY 123

Query: 122 EFGSMMKCPVAQFVPF-DRARDYDIVGGAGEV---------------------------- 152
            +GS+ K PVA F+PF D  +D   + G  +                             
Sbjct: 124 NYGSIYKSPVAGFIPFADLTKDVISISGKADDDDDDNNAKFQEQLVTNDLNTYISSEEPS 183

Query: 153 VEAKSGYNNFQLVVDSGFNCTWVMPVIKGVPYYKATKKLDIGGRFLNGLLKETISFRHYN 212
           V   + Y +FQL++DSGFNCTW++PVIKG+PYYKA KK+DIGGRFL GLLKET+SFRHYN
Sbjct: 184 VTKTAEYKDFQLIIDSGFNCTWIIPVIKGIPYYKAIKKMDIGGRFLTGLLKETLSFRHYN 243

Query: 213 VMDETILINNIKEQCCFMPPVSYFDSFQRKEETRVEYILPDFQTSLIGYVR-QPKQAIPK 271
           V DETIL+NNIKE+C F+ P SY +SF+ K +T VEY+LPDF T+ +GY++   K  +P 
Sbjct: 244 VTDETILVNNIKEKCLFVAPKSYAESFKLKNKTAVEYVLPDFHTTFMGYIKDNSKTKLPD 303

Query: 272 TSQILRLEDELFTVPETFFHPEISNILKPGLVETILECVSMVPEVLRPLLVSNIVAVGGN 331
            +Q++ L+DELF+V ET FHPEIS ILKPG++ETI+E +SM+PEV+RPL+V+NIV +GGN
Sbjct: 304 NAQLITLKDELFSVTETIFHPEISRILKPGIIETIIESLSMLPEVIRPLMVNNIVCIGGN 363

Query: 332 FNIANFATRLATELQRQCPTDWKVRVHQPKLDAALQGWKSMRQFSQTDSYKNSRVTRSEY 391
           FN+ NF+ RL +ELQRQ PTDW   V+ PK+DA L GWK+M QFS TDSY+ +R+TR EY
Sbjct: 364 FNLPNFSKRLTSELQRQLPTDWTTHVYIPKIDAELFGWKAMAQFSDTDSYRKARITREEY 423

Query: 392 LEHGADWCTKHRFGYEQWI 410
           +EHG +WCTKHRFGY+ WI
Sbjct: 424 MEHGVEWCTKHRFGYQNWI 442

>CAGL0L12166g Chr12 complement(1308681..1309946) [1266 bp, 421 aa]
           {ON} similar to uniprot|Q12509 Saccharomyces cerevisiae
           YLR085c Actin-related protein
          Length = 421

 Score =  525 bits (1353), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 239/415 (57%), Positives = 308/415 (74%), Gaps = 9/415 (2%)

Query: 5   LLMENGSYEIKFGPANLETPYRARNCLTRDRYGRYHLSNQMDQIRDISHCHIRRPSELGQ 64
           ++++NGSY++KFG A+   P  A N L +D+YG  HLSNQ+  I+DIS    RRP ELGQ
Sbjct: 7   IVIDNGSYQVKFGLASEVRPRVALNALAKDKYGVTHLSNQVQNIKDISSVVFRRPHELGQ 66

Query: 65  LISWELEEQIWDYCLFNPDEFGWELKDSKDVDLIASETCMTIPEISKNMDQVVFEEYEFG 124
           L SWELE  IWDYCL+NPDEFG + +  ++  ++ SETCMT+PE+SKN DQV+FEEYE  
Sbjct: 67  LTSWELESCIWDYCLYNPDEFGIDWQSLENRHVVLSETCMTLPELSKNTDQVLFEEYEVD 126

Query: 125 SMMKCPVAQFVPF-DRARDYDIVGGAG--------EVVEAKSGYNNFQLVVDSGFNCTWV 175
           S+ K P A ++PF     +   + G          E +EA   YN+F LV+DSGFNCTWV
Sbjct: 127 SLYKAPTAAYIPFYTTNENIKTISGKSDHGELDIEEKIEAGKEYNDFSLVIDSGFNCTWV 186

Query: 176 MPVIKGVPYYKATKKLDIGGRFLNGLLKETISFRHYNVMDETILINNIKEQCCFMPPVSY 235
           +P++KGVPYYKA KKLD+GGRFLNGLLKETISFRHYNVMDE+IL+NNIKEQC ++ PVSY
Sbjct: 187 IPIVKGVPYYKAVKKLDVGGRFLNGLLKETISFRHYNVMDESILVNNIKEQCLYVDPVSY 246

Query: 236 FDSFQRKEETRVEYILPDFQTSLIGYVRQPKQAIPKTSQILRLEDELFTVPETFFHPEIS 295
           F++F+ K + +++++LPDFQTS  GYVR PK A+P  +QIL L DE F+VPE FFHPEIS
Sbjct: 247 FEAFKAKGKNKIDFVLPDFQTSFQGYVRDPKTALPDNAQILTLTDERFSVPEAFFHPEIS 306

Query: 296 NILKPGLVETILECVSMVPEVLRPLLVSNIVAVGGNFNIANFATRLATELQRQCPTDWKV 355
             LKPG++ET+LE + M+PE+LRPL+ SNIV +GGNFN+  F  RL +ELQRQ PTDW  
Sbjct: 307 QSLKPGIIETVLESIYMLPELLRPLMASNIVCMGGNFNLPGFTDRLVSELQRQLPTDWVC 366

Query: 356 RVHQPKLDAALQGWKSMRQFSQTDSYKNSRVTRSEYLEHGADWCTKHRFGYEQWI 410
           R      D +L GW +M +F+ TD+YK +RVT+ +Y EHG DW TK RFGY+ W+
Sbjct: 367 RAKISSGDKSLTGWTAMAKFAHTDAYKKARVTKEDYFEHGLDWTTKERFGYQNWV 421

>TPHA0A01830 Chr1 (369897..371162) [1266 bp, 421 aa] {ON} Anc_8.258
           YLR085C
          Length = 421

 Score =  508 bits (1309), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 234/419 (55%), Positives = 317/419 (75%), Gaps = 10/419 (2%)

Query: 2   RVPLLMENGSYEIKFGPANLETPYRARNCLTRDRYGRYHLSNQMDQIRDISHCHIRRPSE 61
             PLL++NGSYEIKFG +N ETP+ A N L +D+Y  Y+LSNQ++ I+DIS   I+RP +
Sbjct: 3   EAPLLIDNGSYEIKFGYSNQETPFVALNALAKDKYETYYLSNQINNIKDISSVSIKRPHQ 62

Query: 62  LGQLISWELEEQIWDYCLFNPDEF-GWELKDSKDVDLIASETCMTIPEISKNMDQVVFEE 120
           LGQL+SWELE +IWDYC +N D+F G+E+ +  +  L+ +ET MT+PE+S+N DQVVFEE
Sbjct: 63  LGQLVSWELEHEIWDYCFYNGDDFKGFEVNEDSENHLVLTETPMTLPELSRNTDQVVFEE 122

Query: 121 YEFGSMMKCPVAQFVPFDRARDYDIVGGAGEVVEAKSG-----YNNFQLVVDSGFNCTWV 175
           Y F S+ K P A F+PF +  D   +  +G+      G     Y +F LV+DSG+NC+W+
Sbjct: 123 YGFDSLYKAPAANFIPFIKNDDNSFIRLSGKSKTYLDGSKENNYQDFNLVIDSGYNCSWI 182

Query: 176 MPVIKGVPYYKATKKLDIGGRFLNGLLKETISFRHYNVMDETILINNIKEQCCFMPPVSY 235
           +P+IKGVPYYKA KK+D+GGRFLNGLLKETIS+RHY+V DE++L+NNIKE C F+ PVSY
Sbjct: 183 IPMIKGVPYYKAVKKMDMGGRFLNGLLKETISYRHYDVTDESMLVNNIKENCMFISPVSY 242

Query: 236 FDSFQRKEETRVEYILPDFQTSLIGYVRQPKQ--AIPKTSQILRLEDELFTVPETFFHPE 293
            +SF++K  T+VEY+LPDFQTS +GYVR  K+   +P+ SQ + LEDELF+VPE FFHPE
Sbjct: 243 IESFKKKALTKVEYVLPDFQTSFMGYVRDMKKHSTLPEHSQSIILEDELFSVPEGFFHPE 302

Query: 294 ISNILKPGLVETILECVSMVPEVLRPLLVSNIVAVGGNFNIANFATRLATELQRQCPTDW 353
           ++N+LKPG++ETILE + ++PE LR L+V+NIV  GGNFNI NF +R+ TELQ+Q  T+W
Sbjct: 303 MANVLKPGIIETILESLFILPESLRSLMVNNIVCTGGNFNIPNFGSRIYTELQKQVQTEW 362

Query: 354 KVRVHQPKLDAALQGWKSMRQFSQTDS--YKNSRVTRSEYLEHGADWCTKHRFGYEQWI 410
              V  PK +A LQ WK+M+ F++ +   YK++RVT+ EY EHG +W TK RFGY+ W+
Sbjct: 363 VCDVSIPKANAELQNWKAMKSFTENNEELYKHTRVTKQEYNEHGFEWTTKQRFGYQNWL 421

>KLLA0E22925g Chr5 complement(2040279..2041421) [1143 bp, 380 aa]
           {ON} similar to uniprot|P38696 Saccharomyces cerevisiae
           YHR129C ARP1 Actin-related protein of the dynactin
           complex required for spindle orientation and nuclear
           migration putative ortholog of mammalian centractin
          Length = 380

 Score = 96.7 bits (239), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 101/414 (24%), Positives = 169/414 (40%), Gaps = 59/414 (14%)

Query: 4   PLLMENGSYEIKFGPANLETPYRARNCL------TRDRYGRYH----LSNQMDQIRDISH 53
           P++++NGS  IK G    + P    + L      ++   GR+     + NQ  +IR +  
Sbjct: 12  PIVLDNGSGLIKAGFGGEDKPKCYEHSLVGIPKYSKVMAGRFDGNTFVGNQAQEIRGL-- 69

Query: 54  CHIRRPSELGQLISWELEEQIWDYCLFNPDEFGWELKDSKDVDLIASETCMTIPEISKNM 113
             +R P E G +  W   EQ+W +      E G +L   +D  ++ +E  +   +  + M
Sbjct: 70  LKLRHPLEHGVVTDWNALEQLWGHVF----EKGLQLSSLQDHPVLVTEAPLNPKKNREQM 125

Query: 114 DQVVFEEYEFGSMMKCPVAQFVPFDRARDYDIVGGAGEVVEAKSGYNNFQLVVDSGFNCT 173
            +++FE +   ++     A    +   R                       V+DSG  C+
Sbjct: 126 CELLFETFSVPAVYVSIQAVLSLYASGRTTGC-------------------VLDSGDGCS 166

Query: 174 WVMPVIKGVPYYKATKKLDIGGRFLNGLLKETISFRHYNVM---DETILINNIKEQCCFM 230
             +PV  G     A +++DI GR ++ LL+  I       +    E  ++  IKE+ C++
Sbjct: 167 HAVPVYDGYTLPSAIRRIDIAGRDISELLQVLIRKSTGVSLLSSSEREIVRIIKEKACYI 226

Query: 231 PPVSYFDSFQRKEETRVEYILPDFQTSLIGYVRQPKQAIPKTSQILRLEDELFTVPETFF 290
                  +   KEE +  Y +   QT            +P   QI  L++E F  PE  F
Sbjct: 227 -------ALDPKEEEK-NYTMHGKQTMF---------RLPDGKQI-ELDNEKFRAPEILF 268

Query: 291 HPEISNILKPGLVETILECVSMVPEVLRPLLVSNIVAVGGNFNIANFATRLATELQRQCP 350
           +P++       L E + E +  V   LR  L SNIV  GG   I  F  R+  EL+  C 
Sbjct: 269 NPQLIGSEFQSLPEILYESIQKVDLDLRTSLFSNIVFSGGTTMIPGFGDRVLKELKLSCE 328

Query: 351 TDWKVRVHQPKLDAALQGWKSMRQFSQTDSYKNSRVTRSEYLEHGADWCTKHRF 404
              K+++  P  +     W      S   ++K   VT+ E+ E+    C   RF
Sbjct: 329 PQTKIKIFAPP-ERKYSTWIGGSILSGLSTFKKIWVTKKEWEEN--PRCVHARF 379

>NDAI0G02900 Chr7 (671423..671444,671694..672847) [1176 bp, 391 aa]
           {ON} Anc_3.161 YDL029W
          Length = 391

 Score = 90.9 bits (224), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 93/369 (25%), Positives = 153/369 (41%), Gaps = 61/369 (16%)

Query: 4   PLLMENGSYEIKFGPANLETP-YRARNCLTRDRYGRYHLSNQMDQIRDI----------S 52
           P++++ G+  +K G A    P Y   + + R        +N    +RDI          S
Sbjct: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANITTPLRDIMIGDEASDVRS 65

Query: 53  HCHIRRPSELGQLISWELEEQIWDYCLFNPDEFGWELKDSKDVDLIASETCMTIPEISKN 112
           +  I  P E G + +W   E +WDY  FN      +L ++    ++ +E  M   +  + 
Sbjct: 66  YLQISYPMENGIIKNWTDMELLWDYAFFNQ----MKLNNTSGGKILLTEPPMNPLKNREK 121

Query: 113 MDQVVFEEYEFGSMMKCPVAQFVPFDRARDYDIVGGAGEVVEAKSGYNNFQLVVDSGFNC 172
           M +V+FE+Y+FG +     A    + +                 SG     +VVDSG   
Sbjct: 122 MCEVMFEKYDFGGVYVAIQAVLALYAQG--------------LSSG-----VVVDSGDGV 162

Query: 173 TWVMPVIKGVPYYKATKKLDIGGRFLNGLLKETISFRHY--NVMDETILINNIKEQCCFM 230
           T ++PV + V     T++LD+ GR +   L + +S R Y  N   +   +  IKE+ C++
Sbjct: 163 THIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYV 222

Query: 231 PPVSYFDS-FQRKEETRVE-YILPDFQTSLIGYVRQPKQAIPKTSQILRLEDELFTVPET 288
                 D+   R+  T VE Y LPD +T  +G                    E F  PE 
Sbjct: 223 SYDLDLDTKLARETTTLVESYELPDGRTIKVG-------------------QERFEAPEC 263

Query: 289 FFHPEISNILKPGLVETILECVSMVPEVLRPLLVSNIVAVGGNFNIANFATRLATELQRQ 348
            F P + ++ +PG+ E +   +      +R  L   IV  GG+       +RL  EL++ 
Sbjct: 264 LFQPGLVDVEQPGVGELLFNTIQSADVDVRSALYKAIVLSGGSSMYPGLPSRLEKELKQL 323

Query: 349 CPTDWKVRV 357
               W  RV
Sbjct: 324 ----WYTRV 328

>NCAS0C03550 Chr3 (709102..709123,709273..710429) [1179 bp, 392 aa]
           {ON} Anc_3.161
          Length = 392

 Score = 90.5 bits (223), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 96/383 (25%), Positives = 158/383 (41%), Gaps = 68/383 (17%)

Query: 4   PLLMENGSYEIKFGPANLETP-YRARNCLTRDRYGRYHLSNQMDQIRDI----------S 52
           P++++ G+  +K G A    P Y   + + R        +N    ++DI          S
Sbjct: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANITTPLKDIMIGDEASEVRS 65

Query: 53  HCHIRRPSELGQLISWELEEQIWDYCLFNPDEFGWELKDSKDVDLIASETCMTIPEISKN 112
           +  I  P E G + +W   E +WDY  F       +L  + +  ++ +E  M   +  + 
Sbjct: 66  YLQISYPMENGIIKNWTDMELLWDYAFFEQ----MKLPTTSNGKILLTEPPMNPTKNREK 121

Query: 113 MDQVVFEEYEFGSMMKCPVAQFVPFDRARDYDIVGGAGEVVEAKSGYNNFQLVVDSGFNC 172
           M +V+FE+Y+FG +     A    + +                 SG     +VVDSG   
Sbjct: 122 MCEVMFEKYDFGGVYVAIQAVLALYAQG--------------LSSG-----VVVDSGDGV 162

Query: 173 TWVMPVIKGVPYYKATKKLDIGGRFLNGLLKETISFRHY--NVMDETILINNIKEQCCFM 230
           T ++PV + V     T++LD+ GR +   L + +S R Y  N   +   +  IKE+ C++
Sbjct: 163 THIVPVYESVVLGHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYV 222

Query: 231 PPVSYFDS-FQRKEETRVE-YILPDFQTSLIGYVRQPKQAIPKTSQILRLEDELFTVPET 288
                 D+   R+  T VE Y LPD +T  +G                    E F  PE 
Sbjct: 223 SYDLDLDTKLARETTTLVESYELPDGRTIKVG-------------------QERFEAPEC 263

Query: 289 FFHPEISNILKPGLVETILECVSMVPEVLRPLLVSNIVAVGGNFNIANFATRLATELQ-- 346
            F P + ++ +PG+ E + + V      +R  L   IV  GG+       +RL  EL+  
Sbjct: 264 LFQPGLVDVEQPGMGELLFDTVQSADVDVRSALYKAIVLSGGSSMYPGLPSRLEKELKQL 323

Query: 347 ------RQCPT---DWKVRVHQP 360
                 R  PT    +KVR+  P
Sbjct: 324 WFTRVLRNDPTRLDKFKVRIEDP 346

>Ecym_6385 Chr6 complement(749508..750641) [1134 bp, 377 aa] {ON}
           similar to Ashbya gossypii AFR051W
          Length = 377

 Score = 89.7 bits (221), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 95/416 (22%), Positives = 164/416 (39%), Gaps = 63/416 (15%)

Query: 4   PLLMENGSYEIKFGPANLETP----------YRARNCLTRDRYGRYHLSNQMDQIRDISH 53
           P++++NGS  IK G +  E P           +    +     G   + NQ  ++R +  
Sbjct: 9   PIVLDNGSGIIKAGFSGEEKPKCFEYSLIGTVKYNKVMAGGLEGDTFIGNQAQELRGL-- 66

Query: 54  CHIRRPSELGQLISWELEEQIWDYCLFNPDEFGWELKDSKDVDLIASETCMTIPEISKNM 113
             +R P E G + +W   E IW Y +FN      +L++ +D  ++ +E  +      + M
Sbjct: 67  LKLRHPVEHGIVKNWSDMEHIWSY-VFNKS---LQLQNVEDHPILITEAPLNPRNNRERM 122

Query: 114 DQVVFEEYEFGSMMKCPVAQFVPFDRARDYDIVGGAGEVVEAKSGYNNFQLVVDSGFNCT 173
            +++FE +   ++     A    +   R                       VVD G  C 
Sbjct: 123 CELLFESFNVPALYVSIQAVLSLYASGRTTGC-------------------VVDCGDGCC 163

Query: 174 WVMPVIKGVPYYKATKKLDIGGR----FLNGLLKETISFRHYNVMDETILINNIKEQCCF 229
             +PV  G     + +++DI GR    FL  LL++T      +  +  + +  IKE+ C+
Sbjct: 164 HAVPVFDGFSIPSSIRRIDIAGRDITEFLQLLLRKTTGVSLLSSSEREV-VRIIKEKACY 222

Query: 230 MPPVSYFDSFQRK-EETRVEYILPDFQTSLIGYVRQPKQAIPKTSQILRLEDELFTVPET 288
           +    + +           ++ LPD +T                   + L  E F  PE 
Sbjct: 223 VAKDPHIEEQNFSINPNYTKFKLPDGKT-------------------IDLGQEKFRAPEI 263

Query: 289 FFHPEISNILKPGLVETILECVSMVPEVLRPLLVSNIVAVGGNFNIANFATRLATELQRQ 348
            F PE+       L +   + +  V   LR LL SN++  GG   +  F  RL +EL+  
Sbjct: 264 LFQPELIGSEFESLPDMCYQSIEKVDLDLRSLLFSNVLLSGGTSILPGFGDRLLSELKSL 323

Query: 349 CPTDWKVRVHQPKLDAALQGWKSMRQFSQTDSYKNSRVTRSEYLEHGADWCTKHRF 404
             +  K+++  P  +     W      S   ++K   VTR+E+ E  AD C   RF
Sbjct: 324 SDSQTKIKIFAPP-ERKYSTWIGGSILSGLSTFKKLWVTRAEW-EEAAD-CIHSRF 376

>SAKL0E11814g Chr5 complement(984199..985338) [1140 bp, 379 aa] {ON}
           highly similar to gnl|GLV|KLLA0E23012g Kluyveromyces
           lactis KLLA0E23012g and similar to uniprot|P38696
           Saccharomyces cerevisiae YHR129C ARP1 Actin- related
           protein of the dynactin complex required for spindle
           orientation and nuclear migration putative ortholog of
           mammalian centractin
          Length = 379

 Score = 89.0 bits (219), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 93/417 (22%), Positives = 168/417 (40%), Gaps = 65/417 (15%)

Query: 4   PLLMENGSYEIKFGPANLETPY----------RARNCLTRDRYGRYHLSNQMDQIRDISH 53
           P++++NGS  IK G +  E P           +    +     G   + NQ  ++R +  
Sbjct: 11  PIVLDNGSGIIKAGFSGEERPKCFEYSLIGTPKYNKVMAGGLEGEQFIGNQAQELRGL-- 68

Query: 54  CHIRRPSELGQLISWELEEQIWDYCLFNPDEFGWELKDSKDVDLIASETCMTIPEISKNM 113
             +R P E G + +W   E IW++          +L + ++  ++A+E  +   +  + M
Sbjct: 69  LKLRYPLEHGIVKNWSDMELIWNHVFHK----SLQLNNIEEHPVLATEAPLNPLKNREAM 124

Query: 114 DQVVFEEYEFGSMMKCPVAQFVPFDRARDYDIVGGAGEVVEAKSGYNNFQLVVDSGFNCT 173
            +++FE +   ++     A    +   R                       V+D G  C 
Sbjct: 125 CEMLFETFNVPAVYVSIQAVLSLYASGRTTGC-------------------VLDCGDGCC 165

Query: 174 WVMPVIKGVPYYKATKKLDIGGR----FLNGLLKETISFRHYNVMDETILINNIKEQCCF 229
             +PV  G     + +++D+ GR    FL  LL++T      +  +  I +  IKE+ C+
Sbjct: 166 HSVPVFDGFSLPSSIRRIDVAGRDVTEFLQLLLRKTTGVSLLSSSEREI-VRIIKEKACY 224

Query: 230 MP--PVSYFDSFQRKEETRVEYILPDFQTSLIGYVRQPKQAIPKTSQILRLEDELFTVPE 287
           +   P++   ++     + + + LPD                    ++L L++E F  PE
Sbjct: 225 VARDPLTEEQTYHLTPTSTI-FKLPD-------------------GKVLDLKNEKFRAPE 264

Query: 288 TFFHPEISNILKPGLVETILECVSMVPEVLRPLLVSNIVAVGGNFNIANFATRLATELQR 347
             F P++       + E   + +S V   LRP L+SNIV  GG      F  RL TEL+ 
Sbjct: 265 VLFQPQLIGSEFESIPEMCHQSISKVDLDLRPALLSNIVLSGGTTMFPGFGDRLLTELRN 324

Query: 348 QCPTDWKVRVHQPKLDAALQGWKSMRQFSQTDSYKNSRVTRSEYLEHGADWCTKHRF 404
                 K+++  P  +     W      S   ++K   VT+SE+ E+    C   RF
Sbjct: 325 LSEPQTKIKIFAPP-ERKYSTWIGGSILSGLSTFKKIWVTKSEWQENPD--CVHSRF 378

>TBLA0F00870 Chr6 complement(222947..224100,224325..224346) [1176
           bp, 391 aa] {ON} Anc_3.161 YDL029W
          Length = 391

 Score = 87.8 bits (216), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 86/361 (23%), Positives = 149/361 (41%), Gaps = 61/361 (16%)

Query: 4   PLLMENGSYEIKFGPANLETP------YRARNCLTRDRYGRYH-------LSNQMDQIRD 50
           P++++ G+  +K G A    P         R  L  +  G          + ++  ++R 
Sbjct: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERGTISTPLKDIMIGDEASEVR- 64

Query: 51  ISHCHIRRPSELGQLISWELEEQIWDYCLFNPDEFGWELKDSKDVDLIASETCMTIPEIS 110
            S+  I  P E G + +W   E +WDY  FN      +L  +    ++ +E  M   +  
Sbjct: 65  -SYLQISYPMENGIIKNWTDMELLWDYAFFNQ----MKLPTTSGGKVLLTEPPMNPVKNR 119

Query: 111 KNMDQVVFEEYEFGSMMKCPVAQFVPFDRARDYDIVGGAGEVVEAKSGYNNFQLVVDSGF 170
           + M +V+FE Y+FG +     A    + +                 SG     +VVDSG 
Sbjct: 120 ERMCEVMFERYDFGGVYVAIQAVLALYAQG--------------LSSG-----VVVDSGD 160

Query: 171 NCTWVMPVIKGVPYYKATKKLDIGGRFLNGLLKETISFRHY--NVMDETILINNIKEQCC 228
             T ++PV + V     T++LD+ GR +   L + +S R Y  N   +   +  IKE+ C
Sbjct: 161 GVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYSFNRTADFETVRQIKEKVC 220

Query: 229 FMPPVSYFDSFQRKEETRV--EYILPDFQTSLIGYVRQPKQAIPKTSQILRLEDELFTVP 286
           ++      D+   +E T +  EY LPD                    +I+++  E F  P
Sbjct: 221 YVSYDLNLDTKLARETTTLVQEYELPD-------------------GRIIKVGQERFEAP 261

Query: 287 ETFFHPEISNILKPGLVETILECVSMVPEVLRPLLVSNIVAVGGNFNIANFATRLATELQ 346
           E  F P++ ++  PG+ E +   +      +R  L   IV  GG+       +RL  EL+
Sbjct: 262 ECLFQPDLVDVESPGVGELLFNTIQSADIDVRSSLYKAIVLSGGSSMYPGLPSRLERELK 321

Query: 347 R 347
           +
Sbjct: 322 Q 322

>Ecym_1520 Chr1 (1071497..1071506,1072543..1073663) [1131 bp, 376
           aa] {ON} similar to Ashbya gossypii ABR222W  1-intron
          Length = 376

 Score = 85.9 bits (211), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 78/346 (22%), Positives = 137/346 (39%), Gaps = 52/346 (15%)

Query: 56  IRRPSELGQLISWELEEQIWDYCLFNPDEFGWELKDS-KDVDLIASETCMTIPEISKNMD 114
           +R P E G + +W+  E+IW +  +N      EL+ + ++  ++ +E  M      + M 
Sbjct: 68  LRYPIEHGIVTNWDDMEKIWHHTFYN------ELRVAPEEHPVLLTEAPMNPKSNREKMT 121

Query: 115 QVVFEEYEFGSMMKCPVAQFVPFDRARDYDIVGGAGEVVEAKSGYNNFQLVVDSGFNCTW 174
           Q++FE +   +      A    +   R   IV                   +DSG   T 
Sbjct: 122 QIMFETFNVPAFYVSIQAVLSLYSSGRTTGIV-------------------LDSGDGVTH 162

Query: 175 VMPVIKGVPYYKATKKLDIGGRFLNGLLKETISFRHYN--VMDETILINNIKEQCCFMPP 232
           V+P+  G     A  ++D+ GR +   L + +S R Y+     E  ++ +IKE+ C++  
Sbjct: 163 VVPIYAGFSLPHAILRIDLAGRDMTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYVA- 221

Query: 233 VSYFDSFQRKEETRV---EYILPDFQTSLIGYVRQPKQAIPKTSQILRLEDELFTVPETF 289
           + Y    Q   ++      Y LPD Q   IG                   +E F  PE  
Sbjct: 222 LDYDQEMQTAAQSSAIEKSYELPDGQVITIG-------------------NERFRAPEAL 262

Query: 290 FHPEISNILKPGLVETILECVSMVPEVLRPLLVSNIVAVGGNFNIANFATRLATELQRQC 349
           FHP +  +   G+ +T    +      +R  L  NIV  GG       A R+  E+    
Sbjct: 263 FHPSVLGLEAAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMFPGIAERMQKEITALA 322

Query: 350 PTDWKVRVHQPKLDAALQGWKSMRQFSQTDSYKNSRVTRSEYLEHG 395
           P+  KV++  P  +     W      +   +++   +++ EY E G
Sbjct: 323 PSSMKVKIIAPP-ERKYSVWIGGSILASLTTFQQMWISKQEYDESG 367

>KLTH0F06490g Chr6 complement(561947..563100,563192..563213) [1176
           bp, 391 aa] {ON} highly similar to uniprot|P32381
           Saccharomyces cerevisiae YDL029W ARP2 Essential
           component of the Arp2/3 complex which is a highly
           conserved actin nucleation center required for the
           motility and integrity of actin patches involved in
           endocytosis and membrane growth and polarity
          Length = 391

 Score = 85.9 bits (211), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 94/389 (24%), Positives = 161/389 (41%), Gaps = 74/389 (19%)

Query: 1   MRVPLLMENGSYEIKFGPANLETP-YRARNCLTRDRYGRYHLSNQMDQIRDI-------- 51
           +R P++++ G+  +K G A    P Y   + + R        +N +  ++DI        
Sbjct: 3   LRTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANVVTPLKDIMIGDEASA 62

Query: 52  --SHCHIRRPSELGQLISWELEEQIWDYCLFNPDEFGWELKDSKDVDLIASETCMTIPEI 109
             S+  I  P E G + +W   E +WDY  ++      +L  +    ++ +E  M     
Sbjct: 63  VRSYLQISYPMENGVIKNWSDMELLWDYAFYDQ----MKLPSTSGGKVMLTEPPMNPLRN 118

Query: 110 SKNMDQVVFEEYEFGSMMKCPVAQFVPFDRARDYDIVGGAGEVVEAKSGYNNFQLVVDSG 169
            + M +V+FE+Y+FG +     A    + +                 SG     +VVDSG
Sbjct: 119 REQMCEVMFEKYDFGGVYVAIQAVLALYAQG--------------LSSG-----VVVDSG 159

Query: 170 FNCTWVMPVIKGVPYYKATKKLDIGGRFLNGLLKETISFRHY--NVMDETILINNIKEQC 227
              T ++PV + V     T++LD+ GR +   L + +S R Y  N   +   +  IKE+ 
Sbjct: 160 DGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKL 219

Query: 228 CFMPPVSY---FDS-FQRKEETRVE-YILPDFQTSLIGYVRQPKQAIPKTSQILRLEDEL 282
            +   VSY    D+   R+  T VE Y LPD                    +++++  E 
Sbjct: 220 SY---VSYDLDLDTKLARETTTLVENYELPD-------------------GRVIKVGSER 257

Query: 283 FTVPETFFHPEISNILKPGLVETILECVSMVPEVLRPLLVSNIVAVGGNFNIANFATRLA 342
           F  PE  F P + ++ +PG+ E +   +      +R  L   IV  GG+       +RL 
Sbjct: 258 FEAPECLFQPNLVDVEQPGVGEMLFNTIQAADVDVRSALYRAIVLSGGSSMYPGLPSRLE 317

Query: 343 TELQ--------RQCPT---DWKVRVHQP 360
            EL+        R  P+    +KVR+  P
Sbjct: 318 KELKQLWFTRVLRNDPSRLEKFKVRIEDP 346

>NCAS0C03700 Chr3 complement(745133..746250,746901..746910) [1128
           bp, 375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score = 85.9 bits (211), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 90/407 (22%), Positives = 159/407 (39%), Gaps = 64/407 (15%)

Query: 5   LLMENGSYEIKFGPANLETPY----------RARNCLTRDRYGRYHLSNQMDQIRDISHC 54
           L+++NGS   K G A  + P           R +  +        ++ ++    R I   
Sbjct: 8   LVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRGI--L 65

Query: 55  HIRRPSELGQLISWELEEQIWDYCLFNPDEFGWELKDS-KDVDLIASETCMTIPEISKNM 113
            +R P E G + +W+  E+IW +  +N      EL+ + ++  ++ +E  M      + M
Sbjct: 66  TLRYPIEHGIVTNWDDMEKIWHHTFYN------ELRVAPEEHPVLLTEAPMNPKSNREKM 119

Query: 114 DQVVFEEYEFGSMMKCPVAQFVPFDRARDYDIVGGAGEVVEAKSGYNNFQLVVDSGFNCT 173
            Q++FE +   +      A    +   R   IV                   +DSG   T
Sbjct: 120 TQIMFETFNVPAFYVSIQAVLSLYSSGRTTGIV-------------------LDSGDGVT 160

Query: 174 WVMPVIKGVPYYKATKKLDIGGRFLNGLLKETISFRHYN--VMDETILINNIKEQCCFMP 231
            V+P+  G     A  ++D+ GR L   L + +S R Y+     E  ++ +IKE+ C++ 
Sbjct: 161 HVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYVA 220

Query: 232 PVSYFDSFQRKEETRV---EYILPDFQTSLIGYVRQPKQAIPKTSQILRLEDELFTVPET 288
            + +    Q   ++      Y LPD Q   IG                   +E F  PE 
Sbjct: 221 -LDFEQEMQTAAQSSSIEKSYELPDGQVITIG-------------------NERFRAPEA 260

Query: 289 FFHPEISNILKPGLVETILECVSMVPEVLRPLLVSNIVAVGGNFNIANFATRLATELQRQ 348
            FHP I ++   G+ +T    +      +R  L  NIV  GG       A R+  E+   
Sbjct: 261 LFHPSILSLESAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMFPGIAERMQKEITAL 320

Query: 349 CPTDWKVRVHQPKLDAALQGWKSMRQFSQTDSYKNSRVTRSEYLEHG 395
            P+  KV++  P  +     W      +   +++   +++ EY E G
Sbjct: 321 APSSMKVKIIAPP-ERKYSVWIGGSILASLTTFQQMWISKQEYDESG 366

>Suva_4.220 Chr4 (389822..389843,389967..391120) [1176 bp, 391 aa]
           {ON} YDL029W (REAL)
          Length = 391

 Score = 85.9 bits (211), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 88/359 (24%), Positives = 150/359 (41%), Gaps = 57/359 (15%)

Query: 4   PLLMENGSYEIKFGPANLETP-YRARNCLTRDRYGRYHLSNQMDQIRDI----------S 52
           P++++ G+  +K G A    P Y   + + R        ++    ++DI          S
Sbjct: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVTTPLKDIMIGDEASDVRS 65

Query: 53  HCHIRRPSELGQLISWELEEQIWDYCLFNPDEFGWELKDSKDVDLIASETCMTIPEISKN 112
           +  I  P E G + +W   E +WDY  F       +L+ + +  ++ +E  M   +  + 
Sbjct: 66  YLQISYPMENGIIKNWTDMELLWDYAFFEQ----MKLQSTSNGKILLTEPPMNPLKNREK 121

Query: 113 MDQVVFEEYEFGSMMKCPVAQFVPFDRARDYDIVGGAGEVVEAKSGYNNFQLVVDSGFNC 172
           M +V+FE+Y+FG +     A    + +                 SG     +VVDSG   
Sbjct: 122 MCEVMFEKYDFGGVYVAIQAVLALYAQG--------------LSSG-----VVVDSGDGV 162

Query: 173 TWVMPVIKGVPYYKATKKLDIGGRFLNGLLKETISFRHY--NVMDETILINNIKEQCCFM 230
           T ++PV + V     T++LD+ GR +   L + +S R Y  N   +   +  IKE+ C++
Sbjct: 163 THIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYV 222

Query: 231 PPVSYFDS-FQRKEETRVE-YILPDFQTSLIGYVRQPKQAIPKTSQILRLEDELFTVPET 288
                 D+   R+  T VE Y LPD +T  +G                    E F  PE 
Sbjct: 223 SYDLDLDTKLARETTTLVESYELPDGRTIKVG-------------------QERFEAPEC 263

Query: 289 FFHPEISNILKPGLVETILECVSMVPEVLRPLLVSNIVAVGGNFNIANFATRLATELQR 347
            F P + ++ +PG+ E +   V      +R  L   IV  GG+       +RL  EL++
Sbjct: 264 LFQPGLVDVEQPGVGELLFNTVQSADVDIRSSLYKAIVLSGGSSMYPGLPSRLEKELKQ 322

>NDAI0G03040 Chr7 complement(708715..709832,710590..710599) [1128
           bp, 375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score = 85.5 bits (210), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 89/407 (21%), Positives = 159/407 (39%), Gaps = 64/407 (15%)

Query: 5   LLMENGSYEIKFGPANLETPY----------RARNCLTRDRYGRYHLSNQMDQIRDISHC 54
           L+++NGS   K G A  + P           R +  +        ++ ++    R I   
Sbjct: 8   LVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRGI--L 65

Query: 55  HIRRPSELGQLISWELEEQIWDYCLFNPDEFGWELKDS-KDVDLIASETCMTIPEISKNM 113
            +R P E G + +W+  E+IW +  +N      EL+ + ++  ++ +E  M      + M
Sbjct: 66  TLRYPIEHGIVTNWDDMEKIWHHTFYN------ELRVAPEEHPVLLTEAPMNPKSNREKM 119

Query: 114 DQVVFEEYEFGSMMKCPVAQFVPFDRARDYDIVGGAGEVVEAKSGYNNFQLVVDSGFNCT 173
            Q++FE +   +      A    +   R   IV                   +DSG   T
Sbjct: 120 TQIMFETFNVPAFYVSIQAVLSLYSSGRTTGIV-------------------LDSGDGVT 160

Query: 174 WVMPVIKGVPYYKATKKLDIGGRFLNGLLKETISFRHYN--VMDETILINNIKEQCCFMP 231
            V+P+  G     A  ++D+ GR L   L + +S R Y+     E  ++ +IKE+ C++ 
Sbjct: 161 HVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYVA 220

Query: 232 PVSYFDSFQRKEETRV---EYILPDFQTSLIGYVRQPKQAIPKTSQILRLEDELFTVPET 288
            + +    Q   ++      Y LPD Q   IG                   +E F  PE 
Sbjct: 221 -LDFEQEMQTASQSSSIEKSYELPDGQVITIG-------------------NERFRAPEA 260

Query: 289 FFHPEISNILKPGLVETILECVSMVPEVLRPLLVSNIVAVGGNFNIANFATRLATELQRQ 348
            FHP +  +   G+ +T    +      +R  L  NIV  GG+      A R+  E+   
Sbjct: 261 LFHPSVLGLESSGIDQTTYNSIMKCDVDVRKELYGNIVMSGGSTMFPGIAERMQKEITAL 320

Query: 349 CPTDWKVRVHQPKLDAALQGWKSMRQFSQTDSYKNSRVTRSEYLEHG 395
            P+  KV++  P  +     W      +   +++   +++ EY E G
Sbjct: 321 APSSMKVKIIAPP-ERKYSVWIGGSILASLTTFQQMWISKQEYDESG 366

>Skud_6.31 Chr6 complement(56454..57536) [1083 bp, 360 aa] {ON}
           YFL039C (REAL)
          Length = 360

 Score = 85.1 bits (209), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 78/346 (22%), Positives = 137/346 (39%), Gaps = 52/346 (15%)

Query: 56  IRRPSELGQLISWELEEQIWDYCLFNPDEFGWELKDS-KDVDLIASETCMTIPEISKNMD 114
           +R P E G + +W+  E+IW +  +N      EL+ + ++  ++ +E  M      + M 
Sbjct: 52  LRYPIEHGIVTNWDDMEKIWHHTFYN------ELRVAPEEHPVLLTEAPMNPKSNREKMT 105

Query: 115 QVVFEEYEFGSMMKCPVAQFVPFDRARDYDIVGGAGEVVEAKSGYNNFQLVVDSGFNCTW 174
           Q++FE +   +      A    +   R   IV                   +DSG   T 
Sbjct: 106 QIMFETFNVPAFYVSIQAVLSLYSSGRTTGIV-------------------LDSGDGVTH 146

Query: 175 VMPVIKGVPYYKATKKLDIGGRFLNGLLKETISFRHYN--VMDETILINNIKEQCCFMPP 232
           V+P+  G     A  ++D+ GR L   L + +S R Y+     E  ++ +IKE+ C++  
Sbjct: 147 VVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYVA- 205

Query: 233 VSYFDSFQRKEETRV---EYILPDFQTSLIGYVRQPKQAIPKTSQILRLEDELFTVPETF 289
           + +    Q   ++      Y LPD Q   IG                   +E F  PE  
Sbjct: 206 LDFEQEMQTAAQSSSIEKSYELPDGQVITIG-------------------NERFRAPEAL 246

Query: 290 FHPEISNILKPGLVETILECVSMVPEVLRPLLVSNIVAVGGNFNIANFATRLATELQRQC 349
           FHP +  +   G+ +T    +      +R  L  NIV  GG       A R+  E+    
Sbjct: 247 FHPSVLGLESAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMFPGIAERMQKEITALA 306

Query: 350 PTDWKVRVHQPKLDAALQGWKSMRQFSQTDSYKNSRVTRSEYLEHG 395
           P+  KV++  P  +     W      +   +++   +++ EY E G
Sbjct: 307 PSSMKVKIIAPP-ERKYSVWIGGSILASLTTFQQMWISKQEYDESG 351

>TDEL0C00470 Chr3 complement(72546..73663,73929..73938) [1128 bp,
           375 aa] {ON} 
          Length = 375

 Score = 85.1 bits (209), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 89/407 (21%), Positives = 158/407 (38%), Gaps = 64/407 (15%)

Query: 5   LLMENGSYEIKFGPANLETPY----------RARNCLTRDRYGRYHLSNQMDQIRDISHC 54
           L+++NGS   K G A  + P           R +  +        ++ ++    R I   
Sbjct: 8   LVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRGI--L 65

Query: 55  HIRRPSELGQLISWELEEQIWDYCLFNPDEFGWELKDS-KDVDLIASETCMTIPEISKNM 113
            +R P E G + +W+  E+IW +  +N      EL+ + ++  ++ +E  M      + M
Sbjct: 66  TLRYPIEHGIVTNWDDMEKIWHHTFYN------ELRVAPEEHPVLLTEAPMNPKSNREKM 119

Query: 114 DQVVFEEYEFGSMMKCPVAQFVPFDRARDYDIVGGAGEVVEAKSGYNNFQLVVDSGFNCT 173
            Q++FE +   +      A    +   R   IV                   +DSG   T
Sbjct: 120 TQIMFETFNVPAFYVSIQAVLSLYSSGRTTGIV-------------------LDSGDGVT 160

Query: 174 WVMPVIKGVPYYKATKKLDIGGRFLNGLLKETISFRHYN--VMDETILINNIKEQCCFMP 231
            V+P+  G     A  ++D+ GR L   L + +S R Y+     E  ++ +IKE+ C++ 
Sbjct: 161 HVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYVA 220

Query: 232 PVSYFDSFQRKEETRV---EYILPDFQTSLIGYVRQPKQAIPKTSQILRLEDELFTVPET 288
            + +    Q   ++      Y LPD Q   IG                   +E F  PE 
Sbjct: 221 -LDFEQEMQTAAQSSSIEKSYELPDGQVITIG-------------------NERFRAPEA 260

Query: 289 FFHPEISNILKPGLVETILECVSMVPEVLRPLLVSNIVAVGGNFNIANFATRLATELQRQ 348
            FHP +  +   G+ +T    +      +R  L  NIV  GG       A R+  E+   
Sbjct: 261 LFHPSVLGLESAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMFPGIAERMQKEITAL 320

Query: 349 CPTDWKVRVHQPKLDAALQGWKSMRQFSQTDSYKNSRVTRSEYLEHG 395
            P+  KV++  P  +     W      +   +++   +++ EY E G
Sbjct: 321 APSSMKVKIIAPP-ERKYSVWIGGSILASLTTFQQMWISKQEYDESG 366

>CAGL0K12694g Chr11 (1258451..1258460,1259340..1260457) [1128 bp,
           375 aa] {ON} highly similar to uniprot|P02579
           Saccharomyces cerevisiae YFL039c ACT1 actin
          Length = 375

 Score = 85.1 bits (209), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 89/407 (21%), Positives = 158/407 (38%), Gaps = 64/407 (15%)

Query: 5   LLMENGSYEIKFGPANLETPY----------RARNCLTRDRYGRYHLSNQMDQIRDISHC 54
           L+++NGS   K G A  + P           R +  +        ++ ++    R I   
Sbjct: 8   LVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRGI--L 65

Query: 55  HIRRPSELGQLISWELEEQIWDYCLFNPDEFGWELKDS-KDVDLIASETCMTIPEISKNM 113
            +R P E G + +W+  E+IW +  +N      EL+ + ++  ++ +E  M      + M
Sbjct: 66  TLRYPIEHGIVTNWDDMEKIWHHTFYN------ELRVAPEEHPVLLTEAPMNPKSNREKM 119

Query: 114 DQVVFEEYEFGSMMKCPVAQFVPFDRARDYDIVGGAGEVVEAKSGYNNFQLVVDSGFNCT 173
            Q++FE +   +      A    +   R   IV                   +DSG   T
Sbjct: 120 TQIMFETFNVPAFYVSIQAVLSLYSSGRTTGIV-------------------LDSGDGVT 160

Query: 174 WVMPVIKGVPYYKATKKLDIGGRFLNGLLKETISFRHYN--VMDETILINNIKEQCCFMP 231
            V+P+  G     A  ++D+ GR L   L + +S R Y+     E  ++ +IKE+ C++ 
Sbjct: 161 HVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYVA 220

Query: 232 PVSYFDSFQRKEETRV---EYILPDFQTSLIGYVRQPKQAIPKTSQILRLEDELFTVPET 288
            + +    Q   ++      Y LPD Q   IG                   +E F  PE 
Sbjct: 221 -LDFEQEMQTAAQSSSIEKSYELPDGQVITIG-------------------NERFRAPEA 260

Query: 289 FFHPEISNILKPGLVETILECVSMVPEVLRPLLVSNIVAVGGNFNIANFATRLATELQRQ 348
            FHP +  +   G+ +T    +      +R  L  NIV  GG       A R+  E+   
Sbjct: 261 LFHPSVLGLESAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMFPGIAERMQKEITAL 320

Query: 349 CPTDWKVRVHQPKLDAALQGWKSMRQFSQTDSYKNSRVTRSEYLEHG 395
            P+  KV++  P  +     W      +   +++   +++ EY E G
Sbjct: 321 APSSMKVKIIAPP-ERKYSVWIGGSILASLTTFQQMWISKQEYDESG 366

>Suva_6.18 Chr6 complement(26677..27794,28152..28161) [1128 bp, 375
           aa] {ON} YFL039C (REAL)
          Length = 375

 Score = 85.1 bits (209), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 89/407 (21%), Positives = 158/407 (38%), Gaps = 64/407 (15%)

Query: 5   LLMENGSYEIKFGPANLETPY----------RARNCLTRDRYGRYHLSNQMDQIRDISHC 54
           L+++NGS   K G A  + P           R +  +        ++ ++    R I   
Sbjct: 8   LVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRGI--L 65

Query: 55  HIRRPSELGQLISWELEEQIWDYCLFNPDEFGWELKDS-KDVDLIASETCMTIPEISKNM 113
            +R P E G + +W+  E+IW +  +N      EL+ + ++  ++ +E  M      + M
Sbjct: 66  TLRYPIEHGIVTNWDDMEKIWHHTFYN------ELRVAPEEHPVLLTEAPMNPKSNREKM 119

Query: 114 DQVVFEEYEFGSMMKCPVAQFVPFDRARDYDIVGGAGEVVEAKSGYNNFQLVVDSGFNCT 173
            Q++FE +   +      A    +   R   IV                   +DSG   T
Sbjct: 120 TQIMFETFNVPAFYVSIQAVLSLYSSGRTTGIV-------------------LDSGDGVT 160

Query: 174 WVMPVIKGVPYYKATKKLDIGGRFLNGLLKETISFRHYN--VMDETILINNIKEQCCFMP 231
            V+P+  G     A  ++D+ GR L   L + +S R Y+     E  ++ +IKE+ C++ 
Sbjct: 161 HVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYVA 220

Query: 232 PVSYFDSFQRKEETRV---EYILPDFQTSLIGYVRQPKQAIPKTSQILRLEDELFTVPET 288
            + +    Q   ++      Y LPD Q   IG                   +E F  PE 
Sbjct: 221 -LDFEQEMQTAAQSSSIEKSYELPDGQVITIG-------------------NERFRAPEA 260

Query: 289 FFHPEISNILKPGLVETILECVSMVPEVLRPLLVSNIVAVGGNFNIANFATRLATELQRQ 348
            FHP +  +   G+ +T    +      +R  L  NIV  GG       A R+  E+   
Sbjct: 261 LFHPSVLGLESAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMFPGIAERMQKEITAL 320

Query: 349 CPTDWKVRVHQPKLDAALQGWKSMRQFSQTDSYKNSRVTRSEYLEHG 395
            P+  KV++  P  +     W      +   +++   +++ EY E G
Sbjct: 321 APSSMKVKIIAPP-ERKYSVWIGGSILASLTTFQQMWISKQEYDESG 366

>Smik_6.39 Chr6 complement(68673..69790,70076..70085) [1128 bp, 375
           aa] {ON} YFL039C (REAL)
          Length = 375

 Score = 85.1 bits (209), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 89/407 (21%), Positives = 158/407 (38%), Gaps = 64/407 (15%)

Query: 5   LLMENGSYEIKFGPANLETPY----------RARNCLTRDRYGRYHLSNQMDQIRDISHC 54
           L+++NGS   K G A  + P           R +  +        ++ ++    R I   
Sbjct: 8   LVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRGI--L 65

Query: 55  HIRRPSELGQLISWELEEQIWDYCLFNPDEFGWELKDS-KDVDLIASETCMTIPEISKNM 113
            +R P E G + +W+  E+IW +  +N      EL+ + ++  ++ +E  M      + M
Sbjct: 66  TLRYPIEHGIVTNWDDMEKIWHHTFYN------ELRVAPEEHPVLLTEAPMNPKSNREKM 119

Query: 114 DQVVFEEYEFGSMMKCPVAQFVPFDRARDYDIVGGAGEVVEAKSGYNNFQLVVDSGFNCT 173
            Q++FE +   +      A    +   R   IV                   +DSG   T
Sbjct: 120 TQIMFETFNVPAFYVSIQAVLSLYSSGRTTGIV-------------------LDSGDGVT 160

Query: 174 WVMPVIKGVPYYKATKKLDIGGRFLNGLLKETISFRHYN--VMDETILINNIKEQCCFMP 231
            V+P+  G     A  ++D+ GR L   L + +S R Y+     E  ++ +IKE+ C++ 
Sbjct: 161 HVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYVA 220

Query: 232 PVSYFDSFQRKEETRV---EYILPDFQTSLIGYVRQPKQAIPKTSQILRLEDELFTVPET 288
            + +    Q   ++      Y LPD Q   IG                   +E F  PE 
Sbjct: 221 -LDFEQEMQTAAQSSSIEKSYELPDGQVITIG-------------------NERFRAPEA 260

Query: 289 FFHPEISNILKPGLVETILECVSMVPEVLRPLLVSNIVAVGGNFNIANFATRLATELQRQ 348
            FHP +  +   G+ +T    +      +R  L  NIV  GG       A R+  E+   
Sbjct: 261 LFHPSVLGLESAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMFPGIAERMQKEITAL 320

Query: 349 CPTDWKVRVHQPKLDAALQGWKSMRQFSQTDSYKNSRVTRSEYLEHG 395
            P+  KV++  P  +     W      +   +++   +++ EY E G
Sbjct: 321 APSSMKVKIIAPP-ERKYSVWIGGSILASLTTFQQMWISKQEYDESG 366

>YFL039C Chr6 complement(53260..54377,54687..54696) [1128 bp, 375
           aa] {ON}  ACT1Actin, structural protein involved in cell
           polarization, endocytosis, and other cytoskeletal
           functions
          Length = 375

 Score = 85.1 bits (209), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 89/407 (21%), Positives = 158/407 (38%), Gaps = 64/407 (15%)

Query: 5   LLMENGSYEIKFGPANLETPY----------RARNCLTRDRYGRYHLSNQMDQIRDISHC 54
           L+++NGS   K G A  + P           R +  +        ++ ++    R I   
Sbjct: 8   LVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRGI--L 65

Query: 55  HIRRPSELGQLISWELEEQIWDYCLFNPDEFGWELKDS-KDVDLIASETCMTIPEISKNM 113
            +R P E G + +W+  E+IW +  +N      EL+ + ++  ++ +E  M      + M
Sbjct: 66  TLRYPIEHGIVTNWDDMEKIWHHTFYN------ELRVAPEEHPVLLTEAPMNPKSNREKM 119

Query: 114 DQVVFEEYEFGSMMKCPVAQFVPFDRARDYDIVGGAGEVVEAKSGYNNFQLVVDSGFNCT 173
            Q++FE +   +      A    +   R   IV                   +DSG   T
Sbjct: 120 TQIMFETFNVPAFYVSIQAVLSLYSSGRTTGIV-------------------LDSGDGVT 160

Query: 174 WVMPVIKGVPYYKATKKLDIGGRFLNGLLKETISFRHYN--VMDETILINNIKEQCCFMP 231
            V+P+  G     A  ++D+ GR L   L + +S R Y+     E  ++ +IKE+ C++ 
Sbjct: 161 HVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYVA 220

Query: 232 PVSYFDSFQRKEETRV---EYILPDFQTSLIGYVRQPKQAIPKTSQILRLEDELFTVPET 288
            + +    Q   ++      Y LPD Q   IG                   +E F  PE 
Sbjct: 221 -LDFEQEMQTAAQSSSIEKSYELPDGQVITIG-------------------NERFRAPEA 260

Query: 289 FFHPEISNILKPGLVETILECVSMVPEVLRPLLVSNIVAVGGNFNIANFATRLATELQRQ 348
            FHP +  +   G+ +T    +      +R  L  NIV  GG       A R+  E+   
Sbjct: 261 LFHPSVLGLESAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMFPGIAERMQKEITAL 320

Query: 349 CPTDWKVRVHQPKLDAALQGWKSMRQFSQTDSYKNSRVTRSEYLEHG 395
            P+  KV++  P  +     W      +   +++   +++ EY E G
Sbjct: 321 APSSMKVKIIAPP-ERKYSVWIGGSILASLTTFQQMWISKQEYDESG 366

>KNAG0L00250 Chr12 complement(32595..33712,34194..34203) [1128 bp,
           375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score = 85.1 bits (209), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 89/407 (21%), Positives = 158/407 (38%), Gaps = 64/407 (15%)

Query: 5   LLMENGSYEIKFGPANLETPY----------RARNCLTRDRYGRYHLSNQMDQIRDISHC 54
           L+++NGS   K G A  + P           R +  +        ++ ++    R I   
Sbjct: 8   LVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRGI--L 65

Query: 55  HIRRPSELGQLISWELEEQIWDYCLFNPDEFGWELKDS-KDVDLIASETCMTIPEISKNM 113
            +R P E G + +W+  E+IW +  +N      EL+ + ++  ++ +E  M      + M
Sbjct: 66  TLRYPIEHGIVTNWDDMEKIWHHTFYN------ELRVAPEEHPVLLTEAPMNPKSNREKM 119

Query: 114 DQVVFEEYEFGSMMKCPVAQFVPFDRARDYDIVGGAGEVVEAKSGYNNFQLVVDSGFNCT 173
            Q++FE +   +      A    +   R   IV                   +DSG   T
Sbjct: 120 TQIMFETFNVPAFYVSIQAVLSLYSSGRTTGIV-------------------LDSGDGVT 160

Query: 174 WVMPVIKGVPYYKATKKLDIGGRFLNGLLKETISFRHYN--VMDETILINNIKEQCCFMP 231
            V+P+  G     A  ++D+ GR L   L + +S R Y+     E  ++ +IKE+ C++ 
Sbjct: 161 HVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYVA 220

Query: 232 PVSYFDSFQRKEETRV---EYILPDFQTSLIGYVRQPKQAIPKTSQILRLEDELFTVPET 288
            + +    Q   ++      Y LPD Q   IG                   +E F  PE 
Sbjct: 221 -LDFEQEMQTAAQSSSIEKSYELPDGQVITIG-------------------NERFRAPEA 260

Query: 289 FFHPEISNILKPGLVETILECVSMVPEVLRPLLVSNIVAVGGNFNIANFATRLATELQRQ 348
            FHP +  +   G+ +T    +      +R  L  NIV  GG       A R+  E+   
Sbjct: 261 LFHPSVLGLESSGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMFPGIAERMQKEITAL 320

Query: 349 CPTDWKVRVHQPKLDAALQGWKSMRQFSQTDSYKNSRVTRSEYLEHG 395
            P+  KV++  P  +     W      +   +++   +++ EY E G
Sbjct: 321 APSSMKVKIIAPP-ERKYSVWIGGSILASLTTFQQMWISKQEYDESG 366

>KAFR0D00940 Chr4 complement(198280..199397,199945..199954) [1128
           bp, 375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score = 85.1 bits (209), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 89/407 (21%), Positives = 158/407 (38%), Gaps = 64/407 (15%)

Query: 5   LLMENGSYEIKFGPANLETPY----------RARNCLTRDRYGRYHLSNQMDQIRDISHC 54
           L+++NGS   K G A  + P           R +  +        ++ ++    R I   
Sbjct: 8   LVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRGI--L 65

Query: 55  HIRRPSELGQLISWELEEQIWDYCLFNPDEFGWELKDS-KDVDLIASETCMTIPEISKNM 113
            +R P E G + +W+  E+IW +  +N      EL+ + ++  ++ +E  M      + M
Sbjct: 66  TLRYPIEHGIVTNWDDMEKIWHHTFYN------ELRVAPEEHPVLLTEAPMNPKSNREKM 119

Query: 114 DQVVFEEYEFGSMMKCPVAQFVPFDRARDYDIVGGAGEVVEAKSGYNNFQLVVDSGFNCT 173
            Q++FE +   +      A    +   R   IV                   +DSG   T
Sbjct: 120 TQIMFETFNVPAFYVSIQAVLSLYSSGRTTGIV-------------------LDSGDGVT 160

Query: 174 WVMPVIKGVPYYKATKKLDIGGRFLNGLLKETISFRHYN--VMDETILINNIKEQCCFMP 231
            V+P+  G     A  ++D+ GR L   L + +S R Y+     E  ++ +IKE+ C++ 
Sbjct: 161 HVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYVA 220

Query: 232 PVSYFDSFQRKEETRV---EYILPDFQTSLIGYVRQPKQAIPKTSQILRLEDELFTVPET 288
            + +    Q   ++      Y LPD Q   IG                   +E F  PE 
Sbjct: 221 -LDFEQEMQTAAQSSSIEKSYELPDGQVITIG-------------------NERFRAPEA 260

Query: 289 FFHPEISNILKPGLVETILECVSMVPEVLRPLLVSNIVAVGGNFNIANFATRLATELQRQ 348
            FHP +  +   G+ +T    +      +R  L  NIV  GG       A R+  E+   
Sbjct: 261 LFHPSVLGLESSGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMFPGIAERMQKEITAL 320

Query: 349 CPTDWKVRVHQPKLDAALQGWKSMRQFSQTDSYKNSRVTRSEYLEHG 395
            P+  KV++  P  +     W      +   +++   +++ EY E G
Sbjct: 321 APSSMKVKIIAPP-ERKYSVWIGGSILASLTTFQQMWISKQEYDESG 366

>ABR222W Chr2 (818719..818728,819032..820152) [1131 bp, 376 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YFL039C
           (ACT1); 1-intron
          Length = 376

 Score = 85.1 bits (209), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 88/407 (21%), Positives = 158/407 (38%), Gaps = 64/407 (15%)

Query: 5   LLMENGSYEIKFGPANLETPY----------RARNCLTRDRYGRYHLSNQMDQIRDISHC 54
           L+++NGS   K G A  + P           R +  +        ++ ++    R I   
Sbjct: 9   LVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRGI--L 66

Query: 55  HIRRPSELGQLISWELEEQIWDYCLFNPDEFGWELKDS-KDVDLIASETCMTIPEISKNM 113
            +R P E G + +W+  E+IW +  +N      EL+ + ++  ++ +E  M      + M
Sbjct: 67  TLRYPIEHGIVTNWDDMEKIWHHTFYN------ELRVAPEEHPVLLTEAPMNPKSNREKM 120

Query: 114 DQVVFEEYEFGSMMKCPVAQFVPFDRARDYDIVGGAGEVVEAKSGYNNFQLVVDSGFNCT 173
            Q++FE +   +      A    +   R   IV                   +DSG   T
Sbjct: 121 TQIMFETFNVPAFYVSIQAVLSLYSSGRTTGIV-------------------LDSGDGVT 161

Query: 174 WVMPVIKGVPYYKATKKLDIGGRFLNGLLKETISFRHYN--VMDETILINNIKEQCCFMP 231
            V+P+  G     A  ++D+ GR +   L + +S R Y+     E  ++ +IKE+ C++ 
Sbjct: 162 HVVPIYAGFSLPHAILRIDLAGRDMTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYVA 221

Query: 232 PVSYFDSFQRKEETRV---EYILPDFQTSLIGYVRQPKQAIPKTSQILRLEDELFTVPET 288
            + +    Q   ++      Y LPD Q   IG                   +E F  PE 
Sbjct: 222 -LDFEQEMQTAAQSSAIEKSYELPDGQVITIG-------------------NERFRAPEA 261

Query: 289 FFHPEISNILKPGLVETILECVSMVPEVLRPLLVSNIVAVGGNFNIANFATRLATELQRQ 348
            FHP +  +   G+ +T    +      +R  L  NIV  GG       A R+  E+   
Sbjct: 262 LFHPSVLGLEAAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMFPGIAERMQKEITAL 321

Query: 349 CPTDWKVRVHQPKLDAALQGWKSMRQFSQTDSYKNSRVTRSEYLEHG 395
            P+  KV++  P  +     W      +   +++   +++ EY E G
Sbjct: 322 APSSMKVKIIAPP-ERKYSVWIGGSILASLTTFQQMWISKQEYDESG 367

>SAKL0B00968g Chr2 complement(89966..91083,91524..91533) [1128 bp,
           375 aa] {ON} highly similar to uniprot|P02579
           Saccharomyces cerevisiae YFL039C ACT1 Actin
          Length = 375

 Score = 85.1 bits (209), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 88/407 (21%), Positives = 158/407 (38%), Gaps = 64/407 (15%)

Query: 5   LLMENGSYEIKFGPANLETPY----------RARNCLTRDRYGRYHLSNQMDQIRDISHC 54
           L+++NGS   K G A  + P           R +  +        ++ ++    R I   
Sbjct: 8   LVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRGI--L 65

Query: 55  HIRRPSELGQLISWELEEQIWDYCLFNPDEFGWELKDS-KDVDLIASETCMTIPEISKNM 113
            +R P E G + +W+  E+IW +  +N      EL+ + ++  ++ +E  M      + M
Sbjct: 66  TLRYPIEHGIVTNWDDMEKIWHHTFYN------ELRVAPEEHPVLLTEAPMNPKSNREKM 119

Query: 114 DQVVFEEYEFGSMMKCPVAQFVPFDRARDYDIVGGAGEVVEAKSGYNNFQLVVDSGFNCT 173
            Q++FE +   +      A    +   R   IV                   +DSG   T
Sbjct: 120 TQILFETFNVPAFYVSIQAVLSLYSSGRTTGIV-------------------LDSGDGVT 160

Query: 174 WVMPVIKGVPYYKATKKLDIGGRFLNGLLKETISFRHYN--VMDETILINNIKEQCCFMP 231
            V+P+  G     A  ++D+ GR +   L + +S R Y+     E  ++ +IKE+ C++ 
Sbjct: 161 HVVPIYAGFSLPHAILRIDLAGRDMTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYVA 220

Query: 232 PVSYFDSFQRKEETRV---EYILPDFQTSLIGYVRQPKQAIPKTSQILRLEDELFTVPET 288
            + +    Q   ++      Y LPD Q   IG                   +E F  PE 
Sbjct: 221 -LDFEQEMQTAAQSSAIEKSYELPDGQVITIG-------------------NERFRAPEA 260

Query: 289 FFHPEISNILKPGLVETILECVSMVPEVLRPLLVSNIVAVGGNFNIANFATRLATELQRQ 348
            FHP +  +   G+ +T    +      +R  L  NIV  GG       A R+  E+   
Sbjct: 261 LFHPSVLGLEAAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMFPGIAERMQKEITAL 320

Query: 349 CPTDWKVRVHQPKLDAALQGWKSMRQFSQTDSYKNSRVTRSEYLEHG 395
            P+  KV++  P  +     W      +   +++   +++ EY E G
Sbjct: 321 APSSMKVKIIAPP-ERKYSVWIGGSILASLTTFQQMWISKQEYDESG 366

>TPHA0D00250 Chr4 complement(34030..35147,35712..35721) [1128 bp,
           375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score = 84.7 bits (208), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 89/407 (21%), Positives = 159/407 (39%), Gaps = 64/407 (15%)

Query: 5   LLMENGSYEIKFGPANLETPY----------RARNCLTRDRYGRYHLSNQMDQIRDISHC 54
           L+++NGS   K G A  + P           R +  +        ++ ++    R I   
Sbjct: 8   LVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRGI--L 65

Query: 55  HIRRPSELGQLISWELEEQIWDYCLFNPDEFGWELKDS-KDVDLIASETCMTIPEISKNM 113
            +R P E G + +W+  E+IW +  +N      EL+ + ++  ++ +E  M      + M
Sbjct: 66  TLRYPIEHGIVTNWDDMEKIWHHTFYN------ELRVAPEEHPVLLTEAPMNPKSNREKM 119

Query: 114 DQVVFEEYEFGSMMKCPVAQFVPFDRARDYDIVGGAGEVVEAKSGYNNFQLVVDSGFNCT 173
            Q++FE +   +      A    +   R   IV                   +DSG   T
Sbjct: 120 TQIMFETFNVPAFYVSIQAVLSLYSSGRTTGIV-------------------LDSGDGVT 160

Query: 174 WVMPVIKGVPYYKATKKLDIGGRFLNGLLKETISFRHYN--VMDETILINNIKEQCCFMP 231
            V+P+  G     A  ++D+ GR L   L + +S R Y+     E  ++ +IKE+ C++ 
Sbjct: 161 HVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYVA 220

Query: 232 PVSYFDSFQRKEETRV---EYILPDFQTSLIGYVRQPKQAIPKTSQILRLEDELFTVPET 288
            + +    Q   ++      Y LPD Q   IG                   +E F  PE 
Sbjct: 221 -LDFEQEMQTAAQSSSIEKSYELPDGQVITIG-------------------NERFRAPEA 260

Query: 289 FFHPEISNILKPGLVETILECVSMVPEVLRPLLVSNIVAVGGNFNIANFATRLATELQRQ 348
            FHP + ++   G+ +T    +      +R  L  NIV  GG       A R+  E+   
Sbjct: 261 LFHPSVLSLESAGIDQTTYNSIMKCDIDVRKELYGNIVMSGGTTMFPGIAERMQKEITAL 320

Query: 349 CPTDWKVRVHQPKLDAALQGWKSMRQFSQTDSYKNSRVTRSEYLEHG 395
            P+  KV++  P  +     W      +   +++   +++ EY E G
Sbjct: 321 APSSMKVKIIAPP-ERKYSVWIGGSILASLTTFQQMWISKQEYDESG 366

>YDL029W Chr4 (399340..399361,399485..400638) [1176 bp, 391 aa] {ON}
            ARP2Essential component of the Arp2/3 complex, which is
           a highly conserved actin nucleation center required for
           the motility and integrity of actin patches; involved in
           endocytosis and membrane growth and polarity
          Length = 391

 Score = 84.7 bits (208), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 89/362 (24%), Positives = 150/362 (41%), Gaps = 63/362 (17%)

Query: 4   PLLMENGSYEIKFGPANLETP-YRARNCLTRDRYGRYHLSNQMDQIRDI----------S 52
           P++++ G+  +K G A    P Y   + + R        ++    ++DI          S
Sbjct: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVATPLKDIMIGDEASEVRS 65

Query: 53  HCHIRRPSELGQLISWELEEQIWDYCLFNPDEFGWELKDSKDVDLIASETCMTIPEISKN 112
           +  I  P E G + +W   E +WDY  F       +L  + +  ++ +E  M   +  + 
Sbjct: 66  YLQISYPMENGIIKNWTDMELLWDYAFFEQ----MKLPSTSNGKILLTEPPMNPLKNREK 121

Query: 113 MDQVVFEEYEFGSMMKCPVAQFVPFDRARDYDIVGGAGEVVEAKSGYNNFQLVVDSGFNC 172
           M +V+FE+Y+FG +     A    + +                 SG     +VVDSG   
Sbjct: 122 MCEVMFEKYDFGGVYVAIQAVLALYAQG--------------LSSG-----VVVDSGDGV 162

Query: 173 TWVMPVIKGVPYYKATKKLDIGGRFLNGLLKETISFRHY--NVMDETILINNIKEQCCFM 230
           T ++PV + V     T++LD+ GR +   L + +S R Y  N   +   +  IKE+ C+ 
Sbjct: 163 THIVPVYESVVLSHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCY- 221

Query: 231 PPVSY---FDSFQRKEETRV--EYILPDFQTSLIGYVRQPKQAIPKTSQILRLEDELFTV 285
             VSY    D+   +E T +   Y LPD +T  +G                    E F  
Sbjct: 222 --VSYDLDLDTKLARETTALVESYELPDGRTIKVG-------------------QERFEA 260

Query: 286 PETFFHPEISNILKPGLVETILECVSMVPEVLRPLLVSNIVAVGGNFNIANFATRLATEL 345
           PE  F P + ++ +PG+ E +   V      +R  L   IV  GG+       +RL  EL
Sbjct: 261 PECLFQPGLVDVEQPGVGELLFNTVQSADVDIRSSLYKAIVLSGGSSMYPGLPSRLEKEL 320

Query: 346 QR 347
           ++
Sbjct: 321 KQ 322

>KLLA0C03850g Chr3 complement(351772..352947) [1176 bp, 391 aa] {ON}
           highly similar to uniprot|P32381 Saccharomyces
           cerevisiae YDL029W ARP2 Essential component of the
           Arp2/3 complex which is a highly conserved actin
           nucleation center required for the motility and
           integrity of actin patches involved in endocytosis and
           membrane growth and polarity
          Length = 391

 Score = 84.7 bits (208), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 95/388 (24%), Positives = 158/388 (40%), Gaps = 78/388 (20%)

Query: 4   PLLMENGSYEIKFGPANLETP------YRARNCLTRDRYGRYH-------LSNQMDQIRD 50
           P++++ G+  +K G A    P         R  L  +  G          + ++  ++R 
Sbjct: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERGHASTPLKDIMIGDEASEVR- 64

Query: 51  ISHCHIRRPSELGQLISWELEEQIWDYCLFNPDEFGWELKDSKDVDLIASETCMTIPEIS 110
            S+  I  P E G + +W   E +WDY  F       +L  +    ++ +E  M   +  
Sbjct: 65  -SYLQISYPMENGIIRNWADMELLWDYAFFEQ----MKLPTTSGGKVLLTEPPMNPIKNR 119

Query: 111 KNMDQVVFEEYEFGSMMKCPVAQFVPFDRARDYDIVGGAGEVVEAKSGYNNFQLVVDSGF 170
           + M +V+FE+Y+FG       A    + +                 SG     +VVDSG 
Sbjct: 120 EQMCEVMFEKYDFGGTYVAIQAVLALYAQG--------------LSSG-----VVVDSGD 160

Query: 171 NCTWVMPVIKGVPYYKATKKLDIGGRFLNGLLKETISFRHY--NVMDETILINNIKEQCC 228
             T ++PV + V     T++LD+ GR +   L + +S R Y  N   +   +  IKE+ C
Sbjct: 161 GVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLC 220

Query: 229 FMPPVSY---FDS-FQRKEETRVE-YILPDFQTSLIGYVRQPKQAIPKTSQILRLEDELF 283
           +   VSY    D+   R+  T VE Y LPD                    +++++  E F
Sbjct: 221 Y---VSYDLDLDTKLARETTTLVESYELPD-------------------GRVIKVGPERF 258

Query: 284 TVPETFFHPEISNILKPGLVETILECVSMVPEVLRPLLVSNIVAVGGNFNIANFATRLAT 343
             PE  F P + ++ +PG+ E +   +      +R  L   IV  GG+       +RL  
Sbjct: 259 EAPECLFQPSLVDVEQPGVGELLFNTIQAADVDIRTSLYKAIVLSGGSSMYPGLPSRLEK 318

Query: 344 ELQ--------RQCPT---DWKVRVHQP 360
           EL+        R  PT    +KVR+  P
Sbjct: 319 ELKQLWFTRVLRNDPTRLDKFKVRIEDP 346

>ZYRO0F02772g Chr6 complement(235322..236439,236524..236533) [1128
           bp, 375 aa] {ON} uniprot|Q2HWE7 Zygosaccharomyces rouxii
           ACT1 Actin
          Length = 375

 Score = 84.3 bits (207), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 90/406 (22%), Positives = 159/406 (39%), Gaps = 62/406 (15%)

Query: 5   LLMENGSYEIKFGPANLETPY----------RARNCLTRDRYGRYHLSNQMDQIRDISHC 54
           L+++NGS   K G A  + P           R +  +        ++ ++    R I   
Sbjct: 8   LVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRGI--L 65

Query: 55  HIRRPSELGQLISWELEEQIWDYCLFNPDEFGWELKDS-KDVDLIASETCMTIPEISKNM 113
            +R P E G + +W+  E+IW +  +N      EL+ + ++  ++ +E  M      + M
Sbjct: 66  TLRYPIEHGIVTNWDDMEKIWHHTFYN------ELRVAPEEHPVLLTEAPMNPKSNREKM 119

Query: 114 DQVVFEEYEFGSMMKCPVAQFVPFDRARDYDIVGGAGEVVEAKSGYNNFQLVVDSGFNCT 173
            Q++FE +   +      A    +   R   IV                   +DSG   T
Sbjct: 120 TQIMFETFNVPAFYVSIQAVLSLYSSGRTTGIV-------------------LDSGDGVT 160

Query: 174 WVMPVIKGVPYYKATKKLDIGGRFLNGLLKETISFRHYN--VMDETILINNIKEQCCFMP 231
            V+P+  G     A  ++D+ GR L   L + +S R Y+     E  ++ +IKE+ C++ 
Sbjct: 161 HVVPIYAGFSMPHAILRIDLAGRDLTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYVA 220

Query: 232 PVSYFDSFQRKEETRVE--YILPDFQTSLIGYVRQPKQAIPKTSQILRLEDELFTVPETF 289
                +     + + VE  Y LPD Q   IG                   +E F  PE  
Sbjct: 221 LDFEQEMQTAAQSSSVEKSYELPDGQVITIG-------------------NERFRAPEAL 261

Query: 290 FHPEISNILKPGLVETILECVSMVPEVLRPLLVSNIVAVGGNFNIANFATRLATELQRQC 349
           FHP + ++   G+ +T    +      +R  L  NIV  GG       A R+  E+    
Sbjct: 262 FHPSVLSLESSGVDQTTYNSIMKCDVDVRKDLYGNIVMSGGTTMFPGIAERMQKEITALA 321

Query: 350 PTDWKVRVHQPKLDAALQGWKSMRQFSQTDSYKNSRVTRSEYLEHG 395
           P+  KV++  P  +     W      +   +++   +++ EY E G
Sbjct: 322 PSSMKVKIIAPP-ERKYSVWIGGSILASLTTFQQMWISKQEYDESG 366

>Smik_4.206 Chr4 (379506..379527,379652..380805) [1176 bp, 391 aa]
           {ON} YDL029W (REAL)
          Length = 391

 Score = 84.3 bits (207), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 89/362 (24%), Positives = 150/362 (41%), Gaps = 63/362 (17%)

Query: 4   PLLMENGSYEIKFGPANLETP-YRARNCLTRDRYGRYHLSNQMDQIRDI----------S 52
           P++++ G+  +K G A    P Y   + + R        ++    ++DI          S
Sbjct: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVTTPLKDIMIGDEASDVRS 65

Query: 53  HCHIRRPSELGQLISWELEEQIWDYCLFNPDEFGWELKDSKDVDLIASETCMTIPEISKN 112
           +  I  P E G + +W   E +WDY  F       +L  + +  ++ +E  M   +  + 
Sbjct: 66  YLQISYPMENGIIKNWTDMELLWDYAFFEQ----MKLPSTSNGKILLTEPPMNPLKNREK 121

Query: 113 MDQVVFEEYEFGSMMKCPVAQFVPFDRARDYDIVGGAGEVVEAKSGYNNFQLVVDSGFNC 172
           M +V+FE+Y+FG +     A    + +                 SG     +VVDSG   
Sbjct: 122 MCEVMFEKYDFGGVYVAIQAVLALYAQG--------------LSSG-----VVVDSGDGV 162

Query: 173 TWVMPVIKGVPYYKATKKLDIGGRFLNGLLKETISFRHY--NVMDETILINNIKEQCCFM 230
           T ++PV + V     T++LD+ GR +   L + +S R Y  N   +   +  IKE+ C+ 
Sbjct: 163 THIVPVYESVVLSHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCY- 221

Query: 231 PPVSY---FDSFQRKEETRV--EYILPDFQTSLIGYVRQPKQAIPKTSQILRLEDELFTV 285
             VSY    D+   +E T +   Y LPD +T  +G                    E F  
Sbjct: 222 --VSYDLDLDTKLARETTALVESYELPDGRTIKVG-------------------QERFEA 260

Query: 286 PETFFHPEISNILKPGLVETILECVSMVPEVLRPLLVSNIVAVGGNFNIANFATRLATEL 345
           PE  F P + ++ +PG+ E +   V      +R  L   IV  GG+       +RL  EL
Sbjct: 261 PECLFQPGLVDVEQPGVGELLFNTVQSADVDIRSSLYKAIVLSGGSSMYPGLPSRLEKEL 320

Query: 346 QR 347
           ++
Sbjct: 321 KQ 322

>AFR051W Chr6 (522829..524046) [1218 bp, 405 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YHR129C (ARP1)
          Length = 405

 Score = 84.7 bits (208), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 96/415 (23%), Positives = 164/415 (39%), Gaps = 61/415 (14%)

Query: 4   PLLMENGSYEIKFGPANLETP----------YRARNCLTRDRYGRYHLSNQMDQIRDISH 53
           P++++NGS  IK G +  E P           +    +     G   + NQ  ++R +  
Sbjct: 37  PVVLDNGSGIIKAGFSGEEKPKCFEYSLIGTTKYNKVMAGGLEGDTFIGNQAQELRGL-- 94

Query: 54  CHIRRPSELGQLISWELEEQIWDYCLFNPDEFGWELKDSKDVDLIASETCMTIPEISKNM 113
             +R P + G + +W   EQ+W Y +FN      +L++ +D   + +E  +   +  + M
Sbjct: 95  LKLRYPLQHGIVTNWADMEQVWGY-VFNKS---LQLQNVEDHPNLVTEAPLNPHKNREKM 150

Query: 114 DQVVFEEYEFGSMMKCPVAQFVPFDRARDYDIVGGAGEVVEAKSGYNNFQLVVDSGFNCT 173
            +++FE +   ++     A    +   R                       VVD G  C 
Sbjct: 151 CELLFESFNVPALYVSVQAVLSLYASGRTTGC-------------------VVDCGDGCC 191

Query: 174 WVMPVIKGVPYYKATKKLDIGGR----FLNGLLKETISFRHYNVMDETILINNIKEQCCF 229
             +PV  G     + +++DI GR    FL  LL++T      +  +  I +  IKE+ CF
Sbjct: 192 HAVPVFDGFSVPSSIRRIDIAGRDITEFLQLLLRKTTGVSLLSSSEREI-VRTIKEKACF 250

Query: 230 MPPVSYFDSFQRKEETRVEYILPDFQTSLIGYVRQPKQAIPKTSQILRLEDELFTVPETF 289
           +       +   K E +   + P F           K  +P   + + L  E +  PE  
Sbjct: 251 V-------TKDPKLEEQNFPMNPSFS----------KFKLPD-GKTIELGQERYRAPEIL 292

Query: 290 FHPEISNILKPGLVETILECVSMVPEVLRPLLVSNIVAVGGNFNIANFATRLATELQRQC 349
           F PE+       L +   + +  V   LR LL SNI+  GG   +  F  RL  EL+   
Sbjct: 293 FQPELIGSEFESLPDMCYQSIGKVDLDLRSLLYSNILLSGGTSMLPGFGDRLLKELKSLS 352

Query: 350 PTDWKVRVHQPKLDAALQGWKSMRQFSQTDSYKNSRVTRSEYLEHGADWCTKHRF 404
            +  K+++  P  +     W      S   ++K   VT+SE+ E     C   RF
Sbjct: 353 GSRTKIKIFAPP-ERKYSTWIGGSILSGLSTFKKLWVTKSEWEEFPD--CIHSRF 404

>SAKL0C07370g Chr3 complement(680403..681556,681672..681693) [1176
           bp, 391 aa] {ON} highly similar to uniprot|P32381
           Saccharomyces cerevisiae YDL029W ARP2 Essential
           component of the Arp2/3 complex which is a highly
           conserved actin nucleation center required for the
           motility and integrity of actin patches involved in
           endocytosis and membrane growth and polarity
          Length = 391

 Score = 84.3 bits (207), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 86/334 (25%), Positives = 140/334 (41%), Gaps = 64/334 (19%)

Query: 46  DQIRDI-SHCHIRRPSELGQLISWELEEQIWDYCLFNPDEFGWELKDSKDVDLIASETCM 104
           D+  D+ S+  I  P E G + +W   E +WDY  +       +L  +    ++ +E  M
Sbjct: 58  DEASDVRSYLQISYPMENGIIKNWADMELLWDYAFYEQ----MKLPSTSGGKVLLTEPPM 113

Query: 105 TIPEISKNMDQVVFEEYEFGSMMKCPVAQFVPFDRARDYDIVGGAGEVVEAKSGYNNFQL 164
                 + M +V+FE+Y+FG +     A    + +                 SG     +
Sbjct: 114 NPLRNREQMCEVMFEKYDFGGVYVAIQAVLALYAQG--------------LSSG-----V 154

Query: 165 VVDSGFNCTWVMPVIKGVPYYKATKKLDIGGRFLNGLLKETISFRHY--NVMDETILINN 222
           VVDSG   T ++PV + V     TK+LD+ GR +   L + +S R Y  N   +   +  
Sbjct: 155 VVDSGDGVTHIVPVYESVVLSHLTKRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQ 214

Query: 223 IKEQCCFMPPVSY---FDS-FQRKEETRVE-YILPDFQTSLIGYVRQPKQAIPKTSQILR 277
           IKE+ C+   VSY    D+   R+  T VE Y LPD                    ++++
Sbjct: 215 IKEKLCY---VSYDLDLDTKLARETTTLVENYELPD-------------------GRVIK 252

Query: 278 LEDELFTVPETFFHPEISNILKPGLVETILECVSMVPEVLRPLLVSNIVAVGGNFNIANF 337
           +  E F  PE  F P + ++ +PG+ E +   V      +R  L   +V  GG+      
Sbjct: 253 VGSERFEAPECLFQPSLVDVEQPGVGEMLFNTVQAADVDVRTALYRAVVLSGGSSMYPGL 312

Query: 338 ATRLATELQ--------RQCPT---DWKVRVHQP 360
            +RL  EL+        R  P+    +KVR+  P
Sbjct: 313 PSRLEKELKQLWFTRVLRNDPSRLDKFKVRIEDP 346

>TBLA0C00440 Chr3 complement(81591..82708,83412..83421) [1128 bp,
           375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score = 84.0 bits (206), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 88/407 (21%), Positives = 159/407 (39%), Gaps = 64/407 (15%)

Query: 5   LLMENGSYEIKFGPANLETPY----------RARNCLTRDRYGRYHLSNQMDQIRDISHC 54
           L+++NGS   K G A  + P           R +  +        ++ ++    R I   
Sbjct: 8   LVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRGI--L 65

Query: 55  HIRRPSELGQLISWELEEQIWDYCLFNPDEFGWELKDS-KDVDLIASETCMTIPEISKNM 113
            +R P E G + +W+  E+IW +  +N      EL+ + ++  ++ +E  M      + M
Sbjct: 66  TLRYPIEHGIVTNWDDMEKIWHHTFYN------ELRVAPEEHPVLLTEAPMNPKSNREKM 119

Query: 114 DQVVFEEYEFGSMMKCPVAQFVPFDRARDYDIVGGAGEVVEAKSGYNNFQLVVDSGFNCT 173
            Q++FE +   +      A    +   R   IV                   +DSG   T
Sbjct: 120 TQIMFETFNVPAFYVSIQAVLSLYSSGRTTGIV-------------------LDSGDGVT 160

Query: 174 WVMPVIKGVPYYKATKKLDIGGRFLNGLLKETISFRHYN--VMDETILINNIKEQCCFMP 231
            V+P+  G     A  ++D+ GR L   L + +S R Y+     E  ++ +IKE+ C++ 
Sbjct: 161 HVVPIYAGFSLPHAIMRIDLAGRDLTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYVA 220

Query: 232 PVSYFDSFQRKEETRV---EYILPDFQTSLIGYVRQPKQAIPKTSQILRLEDELFTVPET 288
            + +    Q   ++      Y LPD Q   IG                   +E F  PE 
Sbjct: 221 -LDFEQEMQTAAQSSSIEKSYELPDGQVITIG-------------------NERFRAPEA 260

Query: 289 FFHPEISNILKPGLVETILECVSMVPEVLRPLLVSNIVAVGGNFNIANFATRLATELQRQ 348
            FHP + ++   G+ +T    +      +R  L  NIV  GG       A R+  E+   
Sbjct: 261 LFHPSVLSLESAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMFPGIAERMQKEITAL 320

Query: 349 CPTDWKVRVHQPKLDAALQGWKSMRQFSQTDSYKNSRVTRSEYLEHG 395
            P+  +V++  P  +     W      +   +++   +++ EY E G
Sbjct: 321 APSSMEVKIIAPP-ERKYSVWIGGSILASLTTFQQMWISKQEYDESG 366

>KLLA0D05357g Chr4 (461726..461735,462516..463633) [1128 bp, 375 aa]
           {ON} highly similar to uniprot|P60010 Saccharomyces
           cerevisiae YFL039C ACT1 Actin structural protein
           involved in cell polarization endocytosis and other
           cytoskeletal functions
          Length = 375

 Score = 84.0 bits (206), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 87/407 (21%), Positives = 159/407 (39%), Gaps = 64/407 (15%)

Query: 5   LLMENGSYEIKFGPANLETPY----------RARNCLTRDRYGRYHLSNQMDQIRDISHC 54
           L+++NGS   K G A  + P           R +  +        ++ ++    R I   
Sbjct: 8   LVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRGI--L 65

Query: 55  HIRRPSELGQLISWELEEQIWDYCLFNPDEFGWELKDS-KDVDLIASETCMTIPEISKNM 113
            +R P E G + +W+  E+IW +  +N      EL+ + ++  ++ +E  M      + M
Sbjct: 66  TLRYPIEHGIVTNWDDMEKIWHHTFYN------ELRVAPEEHPVLLTEAPMNPKNNREKM 119

Query: 114 DQVVFEEYEFGSMMKCPVAQFVPFDRARDYDIVGGAGEVVEAKSGYNNFQLVVDSGFNCT 173
            Q++FE +   +      A    +   R   IV                   +DSG   T
Sbjct: 120 TQILFETFNVPAFYVSIQAVLSLYSSGRTTGIV-------------------LDSGDGVT 160

Query: 174 WVMPVIKGVPYYKATKKLDIGGRFLNGLLKETISFRHYN--VMDETILINNIKEQCCFMP 231
            V+P+  G     A  ++D+ GR +   L + ++ R Y+     E  ++ +IKE+ C++ 
Sbjct: 161 HVVPIYAGFSLPHAILRIDLAGRDITDYLMKILAERGYSFSTTAEREIVRDIKEKLCYVA 220

Query: 232 PVSYFDSFQRKEETRV---EYILPDFQTSLIGYVRQPKQAIPKTSQILRLEDELFTVPET 288
            + +    Q   ++      Y LPD Q   IG                   +E F  PE 
Sbjct: 221 -LDFEQEMQTASQSSAVEKSYELPDGQVITIG-------------------NERFRAPEA 260

Query: 289 FFHPEISNILKPGLVETILECVSMVPEVLRPLLVSNIVAVGGNFNIANFATRLATELQRQ 348
            FHP + ++   G+ +T    +      +R  L  NIV  GG       A R+  E+   
Sbjct: 261 LFHPSVLSLEAAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMFPGIAERMQKEITAL 320

Query: 349 CPTDWKVRVHQPKLDAALQGWKSMRQFSQTDSYKNSRVTRSEYLEHG 395
            P+  KV++  P  +     W      +   +++   +++ EY E G
Sbjct: 321 APSSMKVKIIAPP-ERKYSVWIGGSILASLTTFQQMWISKQEYDESG 366

>Kpol_1058.15 s1058 complement(49082..50199,50349..50358) [1128 bp,
           375 aa] {ON} complement(49082..50199,50349..50358) [1128
           nt, 376 aa]
          Length = 375

 Score = 83.6 bits (205), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 88/407 (21%), Positives = 157/407 (38%), Gaps = 64/407 (15%)

Query: 5   LLMENGSYEIKFGPANLETPY----------RARNCLTRDRYGRYHLSNQMDQIRDISHC 54
           L+++NGS   K G A  + P           R +  +        ++ ++    R I   
Sbjct: 8   LVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRGI--L 65

Query: 55  HIRRPSELGQLISWELEEQIWDYCLFNPDEFGWELKDS-KDVDLIASETCMTIPEISKNM 113
            +R P E G + +W+  E+IW +  +N      EL+ + ++  ++ +E  M      + M
Sbjct: 66  TLRYPIEHGIVTNWDDMEKIWHHTFYN------ELRVAPEEHPVLLTEAPMNPKSNREKM 119

Query: 114 DQVVFEEYEFGSMMKCPVAQFVPFDRARDYDIVGGAGEVVEAKSGYNNFQLVVDSGFNCT 173
            Q++FE +   +      A    +   R   IV                   +DSG   T
Sbjct: 120 TQIMFETFNVPAFYVSIQAVLSLYSSGRTTGIV-------------------LDSGDGVT 160

Query: 174 WVMPVIKGVPYYKATKKLDIGGRFLNGLLKETISFRHYN--VMDETILINNIKEQCCFMP 231
            V+P+  G        ++D+ GR L   L + +S R Y+     E  ++ +IKE+ C++ 
Sbjct: 161 HVVPIYAGFSMPHGILRIDLAGRDLTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYVA 220

Query: 232 PVSYFDSFQRKEETRV---EYILPDFQTSLIGYVRQPKQAIPKTSQILRLEDELFTVPET 288
            + +    Q   ++      Y LPD Q   IG                   +E F  PE 
Sbjct: 221 -LDFEQEMQTAAQSSSIEKSYELPDGQVITIG-------------------NERFRAPEA 260

Query: 289 FFHPEISNILKPGLVETILECVSMVPEVLRPLLVSNIVAVGGNFNIANFATRLATELQRQ 348
            FHP +  +   G+ +T    +      +R  L  NIV  GG       A R+  E+   
Sbjct: 261 LFHPSVLGLESSGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMFPGIAERMQKEITAL 320

Query: 349 CPTDWKVRVHQPKLDAALQGWKSMRQFSQTDSYKNSRVTRSEYLEHG 395
            P+  KV++  P  +     W      +   +++   +++ EY E G
Sbjct: 321 APSSMKVKIIAPP-ERKYSVWIGGSILASLTTFQQMWISKQEYDESG 366

>CAGL0K01595g Chr11 (141618..141639,141971..143124) [1176 bp, 391
           aa] {ON} highly similar to uniprot|P32381 Saccharomyces
           cerevisiae YDL029w ACT2
          Length = 391

 Score = 84.0 bits (206), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 84/331 (25%), Positives = 139/331 (41%), Gaps = 58/331 (17%)

Query: 46  DQIRDI-SHCHIRRPSELGQLISWELEEQIWDYCLFNPDEFGWELKDSKDVDLIASETCM 104
           D+  D+ S+  I  P E G + +W   E +WDY  FN      +L  +    ++ +E  M
Sbjct: 58  DEASDVRSYLQISYPMENGIIKNWTDMELLWDYAFFNQ----MQLPTTSGGKILLTEPPM 113

Query: 105 TIPEISKNMDQVVFEEYEFGSMMKCPVAQFVPFDRARDYDIVGGAGEVVEAKSGYNNFQL 164
              +  + M +V+FE+Y+FG +     A    + +                 SG     +
Sbjct: 114 NPVKNREQMCEVMFEKYDFGGVYVAIQAVLALYAQG--------------LSSG-----V 154

Query: 165 VVDSGFNCTWVMPVIKGVPYYKATKKLDIGGRFLNGLLKETISFRHY--NVMDETILINN 222
           VVDSG   T ++PV + V     T++LD+ GR +   L + +S R Y  N   +   +  
Sbjct: 155 VVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQ 214

Query: 223 IKEQCCFMPPVSYFDS-FQRKEETRVE-YILPDFQTSLIGYVRQPKQAIPKTSQILRLED 280
           IKE+ C++      D+   R+  T VE Y LPD                    +I+++  
Sbjct: 215 IKEKLCYVSYDLDLDTKLARETTTLVENYELPD-------------------GRIIKVGQ 255

Query: 281 ELFTVPETFFHPEISNILKPGLVETILECVSMVPEVLRPLLVSNIVAVGGNFNIANFATR 340
           E F  PE  F P + ++ + G+ E +   +      +R  L   IV  GG+       +R
Sbjct: 256 ERFEAPECLFQPNLVDVEQAGIGELLFNTIQSADVDVRSSLYKAIVLSGGSSMYPGLPSR 315

Query: 341 LATELQR--------QCPT---DWKVRVHQP 360
           L  EL++          PT    +KVR+  P
Sbjct: 316 LEKELKQLWFTRVLNNDPTRLDKFKVRIEDP 346

>Skud_4.222 Chr4 (394174..394195,394321..395474) [1176 bp, 391 aa]
           {ON} YDL029W (REAL)
          Length = 391

 Score = 84.0 bits (206), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 86/359 (23%), Positives = 148/359 (41%), Gaps = 57/359 (15%)

Query: 4   PLLMENGSYEIKFGPANLETP-YRARNCLTRDRYGRYHLSNQMDQIRDI----------S 52
           P++++ G+  +K G A    P Y   + + R        ++    ++DI          S
Sbjct: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVATPLKDIMIGDEASDVRS 65

Query: 53  HCHIRRPSELGQLISWELEEQIWDYCLFNPDEFGWELKDSKDVDLIASETCMTIPEISKN 112
           +  I  P E G + +W   E +WDY  F       +L  + +  ++ +E  M   +  + 
Sbjct: 66  YLQISYPMENGIIKNWTDMELLWDYAFFEQ----MKLPSTSNGKILLTEPPMNPLKNREK 121

Query: 113 MDQVVFEEYEFGSMMKCPVAQFVPFDRARDYDIVGGAGEVVEAKSGYNNFQLVVDSGFNC 172
           M +V+FE+Y+FG +     A    + +                 SG     +VVDSG   
Sbjct: 122 MCEVMFEKYDFGGVYVAIQAVLALYAQG--------------LSSG-----VVVDSGDGV 162

Query: 173 TWVMPVIKGVPYYKATKKLDIGGRFLNGLLKETISFRHY--NVMDETILINNIKEQCCFM 230
           T ++PV + V     T++LD+ GR +   L + +S R Y  N   +   +  IKE+ C++
Sbjct: 163 THIVPVYESVVLSHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYV 222

Query: 231 PPVSYFDSFQRKEETRV--EYILPDFQTSLIGYVRQPKQAIPKTSQILRLEDELFTVPET 288
                 D+   +E T +   Y LPD +T  +G                    E F  PE 
Sbjct: 223 SYDLDLDTKLARETTVLVESYELPDGRTIKVG-------------------QERFEAPEC 263

Query: 289 FFHPEISNILKPGLVETILECVSMVPEVLRPLLVSNIVAVGGNFNIANFATRLATELQR 347
            F P + ++ +PG+ E +   V      +R  L   IV  GG+       +RL  EL++
Sbjct: 264 LFQPGLVDVEQPGVGELLFNTVQSADVDIRSSLYRAIVLSGGSSMYPGLPSRLEKELKQ 322

>Kwal_14.1109 s14 complement(199181..200263) [1083 bp, 360 aa] {ON}
           YFL039C (ACT1) - Actin [contig 244] FULL
          Length = 360

 Score = 82.8 bits (203), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 76/346 (21%), Positives = 136/346 (39%), Gaps = 52/346 (15%)

Query: 56  IRRPSELGQLISWELEEQIWDYCLFNPDEFGWELKDS-KDVDLIASETCMTIPEISKNMD 114
           +R P E G + +W+  E+IW +  +N      EL+ + ++  ++ +E  M      + M 
Sbjct: 52  LRYPIEHGIVTNWDDMEKIWHHTFYN------ELRVAPEEHPVLLTEAPMNPKSNREKMT 105

Query: 115 QVVFEEYEFGSMMKCPVAQFVPFDRARDYDIVGGAGEVVEAKSGYNNFQLVVDSGFNCTW 174
           Q++FE +   +      A    +   R   IV                   +DSG   T 
Sbjct: 106 QILFETFNVPAFYVSIQAVLSLYSSGRTTGIV-------------------LDSGDGVTH 146

Query: 175 VMPVIKGVPYYKATKKLDIGGRFLNGLLKETISFRHYN--VMDETILINNIKEQCCFMPP 232
           V+P+  G        ++D+ GR +   L + +S R Y+     E  ++ +IKE+ C++  
Sbjct: 147 VVPIYAGFSLPHGILRIDLAGRDMTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYVA- 205

Query: 233 VSYFDSFQRKEETRV---EYILPDFQTSLIGYVRQPKQAIPKTSQILRLEDELFTVPETF 289
           + +    Q   ++      Y LPD Q   IG                   +E F  PE  
Sbjct: 206 LDFEQEMQTAAQSSAIEKSYELPDGQVITIG-------------------NERFRAPEAL 246

Query: 290 FHPEISNILKPGLVETILECVSMVPEVLRPLLVSNIVAVGGNFNIANFATRLATELQRQC 349
           FHP +  +   G+ +T    +      +R  L  NIV  GG       A R+  E+    
Sbjct: 247 FHPSLLGLEAAGIDQTAYNSIMKCDVDVRKELYGNIVMSGGTTMFPGIAERMQKEITALA 306

Query: 350 PTDWKVRVHQPKLDAALQGWKSMRQFSQTDSYKNSRVTRSEYLEHG 395
           P+  KV++  P  +     W      +   +++   +++ EY E G
Sbjct: 307 PSSMKVKIIAPP-ERKYSVWIGGSILASLTTFQQMWISKQEYDESG 351

>KLTH0G18832g Chr7 (1626178..1626187,1626854..1627971) [1128 bp, 375
           aa] {ON} highly similar to uniprot|P60010 Saccharomyces
           cerevisiae YFL039C ACT1 Actin structural protein
           involved in cell polarization endocytosis and other
           cytoskeletal functions
          Length = 375

 Score = 83.2 bits (204), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 87/407 (21%), Positives = 157/407 (38%), Gaps = 64/407 (15%)

Query: 5   LLMENGSYEIKFGPANLETPY----------RARNCLTRDRYGRYHLSNQMDQIRDISHC 54
           L+++NGS   K G A  + P           R +  +        ++ ++    R I   
Sbjct: 8   LVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRGI--L 65

Query: 55  HIRRPSELGQLISWELEEQIWDYCLFNPDEFGWELKDS-KDVDLIASETCMTIPEISKNM 113
            +R P E G + +W+  E+IW +  +N      EL+ + ++  ++ +E  M      + M
Sbjct: 66  TLRYPIEHGIVTNWDDMEKIWHHTFYN------ELRVAPEEHPVLLTEAPMNPKSNREKM 119

Query: 114 DQVVFEEYEFGSMMKCPVAQFVPFDRARDYDIVGGAGEVVEAKSGYNNFQLVVDSGFNCT 173
            Q++FE +   +      A    +   R   IV                   +DSG   T
Sbjct: 120 TQILFETFNVPAFYVSIQAVLSLYSSGRTTGIV-------------------LDSGDGVT 160

Query: 174 WVMPVIKGVPYYKATKKLDIGGRFLNGLLKETISFRHYN--VMDETILINNIKEQCCFMP 231
            V+P+  G        ++D+ GR +   L + +S R Y+     E  ++ +IKE+ C++ 
Sbjct: 161 HVVPIYAGFSLPHGILRIDLAGRDMTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYVA 220

Query: 232 PVSYFDSFQRKEETRV---EYILPDFQTSLIGYVRQPKQAIPKTSQILRLEDELFTVPET 288
            + +    Q   ++      Y LPD Q   IG                   +E F  PE 
Sbjct: 221 -LDFEQEMQTAAQSSAIEKSYELPDGQVITIG-------------------NERFRAPEA 260

Query: 289 FFHPEISNILKPGLVETILECVSMVPEVLRPLLVSNIVAVGGNFNIANFATRLATELQRQ 348
            FHP +  +   G+ +T    +      +R  L  NIV  GG       A R+  E+   
Sbjct: 261 LFHPSLLGLEAAGIDQTAYNSIMKCDVDVRKELYGNIVMSGGTTMFPGIAERMQKEITAL 320

Query: 349 CPTDWKVRVHQPKLDAALQGWKSMRQFSQTDSYKNSRVTRSEYLEHG 395
            P+  KV++  P  +     W      +   +++   +++ EY E G
Sbjct: 321 APSSMKVKIIAPP-ERKYSVWIGGSILASLTTFQQMWISKQEYDESG 366

>ADR316W Chr4 (1261691..1262866) [1176 bp, 391 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDL029W (ARP2)
          Length = 391

 Score = 82.8 bits (203), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 91/386 (23%), Positives = 157/386 (40%), Gaps = 74/386 (19%)

Query: 4   PLLMENGSYEIKFGPANLETP-YRARNCLTRDRYGRYHLSNQMDQIRDI----------S 52
           P++++ G+  +K G A    P Y   + + R        +N    ++DI          S
Sbjct: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRADERANVSTPLKDIMIGDEASQVRS 65

Query: 53  HCHIRRPSELGQLISWELEEQIWDYCLFNPDEFGWELKDSKDVDLIASETCMTIPEISKN 112
           +  I  P E G +  W   E +WDY  +       +L  +    ++ +E  M      + 
Sbjct: 66  YLQISYPMENGIIRDWADMELLWDYAFYEQ----MKLPSTSGGKVLLTEPPMNPLRNREQ 121

Query: 113 MDQVVFEEYEFGSMMKCPVAQFVPFDRARDYDIVGGAGEVVEAKSGYNNFQLVVDSGFNC 172
           M +V+FE+Y+FG +                   VG    +     G ++  +VVDSG   
Sbjct: 122 MCEVMFEKYDFGGVY------------------VGIQAVLALYAQGLSS-GVVVDSGDGV 162

Query: 173 TWVMPVIKGVPYYKATKKLDIGGRFLNGLLKETISFRHY--NVMDETILINNIKEQCCFM 230
           T ++PV + V     T++LD+ GR +   L + +S R Y  N   +   +  IKE+ C+ 
Sbjct: 163 THIVPVYESVVLNHLTRRLDVAGRDMTRYLIDLLSRRGYAFNKTADFETVRQIKEKLCY- 221

Query: 231 PPVSY---FDSFQRKEETRV--EYILPDFQTSLIGYVRQPKQAIPKTSQILRLEDELFTV 285
             VSY    D+   +E T +  +Y LPD                    +++++  E F  
Sbjct: 222 --VSYDLDLDTRLAQETTTLVEQYELPD-------------------GRVIKVGSERFEA 260

Query: 286 PETFFHPEISNILKPGLVETILECVSMVPEVLRPLLVSNIVAVGGNFNIANFATRLATEL 345
           PE  F P + ++ +PG+ E +   +      +   L   IV  GG+       +RL  EL
Sbjct: 261 PECLFQPSLVDVEQPGIGEMLFNTIQSADVDIVSTLYKAIVLSGGSSMYPGLPSRLEKEL 320

Query: 346 Q--------RQCPT---DWKVRVHQP 360
           +        +  PT    +KVR+  P
Sbjct: 321 KQLWFTRVLKNDPTRLEKFKVRIEDP 346

>TDEL0D04610 Chr4 complement(846092..847245,847317..847338) [1176
           bp, 391 aa] {ON} Anc_3.161 YDL029W
          Length = 391

 Score = 82.4 bits (202), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 76/307 (24%), Positives = 132/307 (42%), Gaps = 47/307 (15%)

Query: 46  DQIRDI-SHCHIRRPSELGQLISWELEEQIWDYCLFNPDEFGWELKDSKDVDLIASETCM 104
           D+  D+ S+  I  P E G + +W   E +WDY  F+      +L  + +  ++ +E  M
Sbjct: 58  DEASDVRSYLQISYPMENGIIKNWTDMELLWDYAFFDQ----MKLPTTSNGKILLTEPPM 113

Query: 105 TIPEISKNMDQVVFEEYEFGSMMKCPVAQFVPFDRARDYDIVGGAGEVVEAKSGYNNFQL 164
              +  + M +V+FE+Y+FG +     A    + +                 SG     +
Sbjct: 114 NPVKNREQMCEVMFEKYDFGGVYVAIQAVLALYAQG--------------LSSG-----V 154

Query: 165 VVDSGFNCTWVMPVIKGVPYYKATKKLDIGGRFLNGLLKETISFRHY--NVMDETILINN 222
           VVDSG   T ++PV + V     T++LD+ GR +   L + +S R Y  N   +   +  
Sbjct: 155 VVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQ 214

Query: 223 IKEQCCFMPPVSYFDS-FQRKEETRVE-YILPDFQTSLIGYVRQPKQAIPKTSQILRLED 280
           IKE+ C++      D+   R+  T VE Y LPD                    +++++  
Sbjct: 215 IKEKVCYVSYDLDLDTKLARETTTLVENYELPD-------------------GRVIKVGQ 255

Query: 281 ELFTVPETFFHPEISNILKPGLVETILECVSMVPEVLRPLLVSNIVAVGGNFNIANFATR 340
           E F  PE  F P + ++ + G+ E +   +      +R  L   IV  GG+       +R
Sbjct: 256 ERFEAPECLFQPSLVDVEQAGVGELLFNTIQTADVDIRSALYRAIVLSGGSSMYPGLPSR 315

Query: 341 LATELQR 347
           L  EL++
Sbjct: 316 LEKELKQ 322

>KAFR0C01040 Chr3 complement(212570..213583) [1014 bp, 337 aa] {ON} 
          Length = 337

 Score = 81.6 bits (200), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 80/324 (24%), Positives = 135/324 (41%), Gaps = 57/324 (17%)

Query: 52  SHCHIRRPSELGQLISWELEEQIWDYCLFNPDEFGWELKDSKDVDLIASETCMTIPEISK 111
           S+  I  P E G + +W   E +WDY  +       +L D+ +  ++ +E  M   +  +
Sbjct: 11  SYLQISYPMENGIIKNWTDMELLWDYAFYEQ----MKLPDTSNGKILLTEPPMNPIKNRE 66

Query: 112 NMDQVVFEEYEFGSMMKCPVAQFVPFDRARDYDIVGGAGEVVEAKSGYNNFQLVVDSGFN 171
            M +V+FE+Y FG +     A    + +                 SG     +VVDSG  
Sbjct: 67  KMCEVMFEKYNFGGVYVAIQAVLALYAQG--------------LSSG-----VVVDSGDG 107

Query: 172 CTWVMPVIKGVPYYKATKKLDIGGRFLNGLLKETISFRHY--NVMDETILINNIKEQCCF 229
            T ++PV + V     T++LD+ GR +   L + +S R Y  N   +   +  IKE+ C+
Sbjct: 108 VTHIVPVYESVVLNHLTRRLDVAGRDVTRNLIDLLSRRGYAFNRTADFETVRQIKEKLCY 167

Query: 230 MPPVSYFDS-FQRKEETRVE-YILPDFQTSLIGYVRQPKQAIPKTSQILRLEDELFTVPE 287
           +      D+   R+  T VE Y LPD                    +++++  E F  PE
Sbjct: 168 VSYDLDLDTKLARETTTLVESYELPD-------------------GRVIKVGSERFEAPE 208

Query: 288 TFFHPEISNILKPGLVETILECVSMVPEVLRPLLVSNIVAVGGNFNIANFATRLATELQR 347
             F P + ++ + G+ E +   +      +R  L   IV  GG+       +RL  EL++
Sbjct: 209 CLFQPNLVDVEQAGVGELLFNTIQSADVDIRSTLFKAIVLSGGSSMYPGLPSRLEKELKQ 268

Query: 348 --------QCPT---DWKVRVHQP 360
                     PT    +KVR+  P
Sbjct: 269 LWFTRVLHNDPTRLDKFKVRIEDP 292

>Ecym_5237 Chr5 complement(489181..490356) [1176 bp, 391 aa] {ON}
           similar to Ashbya gossypii ADR316W
          Length = 391

 Score = 81.6 bits (200), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 83/360 (23%), Positives = 148/360 (41%), Gaps = 57/360 (15%)

Query: 3   VPLLMENGSYEIKFGPANLETP-YRARNCLTRDRYGRYHLSNQMDQIRDI---------- 51
           VP++++ G+  +K G A    P Y   + + R        SN    ++DI          
Sbjct: 5   VPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAGERSNISTPLKDIMIGDEASNVR 64

Query: 52  SHCHIRRPSELGQLISWELEEQIWDYCLFNPDEFGWELKDSKDVDLIASETCMTIPEISK 111
           S+  I  P E G + +W   EQ+WDY  ++      ++  +    ++ +E  M   +  +
Sbjct: 65  SYLQISYPMENGIIKNWADMEQLWDYAFYDQ----MKIPSTAGHKVLLTEPPMNPLKNRE 120

Query: 112 NMDQVVFEEYEFGSMMKCPVAQFVPFDRARDYDIVGGAGEVVEAKSGYNNFQLVVDSGFN 171
            M +V+FE+Y+FG +     A    + +                 SG     +VVDSG  
Sbjct: 121 QMCEVMFEKYDFGGVYVAIQAVLALYAQG--------------LSSG-----VVVDSGDG 161

Query: 172 CTWVMPVIKGVPYYKATKKLDIGGRFLNGLLKETISFRHY--NVMDETILINNIKEQCCF 229
            T ++PV + V     T++LD+ GR +   L + +S R Y  N   +   +  IKE+ C+
Sbjct: 162 VTHIVPVYESVVLNHLTRRLDVAGRDVTRYLIDLLSRRGYAFNKTADFETVRQIKEKLCY 221

Query: 230 MPPVSYFDSFQRKEETRV--EYILPDFQTSLIGYVRQPKQAIPKTSQILRLEDELFTVPE 287
           +      D+    E T +   Y LPD                    +++++  E F  PE
Sbjct: 222 VSYDLDLDTKLAHETTTLVETYELPD-------------------GRVIKVGSERFEAPE 262

Query: 288 TFFHPEISNILKPGLVETILECVSMVPEVLRPLLVSNIVAVGGNFNIANFATRLATELQR 347
             F P + ++ + G+ E +   +      +   L   IV  GG+       +RL  EL++
Sbjct: 263 CLFQPSLVDVEQQGIGEMLFSTIQSADVDIISALYRAIVLSGGSSMYPGLPSRLEKELKQ 322

>ZYRO0B04928g Chr2 complement(398291..399444,399538..399559) [1176
           bp, 391 aa] {ON} highly similar to uniprot|P32381
           Saccharomyces cerevisiae YDL029W ARP2 Essential
           component of the Arp2/3 complex which is a highly
           conserved actin nucleation center required for the
           motility and integrity of actin patches involved in
           endocytosis and membrane growth and polarity
          Length = 391

 Score = 80.9 bits (198), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 72/300 (24%), Positives = 128/300 (42%), Gaps = 46/300 (15%)

Query: 52  SHCHIRRPSELGQLISWELEEQIWDYCLFNPDEFGWELKDSKDVDLIASETCMTIPEISK 111
           S+  I  P E G + +W+  E +WDY  +N  +F      +    ++ +E  M   +  +
Sbjct: 65  SYLQISYPMENGIIRNWQDMEHLWDYAFYNQMKF----PSTSGGKILLTEPPMNPLKNRE 120

Query: 112 NMDQVVFEEYEFGSMMKCPVAQFVPFDRARDYDIVGGAGEVVEAKSGYNNFQLVVDSGFN 171
            M +V+FE+Y+FG +     A    + +                 SG     +VVDSG  
Sbjct: 121 LMCEVMFEKYDFGGVYVAIQAVLALYAQG--------------LSSG-----VVVDSGDG 161

Query: 172 CTWVMPVIKGVPYYKATKKLDIGGRFLNGLLKETISFRHY--NVMDETILINNIKEQCCF 229
            T ++PV + V     T++LD+ GR +   L + +S R Y  N   +   +  IKE+  +
Sbjct: 162 VTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSY 221

Query: 230 MPPVSYFDSFQRKEETRV--EYILPDFQTSLIGYVRQPKQAIPKTSQILRLEDELFTVPE 287
           +      D+   +E T +   Y LPD                    +++++  E F  PE
Sbjct: 222 VSYDLNLDTKLARETTVLVENYELPD-------------------GRVIKVGQERFEAPE 262

Query: 288 TFFHPEISNILKPGLVETILECVSMVPEVLRPLLVSNIVAVGGNFNIANFATRLATELQR 347
             F P++ ++ +PG+ E +   +      +R  L   IV  GG+       +RL  EL++
Sbjct: 263 CLFQPDLVDVEQPGIGELLFNTIQSADVDIRSSLYRAIVLSGGSSMYPGLPSRLEKELKQ 322

>KNAG0K01130 Chr11 (220520..220541,220822..221981) [1182 bp, 393 aa]
           {ON} 
          Length = 393

 Score = 80.5 bits (197), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 88/361 (24%), Positives = 147/361 (40%), Gaps = 59/361 (16%)

Query: 4   PLLMENGSYEIKFGPANLETPYRARNCLTRDRYGRYHLSNQMDQ---IRDI--------- 51
           P++++ G+  +K G A    P      +      R    + MD    I+DI         
Sbjct: 6   PIVLDQGTGFVKIGRAGENFPDFTFPSIVGRPILRAEERSFMDSKTPIKDIMVGEEASDV 65

Query: 52  -SHCHIRRPSELGQLISWELEEQIWDYCLFNPDEFGWELKDSKDVDLIASETCMTIPEIS 110
            S+  I  P E G +  W   E +WD+  F       +L  +    ++ +E  M   +  
Sbjct: 66  RSYLQISYPMENGIIKHWTDMELLWDHAFFEK----MKLPSTSGGKILLTEPPMNPLKNR 121

Query: 111 KNMDQVVFEEYEFGSMMKCPVAQFVPFDRARDYDIVGGAGEVVEAKSGYNNFQLVVDSGF 170
           + M QV+FE+Y+FG +     A    + +                 SG     +VVDSG 
Sbjct: 122 EMMCQVMFEKYDFGGVYVAIQAVLALYAQG--------------LSSG-----VVVDSGD 162

Query: 171 NCTWVMPVIKGVPYYKATKKLDIGGRFLNGLLKETISFRHY--NVMDETILINNIKEQCC 228
             T ++PV + V     T++LD+ GR +   L + +S R Y  N   +   +  IKE+  
Sbjct: 163 GVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLS 222

Query: 229 FMPPVSYFDS-FQRKEETRVE-YILPDFQTSLIGYVRQPKQAIPKTSQILRLEDELFTVP 286
           ++     FD+   R+  T VE Y LPD                    +I+++  E F  P
Sbjct: 223 YVSYDLDFDTKLARETTTLVENYELPD-------------------GRIIKVGQERFEAP 263

Query: 287 ETFFHPEISNILKPGLVETILECVSMVPEVLRPLLVSNIVAVGGNFNIANFATRLATELQ 346
           E  F P + ++ +PG+ E +   +      +R  L   IV  GG+       +RL  EL+
Sbjct: 264 ECLFQPNLVDVEQPGVGELLFNTIQSADVDIRSSLYKAIVLSGGSSMYPGLPSRLEKELK 323

Query: 347 R 347
           +
Sbjct: 324 Q 324

>Kwal_33.14177 s33 complement(557522..558535) [1014 bp, 337 aa] {ON}
           YDL029W (ARP2) - actin-related protein [contig 105] FULL
          Length = 337

 Score = 79.7 bits (195), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 73/300 (24%), Positives = 127/300 (42%), Gaps = 46/300 (15%)

Query: 52  SHCHIRRPSELGQLISWELEEQIWDYCLFNPDEFGWELKDSKDVDLIASETCMTIPEISK 111
           S+  I  P E G + +W   E +WDY  ++      +L  +    ++ +E  M   +  +
Sbjct: 11  SYLQISYPMENGVIKNWSDMELLWDYAFYDQ----MQLPSTSGGKVMLTEPPMNPVKNRE 66

Query: 112 NMDQVVFEEYEFGSMMKCPVAQFVPFDRARDYDIVGGAGEVVEAKSGYNNFQLVVDSGFN 171
            M +V+FE+Y+FG +     A    + +                 SG     +VVDSG  
Sbjct: 67  QMCEVMFEKYDFGGVYVAIQAVLALYAQG--------------LSSG-----VVVDSGDG 107

Query: 172 CTWVMPVIKGVPYYKATKKLDIGGRFLNGLLKETISFRHY--NVMDETILINNIKEQCCF 229
            T ++PV + V     T++LD+ GR +   L + +S R Y  N   +   +  IKE+  +
Sbjct: 108 VTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSY 167

Query: 230 MPPVSYFDS-FQRKEETRVE-YILPDFQTSLIGYVRQPKQAIPKTSQILRLEDELFTVPE 287
           +      D+   R+  T VE Y LPD                    +++++  E F  PE
Sbjct: 168 VSYDLDLDTKLARETTTLVENYELPD-------------------GRVIKVGSERFEAPE 208

Query: 288 TFFHPEISNILKPGLVETILECVSMVPEVLRPLLVSNIVAVGGNFNIANFATRLATELQR 347
             F P + ++ +PG+ E +   +      +R  L   IV  GG+       +RL  EL++
Sbjct: 209 CLFQPSLVDVEQPGVGEMLFNTIQSADVDVRSALYRAIVLSGGSSMYPGLPSRLEKELKQ 268

>Kpol_479.25 s479 complement(49227..50402) [1176 bp, 391 aa] {ON}
           complement(49227..50402) [1176 nt, 392 aa]
          Length = 391

 Score = 78.6 bits (192), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 82/359 (22%), Positives = 147/359 (40%), Gaps = 57/359 (15%)

Query: 4   PLLMENGSYEIKFGPANLETP-YRARNCLTRDRYGRYHLSNQMDQIRDI----------S 52
           P++++ G+  +K G A    P Y   + + R        ++    ++DI          S
Sbjct: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASISTPLKDIMIGDEASEVRS 65

Query: 53  HCHIRRPSELGQLISWELEEQIWDYCLFNPDEFGWELKDSKDVDLIASETCMTIPEISKN 112
           +  I  P E G + +W   E +WDY  +       +L  +    ++ +E  M   +  + 
Sbjct: 66  YLQISYPMENGIIKNWTDMELLWDYAFYEQ----MKLPSTSGGKVLLTEPPMNPLKNREQ 121

Query: 113 MDQVVFEEYEFGSMMKCPVAQFVPFDRARDYDIVGGAGEVVEAKSGYNNFQLVVDSGFNC 172
           M +V+FE+Y+FG +     A    + +                 SG     +VVDSG   
Sbjct: 122 MCEVMFEKYDFGGVYVAIQAVLALYAQG--------------LSSG-----VVVDSGDGV 162

Query: 173 TWVMPVIKGVPYYKATKKLDIGGRFLNGLLKETISFRHY--NVMDETILINNIKEQCCFM 230
           T ++PV + V     T++LD+ GR +   L + +S R Y  N   +   +  IKE+ C++
Sbjct: 163 THIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYV 222

Query: 231 PPVSYFDSFQRKEETRV--EYILPDFQTSLIGYVRQPKQAIPKTSQILRLEDELFTVPET 288
                 D+   +E T +  +Y LPD                    +I+++  E F  PE 
Sbjct: 223 SYDLDLDTRLARETTTLVEKYELPD-------------------GRIIKVGQERFEAPEC 263

Query: 289 FFHPEISNILKPGLVETILECVSMVPEVLRPLLVSNIVAVGGNFNIANFATRLATELQR 347
            F P + ++   G+ E +   +      +R  L   IV  GG+       +RL  EL++
Sbjct: 264 LFQPNLVDVESAGVGELLFNTIQSADVDVRSSLYKAIVLSGGSSMYPGLPSRLEKELKQ 322

>Kwal_33.14642 s33 (753758..754909) [1152 bp, 383 aa] {ON} YHR129C
           (ARP1) - Centractin [contig 388] FULL
          Length = 383

 Score = 77.8 bits (190), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 94/418 (22%), Positives = 168/418 (40%), Gaps = 63/418 (15%)

Query: 4   PLLMENGSYEIKFGPANLETP----YRARNCLTRDRYGRYHLSNQMDQIRDISH-----C 54
           P++++NGS  IK G +  E P    Y        D+     LS++   + + +       
Sbjct: 11  PVVLDNGSGIIKAGFSGEEKPKCFEYSLIGTPKYDKIMAGGLSSRGQLVGNEAQKQRGLL 70

Query: 55  HIRRPSELGQLISWELEEQIWDYCLFNPDEFGWELKDSKDVDLIASETCMTIPEISKNMD 114
            ++ P E G +  W   EQ+W +  ++      +L +  D  ++ +E  +   E    M 
Sbjct: 71  RLQYPVEHGIVQDWSGLEQLWTHVFYS----SLKLNNIGDHPMLVTEAPLNPLENRDKMC 126

Query: 115 QVVFEEYEFGSMMKCPVAQFVPFDRARDYDIVGGAGEVVEAKSGYNNFQLVVDSGFNCTW 174
           ++++E +          A +V                V+   +G      V+D G  C  
Sbjct: 127 EMLYETFNV-------PAVYVSIQ------------AVLALYAGGRTTGCVIDCGDGCCQ 167

Query: 175 VMPVIKGVPYYKATKKLDIGGR----FLNGLLKETISFRHYNVMDETILINNIKEQCCFM 230
            +PV  G     A +++D+ GR    FL  LL+++I     +  +  I +  IKE+ C++
Sbjct: 168 SVPVYDGFSIPSAIRRIDVAGRDVTEFLQLLLRKSIGVTLLSSSEREI-VRMIKEKACYV 226

Query: 231 PPVSYFD----SFQRKEETRVEYILPDFQTSLIGYVRQPKQAIPKTSQILRLEDELFTVP 286
            P    +    +  R  E   ++ LPD                    +IL L  E F  P
Sbjct: 227 APEVAAEEQKYASSRGSEELTKFKLPD-------------------GKILSLGAEKFRAP 267

Query: 287 ETFFHPEISNILKPGLVETILECVSMVPEVLRPLLVSNIVAVGGNFNIANFATRLATELQ 346
           E  F P++       + +   + +S V   LR  L S++V  GG+   A F  RL  EL+
Sbjct: 268 EILFQPQLIGSEFNSIQDMCFQSISKVDLDLRSSLYSSLVLSGGSTLFAGFGDRLLNELR 327

Query: 347 RQCPTDWKVRVHQPKLDAALQGWKSMRQFSQTDSYKNSRVTRSEYLEHGADWCTKHRF 404
            +C  + K+++  P  +     W      +   +++   VTRSE+ E+    C   RF
Sbjct: 328 SRCEPNVKIKIFAPP-ERKYSVWIGGSILAGLSTFEKIWVTRSEWQEN--PQCVHSRF 382

>KLTH0B05940g Chr2 complement(485135..486286) [1152 bp, 383 aa] {ON}
           similar to uniprot|P38696 Saccharomyces cerevisiae
           YHR129C ARP1 Actin-related protein of the dynactin
           complex required for spindle orientation and nuclear
           migration putative ortholog of mammalian centractin
          Length = 383

 Score = 77.4 bits (189), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 98/426 (23%), Positives = 171/426 (40%), Gaps = 79/426 (18%)

Query: 4   PLLMENGSYEIKFGPANLETPYRARNCLTRDRYG--RYH-------------LSNQMDQI 48
           P++++NGS  IK G +  E P     C      G  +Y+             + N+  ++
Sbjct: 11  PVVLDNGSGIIKAGFSGEEQP----KCFEYSLIGTPKYNKVMAGGLASDSQLIGNEAQKM 66

Query: 49  RDISHCHIRRPSELGQLISWELEEQIWDYCLFNPDEFGWELKDSKDVDLIASETCMTIPE 108
           R +   H   P E G +  W   EQ+W +  +N      +L + ++  ++ +E  +   +
Sbjct: 67  RGLLKLHY--PLEHGVVQDWPGLEQLWTHVFYN----SLKLANIEEHPMLITEAPLNPMK 120

Query: 109 ISKNMDQVVFEEYEFGSMMKCPVAQFVPFDRARDYDIVGGAGEVVEAKSGYNNFQLVVDS 168
               M +++FE   FGS      A +V                V+   +G      V+D 
Sbjct: 121 NRNKMCEMLFET--FGS-----PAVYVSIQ------------AVLALYAGGRTTGCVIDC 161

Query: 169 GFNCTWVMPVIKGVPYYKATKKLDIGGR----FLNGLLKETISFRHYNVMDETILINNIK 224
           G  C   +PV  G     A +++D+ GR    FL  LL+++      +  +  I +  IK
Sbjct: 162 GDGCCQSVPVYDGFTLPSAIQRIDVAGRDITEFLQLLLRKSSGVTLSSSSEREI-VRMIK 220

Query: 225 EQCCFMPP------VSYFDSFQRKEETRVEYILPDFQTSLIGYVRQPKQAIPKTSQILRL 278
           E+ CF+         +Y  +   + ETR  + LPD                    +IL L
Sbjct: 221 EKACFVATDVGNEEQNYEGANSAELETR--FKLPD-------------------GKILTL 259

Query: 279 EDELFTVPETFFHPEISNILKPGLVETILECVSMVPEVLRPLLVSNIVAVGGNFNIANFA 338
             E F  PE  F P +       + E   + +S V   LR  L S+IV  GG+   + F 
Sbjct: 260 GAEKFRAPEVLFQPHLIGSEFCSIQEMCQQSISKVDLDLRSSLYSSIVLSGGSTMFSGFG 319

Query: 339 TRLATELQRQCPTDWKVRVHQPKLDAALQGWKSMRQFSQTDSYKNSRVTRSEYLEHGADW 398
            RL +E+++    + K+++  P  +     W      +   +++   VTR+E+ E+    
Sbjct: 320 DRLLSEIRKTSEPNTKIKIFAPP-ERKYSTWIGGSILAGLSTFEKLWVTRAEWQEN--PQ 376

Query: 399 CTKHRF 404
           C   RF
Sbjct: 377 CIHSRF 382

>NCAS0B07130 Chr2 complement(1354064..1355209) [1146 bp, 381 aa]
           {ON} Anc_2.117
          Length = 381

 Score = 76.6 bits (187), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 91/421 (21%), Positives = 172/421 (40%), Gaps = 69/421 (16%)

Query: 4   PLLMENGSYEIKFGPANLETPY-RARNCLTRDRYGRYHLSNQMDQIRDISH--------- 53
           P++++NGS  IK G +    P     N +   +Y +  L+N +    D+++         
Sbjct: 10  PVVLDNGSSVIKSGFSGQNKPQCFEYNLIGTPKYEKVMLTNAISN-NDLTYIGNRAQKSR 68

Query: 54  --CHIRRPSELGQLISWELEEQIWDYCLFNPDEFGWELKDSKDVDLIASETCMTIPEISK 111
               +R P   G + +W+  E +W +  FN      ++ D  +  L+ +E  +   +   
Sbjct: 69  GLLRLRHPMNRGIVENWDDMETLWSHT-FNDI---LKINDFDEHPLLITEAPLNPEKNRD 124

Query: 112 NMDQVVFEEYEFGSMMKCPVAQFVPFDRARDYDIVGGAGEVVEAKSGYNNFQLVVDSGFN 171
            M +V FE+++F ++     +    +   R        G V++   GY            
Sbjct: 125 KMCEVFFEKFDFAAVYIANPSTLSLYASGRT------TGCVLDCGDGY------------ 166

Query: 172 CTWVMPVIKGVPYYKATKKLDIGGRFLNGLLKETISFRHYNVMD-----ETILINNIKEQ 226
           C+ V P+ +G     + +++D+GGR +   L+  I  R Y  +      E  ++ N+KE+
Sbjct: 167 CSSV-PIYEGFALPSSIRRIDVGGRDVTEQLQFQI--RKYTGISLYSSSEHEIVKNVKEK 223

Query: 227 CCFMPPVSYFD---SFQRKEETRVEYILPDFQTSLIGYVRQPKQAIPKTSQILRLEDELF 283
            C++      D   S    E+ R ++ LPD +  ++   R                   F
Sbjct: 224 ACYVSTDFAHDEDMSNLNPEKIRCQFKLPDGKDLILDKAR-------------------F 264

Query: 284 TVPETFFHPEISNILKPGLVETILECVSMVPEVLRPLLVSNIVAVGGNFNIANFATRLAT 343
             PE  F P+I  +    + +   E +S V   LRP L S+I+  GG+     F  RL  
Sbjct: 265 RAPEILFRPQIMGLEYDSVSDMCFESISKVDLELRPKLFSSIILNGGSTMFRGFGDRLLK 324

Query: 344 ELQRQCPTDWKVRVHQPKLDAALQGWKSMRQFSQTDSYKNSRVTRSEYLEHGADWCTKHR 403
           ELQ +      +++  P  +     W      +   ++K   +T++E+ E   D   ++R
Sbjct: 325 ELQIRTGNKNLIKIIAPP-ERKYTSWIGGSILTGLSTFKQLWMTKAEWQE---DNNLRYR 380

Query: 404 F 404
           F
Sbjct: 381 F 381

>NDAI0B04460 Chr2 complement(1115478..1116623) [1146 bp, 381 aa]
           {ON} Anc_2.117
          Length = 381

 Score = 75.9 bits (185), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 89/413 (21%), Positives = 172/413 (41%), Gaps = 67/413 (16%)

Query: 4   PLLMENGSYEIKFGPANLETPYRARNCLT-RDRYGRYHLSNQMDQ-----------IRDI 51
           P++++NGS  IK G +  + P      LT   +Y +  ++ Q++            IR +
Sbjct: 11  PIVIDNGSCIIKSGFSRQDKPAGFEYNLTGMPKYDKIMITGQLENLDKYIGNRAQSIRGL 70

Query: 52  SHCHIRRPSELGQLISWELEEQIWDYCLFNPDEFGWELKDSKDVDLIASETCMTIPEISK 111
               ++ P   G + +W+  E +W + +FN       +++ ++  L+ +E  +TI +   
Sbjct: 71  --LRLQHPMNRGVVDNWDDMELLW-WHIFNDT---LNVQNIEEHPLLITEAPLTIEKQRH 124

Query: 112 NMDQVVFEEYEFGSMMKCPVAQFVPFDRARDYDIVGGAGEVVEAKSGYNNFQLVVDSGFN 171
            M + +FE +   S+     +                   V+   +  N    VVD G  
Sbjct: 125 IMCERLFETFNIPSLYVANPS-------------------VLSLYASGNTTGCVVDCGDG 165

Query: 172 CTWVMPVIKGVPYYKATKKLDIGGR----FLNGLLKETISFRHYNVMDETILINNIKEQC 227
                P+ +G     + +K+++GGR     L   ++++     Y+  +E  ++  IKE+ 
Sbjct: 166 YCSSTPIYEGFVLPASIRKMEVGGRDITEHLQFQIRKSSGISLYSS-NEKEIVRTIKEKV 224

Query: 228 CFMPPVSYFDSFQRKEETRVEYILPDFQTSLIGYVRQPKQA----IPKTSQILRLEDELF 283
           C++      + F + EE+               Y+RQ + +    +P   + L L  E F
Sbjct: 225 CYIS-----EDFNKSEESY--------------YLRQDEMSCKFKLPDGKE-LTLNKERF 264

Query: 284 TVPETFFHPEISNILKPGLVETILECVSMVPEVLRPLLVSNIVAVGGNFNIANFATRLAT 343
             PE  F+P++  +    +     E +S V   LRP L SNI+  GG+     F +RL  
Sbjct: 265 RSPEVLFNPQLMGLENENVSAMCFESISKVDLELRPKLFSNILLTGGSTLFKGFGSRLLG 324

Query: 344 ELQRQCPTDWKVRVHQPKLDAALQGWKSMRQFSQTDSYKNSRVTRSEYLEHGA 396
           +LQ       K+++  P  +     W      +   ++KN  VT+S++ E   
Sbjct: 325 DLQELTNNRAKIKILAPP-ERKYTSWIGGSILTGLSTFKNLWVTKSDWEESSG 376

>ZYRO0G05676g Chr7 (452257..453402) [1146 bp, 381 aa] {ON} similar
           to uniprot|P38696 Saccharomyces cerevisiae YHR129C ARP1
           Actin-related protein of the dynactin complex required
           for spindle orientation and nuclear migration putative
           ortholog of mammalian centractin
          Length = 381

 Score = 73.9 bits (180), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 85/405 (20%), Positives = 164/405 (40%), Gaps = 60/405 (14%)

Query: 4   PLLMENGSYEIKFGPANLETP-YRARNCLTRDRYGRYHLSNQMDQI------RDISHCHI 56
           P++++NGS  +K G +  + P +   + +   R+G  + S++ D           S   +
Sbjct: 12  PVVLDNGSAILKAGYSGEDRPKFLEHSIVGSPRHGYVNDSSKDDTFVGNLAQERRSILQL 71

Query: 57  RRPSELGQLISWELEEQIWDYCLFNPDEFGWELKDSKDVDLIASETCMTIPEISKNMDQV 116
           R P + G + +W   E IWDY   +      +LKD  +  ++ +E  +        M  +
Sbjct: 72  RHPVDHGVVKNWNDMELIWDYMFKDK----LKLKDVDEHPVLITEAPLNPVSNRDEMCDL 127

Query: 117 VFEEYEFGSMMKCPVAQFVPFDRARDYDIVGGAGEVVEAKSGYNNFQLVVDSGFNCTWVM 176
           +FE +   ++     A    +   +    V   G+                 G++C+  +
Sbjct: 128 LFESFGVQALYVANPAVLSLYASGKISGCVLDCGD-----------------GYSCS--V 168

Query: 177 PVIKGVPYYKATKKLDIGGRFLNGLLKETI---SFRHYNVMDETILINNIKEQCCFMPPV 233
           PV +G     A K++D+GGR L   L+  +   +        E  L+  IKE+ C++   
Sbjct: 169 PVYQGYTLKSAIKRIDLGGRDLTEQLQLQLRKSTGLSLTTSGEMELVRMIKEKSCYV--A 226

Query: 234 SYFDSFQRK-----EETRVEYILPDFQTSLIGYVRQPKQAIPKTSQILRLEDELFTVPET 288
              D  + K     ++  +++ LPD                    + + L  + F VPE 
Sbjct: 227 VDLDIEEEKCNYEGDQVGLKFKLPD-------------------GKFITLSKDRFQVPEI 267

Query: 289 FFHPEISNILKPGLVETILECVSMVPEVLRPLLVSNIVAVGGNFNIANFATRLATELQRQ 348
            F P + +     + E I + VS +   LRP + S+I+  GG   +  F  RL  EL + 
Sbjct: 268 LFQPSVISSEVSSIPEIIWQSVSKLDTDLRPQMWSDILLSGGTTMLKGFGNRLVQELDKL 327

Query: 349 CPTDWKVRVHQPKLDAALQGWKSMRQFSQTDSYKNSRVTRSEYLE 393
                +V++  P  +     W      ++  +++   VT+S++ E
Sbjct: 328 NQAQSRVKIWAPP-ERKYTSWIGGSILAELSTFQKIIVTKSQWQE 371

>ZYRO0G01936g Chr7 complement(144085..145470) [1386 bp, 461 aa] {ON}
           highly similar to uniprot|P47117 Saccharomyces
           cerevisiae YJR065C ARP3 Essential component of the
           Arp2/3 complex which is a highly conserved actin
           nucleation center required for the motility and
           integrity of actin patches involved in endocytosis and
           membrane growth and polarity
          Length = 461

 Score = 74.3 bits (181), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 92/412 (22%), Positives = 171/412 (41%), Gaps = 64/412 (15%)

Query: 9   NGSYEIKFGPANLETPYRARNCLTRDRYGR---YHLSNQMDQIRDISHCHIRRPSELGQL 65
           N +    FG  NL T     N L+  R      +++ N+       ++  +  P   GQ+
Sbjct: 76  NATSTTNFG--NLTTASLMSNNLSGKRGTEDLDFYIGNEALTASQGANYSLNYPIRHGQV 133

Query: 66  ISWELEEQIWDYCLFNPDEFGWELKDSKDVDLIASETCMTIPEISKNMDQVVFEEYEFGS 125
            +W+  E+ W+  +F      +   + +D   + +E  +  PE  + + ++ FE +    
Sbjct: 134 ENWDHMERFWENSIFK-----YLRTEPEDHFFLLTEPPLNPPENREQVAEIFFESFNCAG 188

Query: 126 MMKCPVAQFVPFDRARDYDIVGGAGEVVE-AKSGYNNFQLVVDSGFNCTWVMPVIKGVPY 184
           +       ++             + +VV+ + +G      V+DSG   T V+PV +G   
Sbjct: 189 L-------YIAVQAVLALAASWTSSKVVDRSLTG-----TVIDSGDGVTHVIPVAEGYVI 236

Query: 185 YKATKKLDIGGRFLNGLLKETISFRHYNVMDETI-LINNIKEQCCFMPP--VSYFDSFQR 241
             A K + I GR +   ++  +  R    +D ++     IK++ C++ P  V  F+ F R
Sbjct: 237 GSALKNIPIAGRDITQFIQSLL--RERGEVDTSLRTAERIKQEYCYVCPDIVKEFNKFDR 294

Query: 242 KEETRVEYILPDFQTSLIGYVRQPKQAIPKTSQILRLEDELFTVPETFFHPEI--SNILK 299
             E   +Y++ +   +     RQ         +++ +  E F  PE FF+PEI  S+ L 
Sbjct: 295 DAEKFAQYVVENQDKT-----RQ---------KVVDIGYERFLAPEIFFNPEIASSDFLT 340

Query: 300 PGLVETILECVSMVPEVLRPLLVSNIVAVGGNFNIANFATRLATELQ------------- 346
           P L   + + +   P  +R  L +NIV  GG+    +F  RL  +L+             
Sbjct: 341 P-LPTVLDQTIQACPIDVRKGLYNNIVLSGGSTMFKDFGRRLQRDLKSIVNNRIAETERL 399

Query: 347 ---RQCPTDWKVRVHQPKLDAALQGWKSMRQFSQTDSYKNSRVTRSEYLEHG 395
              R    D +V  H+ + +A    W      +QT  +K    T+ +Y E+G
Sbjct: 400 SGARSTGVDVQVISHRKQRNAV---WFGGSLLAQTPEFKGYCHTKKDYEEYG 448

>KLLA0B13904g Chr2 complement(1218228..1219598) [1371 bp, 456 aa]
           {ON} highly similar to uniprot|P47117 Saccharomyces
           cerevisiae YJR065C ARP3 Essential component of the
           Arp2/3 complex which is a highly conserved actin
           nucleation center required for the motility and
           integrity of actin patches involved in endocytosis and
           membrane growth and polarity
          Length = 456

 Score = 73.2 bits (178), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 86/369 (23%), Positives = 148/369 (40%), Gaps = 75/369 (20%)

Query: 59  PSELGQLISWELEEQIWDYCLFNPDEFGWELKDSKDVDLIASETCMTIPEISKNMDQVVF 118
           P   GQ+ +W+  E+ W+  +F      +   + +D   + +E  +  PE  + + ++ F
Sbjct: 122 PIRHGQVENWDHMERFWENSIFK-----YLRTEPEDHFFLLTEPPLNPPENRQQVAEIFF 176

Query: 119 EEYEFGSMMKCPVAQFVPF-----DRARDYDIVGGAGEVVEAKSGYNNFQLVVDSGFNCT 173
           E +    +     A           +  D  + G                 V+DSG   T
Sbjct: 177 ESFNCAGLYIAVQAVLALAASWTSSKVTDRSLTG----------------TVIDSGDGVT 220

Query: 174 WVMPVIKGVPYYKATKKLDIGGR----FLNGLLKETISFRHYNVMDETI-LINNIKEQCC 228
            V+PV +G     A K + I GR    F+  LL+E          D ++     IK++ C
Sbjct: 221 HVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLLRER------GEQDASLRTAERIKQEYC 274

Query: 229 FMPP--VSYFDSFQRKEETRVEYILPDFQTSLIGYVRQPKQAIPKTSQILRLEDELFTVP 286
           ++ P  V  F+ F R  E   ++I+ + + +              T +++ +  E F  P
Sbjct: 275 YVCPDIVKEFNKFDRDSEKFAQFIVENKERT--------------TKKVVDVGYERFLAP 320

Query: 287 ETFFHPEI--SNILKPGLVETILECVSMVPEVLRPLLVSNIVAVGGNFNIANFATRLATE 344
           E FF+PEI  S+ L P L   + E +   P  +R  L +NIV  GG+    +F  RL  +
Sbjct: 321 EIFFNPEIASSDFLTP-LPVVVDETIQACPIDVRKGLYNNIVLSGGSTMFKDFGRRLQRD 379

Query: 345 LQ----------------RQCPTDWKVRVHQPKLDAALQGWKSMRQFSQTDSYKNSRVTR 388
           L+                R    D  V  H+ + +A    W      +QT  +K+   T+
Sbjct: 380 LKGIVNDRISQSEKLSGTRSTGVDVSVISHKRQRNAV---WFGGSLLAQTGEFKSYCHTK 436

Query: 389 SEYLEHGAD 397
            +Y E+G D
Sbjct: 437 QDYEEYGPD 445

>TPHA0A00920 Chr1 (181205..182380) [1176 bp, 391 aa] {ON} Anc_2.117
           YHR129C
          Length = 391

 Score = 72.4 bits (176), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 82/371 (22%), Positives = 148/371 (39%), Gaps = 65/371 (17%)

Query: 4   PLLMENGSYEIKFGPANLETPYR------ARNCLTRDRYGRYHL-------SNQMDQIRD 50
           P++++ G+  +K G A    P         R  L  +  G  ++         +   +R 
Sbjct: 6   PIVLDQGTGFVKIGRAGENFPDHTFPSIVGRPILRAEERGNLNIPLKDVMIGEEASAVR- 64

Query: 51  ISHCHIRRPSELGQLISWELEEQIWDYCLFNPDEFGWELKDSKDVDLIASETCMTIPEIS 110
            S+  I  P E G + +W   E +WDY  +       +L  +    ++ +E  +   +  
Sbjct: 65  -SYLQISYPMENGIIKNWTDMELLWDYAFYEQ----MKLPSTSGGKVLLTEPPLNPLKNR 119

Query: 111 KNMDQVVFEEYEFGSMMKCPVAQFVPFDRARDYDIVGGAGEVVEAKSGYNNFQLVVDSGF 170
           + M +V+FE+Y+FG +     A    + +                 SG     +V+DSG 
Sbjct: 120 EKMCEVMFEKYDFGGVYVAIQAVLALYAQG--------------LSSG-----VVIDSGD 160

Query: 171 NCTWVMPVIKGVPYYKATKKLDIGGRFLNGLLKETISFRHY--NVMDETILINNIKEQCC 228
             T ++PV + V     T++LD+ GR +   L + +S R Y  N   +   +  IKE+ C
Sbjct: 161 GVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLC 220

Query: 229 FMPPVSYFDS-FQRKEETRVE-YILPDFQTSLIGYVRQPKQAIPKTSQILRLEDELFTVP 286
           ++      D+   R+  T VE Y LPD                    +++++  E F   
Sbjct: 221 YVSYDLELDTKLARETTTLVENYELPD-------------------GRVIKVGQERFEAA 261

Query: 287 ETFFHPEISNILKPGLVETILECVSMVPEVLRPLLVSNIVAVGGNFNIANFATRLATELQ 346
           E  F P + ++   G+ E +   +      +R  L   IV  GG+       +R+  EL+
Sbjct: 262 ECLFQPNLVDVESAGVGELLFNTIQSADIDVRSSLYKAIVLSGGSSMYPGLPSRIEKELK 321

Query: 347 RQCPTDWKVRV 357
           +     W  RV
Sbjct: 322 QL----WYTRV 328

>TBLA0B01070 Chr2 (236811..237962) [1152 bp, 383 aa] {ON} Anc_2.117
           YHR129C
          Length = 383

 Score = 71.6 bits (174), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 97/419 (23%), Positives = 167/419 (39%), Gaps = 91/419 (21%)

Query: 4   PLLMENGSYEIKFG------PANLE-----TPYRARNCLTRDRYGRYHLSNQMDQIRDIS 52
           P++++NGS  +K G      P   E     TP   +  +     G++ + N   + R + 
Sbjct: 13  PIVLDNGSALLKAGFGGDDKPKCFEYSLIGTPKYDKVMVGGVEKGKF-VGNLAQEYRGL- 70

Query: 53  HCHIRRPSELGQLISWELEEQIWDY----CLFNPDEFGWELKDSKDVDLIASETCMTIPE 108
              +R P + G + +WE  E +WD+    CL        ++ +  +  L+ +E  +    
Sbjct: 71  -LKLRYPMDHGIIENWEHMETVWDHIFKDCL--------KVSNLGEHPLVVTEAPLNPKP 121

Query: 109 ISKNMDQVVFEEYEFGSMMKCPVAQFVPFDRARDYDIVGGAGEVVEAKSGYNNFQLVVDS 168
             + M + +FE +   ++     A    +   R        G VVEA  GY         
Sbjct: 122 NREKMCETLFESFNIPALYIANPAVLSLYASGRT------TGCVVEAGDGY--------- 166

Query: 169 GFNCTWVMPVIKGVPYYKATKKLDIGGR----FLNGLLKETISFRHYNVMDETILINNIK 224
              C+ V P+ +G     + +++DIGGR     L   L+++     Y+  ++ I +  IK
Sbjct: 167 ---CSSV-PIYEGFALTPSIRRIDIGGRDITKHLQLQLRKSTGMWLYSSSEQEI-VRLIK 221

Query: 225 EQCCFMPPVSYFDSFQRKEETR---------VEYILPDFQTSLIGYVRQPKQAIPKTSQI 275
           E  C      Y  S  +KEE +         + + LPD +  +IG  R            
Sbjct: 222 ENGC------YICSNHKKEEEKFLLDQEKKSISFKLPDGKNLVIGPGR------------ 263

Query: 276 LRLEDELFTVPETFFHPEISNILKPGLVETILECVSMVPEVLRPLLVSNIVAVGGNFNIA 335
                  F  PE  F+P +       L + I++ +S V   LR  L++NI   GG+    
Sbjct: 264 -------FRAPEILFNPLLIGSEDSSLPDMIMQSISKVDIDLRSKLLNNITLSGGSTMFQ 316

Query: 336 NFATRLATELQRQCPTDWKVRVHQP---KLDAALQGWKSMRQFSQTDSYKNSRVTRSEY 391
            F  RL TEL        KVR+  P   K  A + G       +   +++N  VT+ ++
Sbjct: 317 GFCDRLITELDFSVDKTTKVRILAPPERKYSAFIGG----SILANLSTFRNMWVTKDQW 371

>TPHA0O01040 Chr15 (196178..197554) [1377 bp, 458 aa] {ON} Anc_1.514
           YJR065C
          Length = 458

 Score = 72.0 bits (175), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 84/363 (23%), Positives = 153/363 (42%), Gaps = 67/363 (18%)

Query: 59  PSELGQLISWELEEQIWDYCLFNPDEFGWELKDSKDVDLIASETCMTIPEISKNMDQVVF 118
           P   GQ+ +W+  E+ W+  +F      +   + +D   + +E  +  PE  + + ++ F
Sbjct: 124 PIRHGQVENWDHMERFWENSIFK-----YLRAEPEDHFFLLTEPPLNPPENREQVAEIFF 178

Query: 119 EEYEFGSMMKCPVAQFVPFDRARDYDIVGGAGEVVE-AKSGYNNFQLVVDSGFNCTWVMP 177
           E +    +       ++             + +V + + +G      V+DSG   T V+P
Sbjct: 179 ESFNCAGL-------YIAVQAVLALAASWTSAQVTDRSLTG-----TVIDSGDGVTHVIP 226

Query: 178 VIKGVPYYKATKKLDIGGR----FLNGLLKETISFRHYNVMDETI-LINNIKEQCCFMPP 232
           V +G     A K + I GR    F+  LL+E          D ++     IK++ C++ P
Sbjct: 227 VAEGYVVGSAIKNIPIAGRDITLFIQSLLRER------GEADSSLKTAERIKQEYCYVCP 280

Query: 233 --VSYFDSFQRKEETRVEYILPDFQTSLIGYVRQPKQAIPKTSQILRLEDELFTVPETFF 290
             V  F+ F R+ E   ++I+ +          Q K     T +++ +  E F  PE FF
Sbjct: 281 DIVKEFNKFDRQPEKFAQFIIEN----------QDK----TTKKVIDIGYERFLAPEIFF 326

Query: 291 HPEI--SNILKPGLVETILECVSMVPEVLRPLLVSNIVAVGGNFNIANFATRLATELQ-- 346
           +PEI  S+ L P L   + + +   P  +R  L +NIV  GG+    +F+ RL  +++  
Sbjct: 327 NPEIASSDFLTP-LPTVVDQTIQACPIDVRKGLYNNIVLSGGSTMFKDFSRRLQRDVKSI 385

Query: 347 --------------RQCPTDWKVRVHQPKLDAALQGWKSMRQFSQTDSYKNSRVTRSEYL 392
                         +    D +V  H+ + +A    W      +QT  +K    T+ +Y 
Sbjct: 386 VSNRIAQNEALTGTKSTGVDVQVISHRKQRNAV---WFGGSLLAQTAEFKGYCHTKKDYE 442

Query: 393 EHG 395
           EHG
Sbjct: 443 EHG 445

>TDEL0B04810 Chr2 (849529..850650) [1122 bp, 373 aa] {ON} Anc_2.117
           YHR129C
          Length = 373

 Score = 70.9 bits (172), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 88/405 (21%), Positives = 154/405 (38%), Gaps = 57/405 (14%)

Query: 4   PLLMENGSYEIKFGPANLETPYRARNCLTRD-RYGRY---------HLSNQMDQIRDISH 53
           P++++NGS  +K G    E P      L  D  Y +           + N+  ++R +  
Sbjct: 11  PVVIDNGSAVVKAGFCGEEKPRCMEYSLIGDANYNKIMVGGLECDSFVGNKAQRLRGL-- 68

Query: 54  CHIRRPSELGQLISWELEEQIWDYCLFNPDEFGWELKDSKDVDLIASETCMTIPEISKNM 113
             ++ P E G +  W+  E +W + LF+      +L    +  L+ +E  +      + M
Sbjct: 69  LKLKHPMERGVVSDWDDMELLWSHILFD----SLQLTSGMEHPLLITEAPLNPESNKEKM 124

Query: 114 DQVVFEEYEFGSMMKCPVAQFVPFDRARDYDIVGGAGEVVEAKSGYNNFQLVVDSGFNCT 173
            +V FE +   ++          +   R        G VV+   GY            C+
Sbjct: 125 LEVFFETFNIPAICVSIPGVLSLYASGRT------TGCVVDCGEGY------------CS 166

Query: 174 WVMPVIKGVPYYKATKKLDIGG----RFLNGLLKETISFRHYNVMDETILINNIKEQCCF 229
            V PV +G     + K++++GG    + L   L++      ++   E  L+  +KE+ C 
Sbjct: 167 SV-PVCEGYTLASSIKRINLGGIDVTKQLQFQLRKESGVWLFSS-GERELVRTMKEKSC- 223

Query: 230 MPPVSYFDSFQRKEETRVEYILPDFQTSLIGYVRQPKQAIPKTSQILRLEDELFTVPETF 289
                Y    Q K+E +  +      T+           +P    +L L    F  PE  
Sbjct: 224 -----YVSLNQLKDEEKFTFEPGKMNTNF---------KLPD-GNMLTLSKSRFRAPEIL 268

Query: 290 FHPEISNILKPGLVETILECVSMVPEVLRPLLVSNIVAVGGNFNIANFATRLATELQRQC 349
           F P+I    +P L E  L+ +  V   LRP L+S I   GG      F  R   ELQ   
Sbjct: 269 FQPQIIASEEPSLPEMCLQSILSVDVELRPRLMSRITLSGGTTMFRGFGDRFLQELQIST 328

Query: 350 PTDWKVRVHQPKLDAALQGWKSMRQFSQTDSYKNSRVTRSEYLEH 394
                +R+  P  +     W      +   +++    T+S++ EH
Sbjct: 329 CKKSNIRILAPP-ERKYTAWIGGSMLAGLTTFRKMLTTKSDWREH 372

>YHR129C Chr8 complement(362999..364153) [1155 bp, 384 aa] {ON}
           ARP1Actin-related protein of the dynactin complex;
           required for spindle orientation and nuclear migration;
           putative ortholog of mammalian centractin
          Length = 384

 Score = 70.5 bits (171), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 83/404 (20%), Positives = 166/404 (41%), Gaps = 57/404 (14%)

Query: 4   PLLMENGSYEIKFGPANLETPYRARNCLTRD-RY---------GRYHLSNQMDQIRDISH 53
           P++++NGS  IK G +  E P     CL  + +Y         G   + N   ++R +  
Sbjct: 14  PVVIDNGSGIIKAGFSGEERPKALEYCLVGNTKYDKVMLEGLQGDTFIGNNAQKLRGL-- 71

Query: 54  CHIRRPSELGQLISWELEEQIWDYCLFNPDEFGWELKDSKDVDLIASETCMTIPEISKNM 113
             +R P + G +  W+  E IW Y L        +L++  +  L+ +E  M   +  + M
Sbjct: 72  LKLRYPIKHGVVEDWDSMELIWSYVLNEV----LQLQNIGEHPLLITEAPMNPLKNREQM 127

Query: 114 DQVVFEEYEFGSMMKCPVAQFVPFDRARDYDIVGGAGEVVEAKSGYNNFQLVVDSGFNCT 173
            QV+FE ++  ++     A    +   R        G VV+   GY            C+
Sbjct: 128 AQVLFETFDVSALYVSNPAVLSLYASGRT------TGCVVDCGEGY------------CS 169

Query: 174 WVMPVIKGVPYYKATKKLDIGG----RFLNGLLKETISFRHYNVMDETILINNIKEQCCF 229
            V P+  G     +  ++DIGG      L   L+++     ++  +  I +  +KE+ C+
Sbjct: 170 TV-PIYDGFALPASMMRMDIGGADITEQLQFQLRKSAGVSLFSSSEREI-VRTMKEKVCY 227

Query: 230 MPPVSYFDSFQRKEETRVEYILPDFQTSLIGYVRQPKQAIPKTSQILRLEDELFTVPETF 289
           +       + +++EE  ++         LI   + P        + + + ++ +  PE  
Sbjct: 228 LAK-----NIKKEEEKYLQ-----GTQDLISTFKLPD------GRCIEVGNDRYRAPEIL 271

Query: 290 FHPEISNILKPGLVETILECVSMVPEVLRPLLVSNIVAVGGNFNIANFATRLATELQRQC 349
           F P+I  +   GL +  ++ +  V   LR  L+S+I+  GG   +  F  R+  +L+   
Sbjct: 272 FSPQIIGLGYDGLSDMCMQSIWKVDLDLRKPLLSSIILSGGTTTLKGFGDRMLWDLEALT 331

Query: 350 PTDWKVRVHQPKLDAALQGWKSMRQFSQTDSYKNSRVTRSEYLE 393
               K+++  P  +     W      +   +++     +S++LE
Sbjct: 332 KGTSKIKIIAPS-ERKYTTWIGGSILTGLSTFQRLWTKKSDWLE 374

>CAGL0H09042g Chr8 (884592..885755) [1164 bp, 387 aa] {ON} similar
           to uniprot|P38696 Saccharomyces cerevisiae YHR129c ACT5
          Length = 387

 Score = 70.5 bits (171), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 81/373 (21%), Positives = 149/373 (39%), Gaps = 59/373 (15%)

Query: 4   PLLMENGSYEIKFGPAN-----------LETPYRARNCLTRDRYGRYHLSNQMDQIRDIS 52
           P++++NGS  IK G A            +  P   R+ +T      Y + N   + R  +
Sbjct: 12  PVILDNGSSVIKAGFAGSQQPDVLEYAWIGNPLAERSMVTVSNKETY-IGNSAYERR--A 68

Query: 53  HCHIRRPSELGQLISWELEEQIWDYCLFNPDEFGWELKDSKDVDLIASETCMTIPEISKN 112
             H+  P     ++SW+  E +WDY L N      E++  ++  ++ + +  T  +  + 
Sbjct: 69  TLHLESPYSTNAIMSWDRLEDLWDYVLLNK----LEIEQLQEHPVVLTNSMSTSKKEEEK 124

Query: 113 MDQVVFEEYEFGSM--MKCPVAQFVPFDRARDYDIVGGAGEVVEAKSGYNNFQLVVDSGF 170
           M +V+FE++   ++   + P+       R                          V  G 
Sbjct: 125 MCEVLFEKFSIPAIYCSRDPIMSLYGLGRTTGCS---------------------VSCGH 163

Query: 171 NCTWVMPVIKGVPYYKATKKLDIGGRFLNGLLKETISFRH---YNVMDETILINNIKEQC 227
               +  VI G+    +++  + GG  +   + + +   H    N  +   LI +IKE+C
Sbjct: 164 RGIGITTVIDGMIVGGSSQISNTGGSAVTNTMLDLLRHNHPKLENGQNGIELIRSIKERC 223

Query: 228 CFMPPVSYFDSFQRKEETRVEYILPDFQTSLIGYVRQPKQAIPKTSQILRLEDELFTVPE 287
           C +    Y        E R  Y L   +TS   Y R P         I+ +  E F  PE
Sbjct: 224 CVLSKDFY-------NEIRA-YELITSKTSNNKY-RLPD------GNIIEIGSERFEAPE 268

Query: 288 TFFHPEISNILKPGLVETILECVSMVPEVLRPLLVSNIVAVGGNFNIANFATRLATELQR 347
             F+P+     +  L + I+  +S    + R  L+ +IV  GG+  I  F  RL  E+++
Sbjct: 269 IIFNPQAYGYSEIPLQKMIINSISRAGILPRSQLLESIVLSGGSSLIKGFGERLTKEIRK 328

Query: 348 QCPTDWKVRVHQP 360
           +   + K+ ++ P
Sbjct: 329 EIDGNQKIMLNAP 341

>KNAG0B00170 Chr2 (18478..19839) [1362 bp, 453 aa] {ON} Anc_1.514
           YJR065C
          Length = 453

 Score = 68.2 bits (165), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 79/359 (22%), Positives = 150/359 (41%), Gaps = 59/359 (16%)

Query: 59  PSELGQLISWELEEQIWDYCLFNPDEFGWELKDSKDVDLIASETCMTIPEISKNMDQVVF 118
           P   GQ+ +W+  E+ W+  +F      +   + +D   + +E  +  PE  + + ++ F
Sbjct: 119 PIRHGQVENWDHMERFWENSIFK-----YLRTEPEDHFFLLTEPPLNPPENREQIAEIFF 173

Query: 119 EEYEFGSMMKCPVAQFVPFDRARDYDIVGGAGEVVE-AKSGYNNFQLVVDSGFNCTWVMP 177
           E +    +       ++             + +VV+ + +G      V+DSG   T V+P
Sbjct: 174 ESFNCAGL-------YIAVQAVLALAASWTSSKVVDRSLTG-----TVIDSGDGVTHVIP 221

Query: 178 VIKGVPYYKATKKLDIGGRFLNGLLKETISFRHYNVMDETI-LINNIKEQCCFMPP--VS 234
           V +G     A K + I GR +   ++  +  R     D ++     IK++ C++ P  V 
Sbjct: 222 VAEGYVIGSAIKNIPIAGRDITQFIQTLL--RERGEADTSLRTAERIKQEYCYVCPDIVK 279

Query: 235 YFDSFQRKEETRVEYILPDFQTSLIGYVRQPKQAIPKTSQILRLEDELFTVPETFFHPEI 294
            F+ F R  E   +Y++ + + +                +++ +  E F  PE FF+PEI
Sbjct: 280 EFNKFDRDPEKFAQYVVENQEKT--------------QKKVVDVGYERFLAPEIFFNPEI 325

Query: 295 --SNILKPGLVETILECVSMVPEVLRPLLVSNIVAVGGNFNIANFATRLATELQ------ 346
             S+ L P L   + + +   P  +R  L +NIV  GG+    +F  RL  +L+      
Sbjct: 326 ASSDFLTP-LPTIVDQTIQACPIDVRKGLYNNIVLSGGSTMFKDFGRRLQRDLKSIVNNR 384

Query: 347 ----------RQCPTDWKVRVHQPKLDAALQGWKSMRQFSQTDSYKNSRVTRSEYLEHG 395
                     +    D  V  H+ + +A    W      +QT  +K+   T+ +Y E+G
Sbjct: 385 IAQNELLSGTKSTGVDVSVISHRKQRNAV---WFGGSLLAQTAEFKSYCHTKKDYEEYG 440

>TPHA0I01300 Chr9 (295950..297089) [1140 bp, 379 aa] {ON} Anc_2.117
           YHR129C
          Length = 379

 Score = 67.8 bits (164), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 74/380 (19%), Positives = 154/380 (40%), Gaps = 80/380 (21%)

Query: 4   PLLMENGSYEIKFGPANLETPYRARNCLTRDRYG--------------RYHLSNQMDQIR 49
           P++++NG+  +K G    + P     C   +  G                ++ N+  + R
Sbjct: 10  PVVIDNGTGVLKVGFVGDDKP----KCFQHNIVGTPKFDKVMIGGLDDNMYIGNKAQENR 65

Query: 50  DISHCHIRRPSELGQLISWELEEQIWDYCLFNPDEFGWELKDSKDVDLIASETCMTIPEI 109
            +    +R P E G++  W+  E +W + L +       ++  ++  ++ +E  +   + 
Sbjct: 66  GL--LRLRHPMEHGEVKHWDEMEAVWKHTLLHD----LNIQHIEEHPILITEAPLNSSKN 119

Query: 110 SKNMDQVVFEEYEFGSMMKCPVAQFVPFDRARDYDIVGGAGEVVEAKSGYNNFQLVVDSG 169
            ++M +++FE +   ++     A    +   R        G V++   GY          
Sbjct: 120 REHMCEILFESFNIPAIHVENPAVLALYSGGRT------TGCVIDCGEGY---------- 163

Query: 170 FNCTWVMPVIKGVPYYKATKKLDIGGRFLNGLL----KETISFRHYNVMDETILINNIKE 225
             C+ V P+ +G     + +++DIGGR +   L    ++++    ++  +E  ++  IKE
Sbjct: 164 --CSAV-PIYEGFALTPSIRRIDIGGREITEQLQFQIRKSVGMSLFS-SNEKEIVRTIKE 219

Query: 226 QCCFMPPVSYFDSFQRKEETRV--------EYILPDFQTSLIGYVRQPKQAIPKTSQILR 277
           + C++      D   ++E   +        ++ LPD ++  IG VR              
Sbjct: 220 RACYVA-----DDISKEEHKYILDSESNSSKFKLPDGKSLSIGNVR-------------- 260

Query: 278 LEDELFTVPETFFHPEISNILKPGLVETILECVSMVPEVLRPLLVSNIVAVGGNFNIANF 337
                F   E  F+P +       + E + + +S V   LRP+L  ++V  GG   +  F
Sbjct: 261 -----FRATELLFNPRLIGCESDSVPEIVFQTLSRVDIDLRPMLYKSLVLNGGTTVLPGF 315

Query: 338 ATRLATELQRQCPTDWKVRV 357
             R+  ELQ     D K+R+
Sbjct: 316 GNRILKELQILTKQDTKLRI 335

>KNAG0I01860 Chr9 (364390..366651) [2262 bp, 753 aa] {ON} Anc_2.248
           YNL059C
          Length = 753

 Score = 68.2 bits (165), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 43/138 (31%), Positives = 64/138 (46%), Gaps = 9/138 (6%)

Query: 276 LRLEDELFTVPETFFHPEISNILKPGLVE----TILECVSMVPEVLRPL---LVSNIVAV 328
           L L  E   VPE  F P I+   + G+ E     +L+     P  L      +V+N+   
Sbjct: 608 LHLNTERIRVPEILFEPSIAGQDQAGIAELCETILLKKFGSKPGNLSAASSRMVNNVWIT 667

Query: 329 GGNFNIANFATRLATELQRQCPTDWKVRVHQPKLDAALQGWKSMRQFSQTDS-YKNSRVT 387
           GGN  I     R+  E     P    + VH  + D +L  WK M + +  ++ YKN+ VT
Sbjct: 668 GGNARIPGIKNRIVKEFTEFLPAGTPLSVHMSE-DPSLDAWKGMAKLANNETDYKNTAVT 726

Query: 388 RSEYLEHGADWCTKHRFG 405
           R EY E+G D+  +H+ G
Sbjct: 727 RKEYEEYGPDYIKEHKLG 744

>Kpol_1056.16 s1056 (36274..37656) [1383 bp, 460 aa] {ON}
           (36274..37656) [1383 nt, 461 aa]
          Length = 460

 Score = 67.4 bits (163), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 83/366 (22%), Positives = 153/366 (41%), Gaps = 69/366 (18%)

Query: 59  PSELGQLISWELEEQIWDYCLFNPDEFGWELKDSKDVDLIASETCMTIPEISKNMDQVVF 118
           P   GQ+ +W+  E+ W+  +F      +   + +D   + +E  +  PE  + + ++ F
Sbjct: 126 PIRHGQIENWDHMERFWENSIFK-----YLRAEPEDHFFLLTEPPLNPPENREQVAEIFF 180

Query: 119 EEYEFGSMMKCPVAQFVPFDRARDYDIVGGAGEVVE-AKSGYNNFQLVVDSGFNCTWVMP 177
           E +    +       ++             + +V + + +G      V+DSG   T V+P
Sbjct: 181 ESFNCAGL-------YIAVQAVLALAASWTSSQVTDRSLTG-----TVIDSGDGVTHVIP 228

Query: 178 VIKGVPYYKATKKLDIGGR----FLNGLLKETISFRHYNVMDETI-LINNIKEQCCFMPP 232
           V +G     A K + I GR    F+  LL+E          D ++     IK++ C++ P
Sbjct: 229 VAEGYVIGSAIKNIPIAGRDITLFIQSLLRER------GEADTSLRTAERIKQEYCYVCP 282

Query: 233 --VSYFDSFQRKEETRVEYILPDFQTSLIGYVRQPKQAIPKTSQ-ILRLEDELFTVPETF 289
             V  F+ F R+ E   ++I+ +                 KT Q ++ +  E F  PE F
Sbjct: 283 DIVKEFNKFDRQPEKFAQFIIENQD---------------KTKQKVVDIGYERFLAPEIF 327

Query: 290 FHPEI--SNILKPGLVETILECVSMVPEVLRPLLVSNIVAVGGNFNIANFATRLATELQ- 346
           F+PEI  S+ L P L   +   +   P  +R  L +NIV  GG+    +F+ RL  +++ 
Sbjct: 328 FNPEIASSDFLTP-LPTVVDHTIQACPIDVRKGLYNNIVLSGGSTMFKDFSRRLQRDIKS 386

Query: 347 ---------------RQCPTDWKVRVHQPKLDAALQGWKSMRQFSQTDSYKNSRVTRSEY 391
                          +    D +V  H+ + +A    W      +QT  +K+   T+ +Y
Sbjct: 387 IVNSRIIQNEAVTGVKSTGVDVQVISHRKQRNAV---WFGGSLLAQTAEFKSYCHTKKDY 443

Query: 392 LEHGAD 397
            E+G +
Sbjct: 444 EEYGPE 449

>SAKL0D12804g Chr4 complement(1066058..1067428) [1371 bp, 456 aa]
           {ON} highly similar to uniprot|P47117 Saccharomyces
           cerevisiae YJR065C ARP3 Essential component of the
           Arp2/3 complex which is a highly conserved actin
           nucleation center required for the motility and
           integrity of actin patches involved in endocytosis and
           membrane growth and polarity
          Length = 456

 Score = 67.0 bits (162), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 82/366 (22%), Positives = 145/366 (39%), Gaps = 73/366 (19%)

Query: 59  PSELGQLISWELEEQIWDYCLFNPDEFGWELKDSKDVDLIASETCMTIPEISKNMDQVVF 118
           P   GQ+ +W+  E+ W+  +F      +   + +D   + +E  +  PE  + + ++ F
Sbjct: 122 PIRHGQVENWDHMERFWENSIFK-----YLRTEPEDHFFLLTEPPLNPPENREQVAEIFF 176

Query: 119 EEYEFGSMMKCPVAQFVPF-----DRARDYDIVGGAGEVVEAKSGYNNFQLVVDSGFNCT 173
           E +    +     A           +  D  + G                 V+DSG   T
Sbjct: 177 ESFNCAGLYIAVQAVLALAASWTSSKVTDRSLTG----------------TVIDSGDGVT 220

Query: 174 WVMPVIKGVPYYKATKKLDIGGR----FLNGLLKETISFRHYNVMDETILINNIKEQCCF 229
            V+PV +G     A K + I GR    F+  LL+E        V         IK++ C+
Sbjct: 221 HVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLLRE-----RGEVDTSLRTAERIKQEYCY 275

Query: 230 MPP--VSYFDSFQRKEETRVEYILPDFQTSLIGYVRQPKQAIPKTSQILRLEDELFTVPE 287
           + P  V  F+ F R      ++I+ + +++                +I+ +  E F  PE
Sbjct: 276 VCPDIVKEFNKFDRDAGKFAQFIVENSEST--------------KKKIVDVGYERFLAPE 321

Query: 288 TFFHPEI--SNILKPGLVETILECVSMVPEVLRPLLVSNIVAVGGNFNIANFATRLATEL 345
            FF+PEI  S+ L P L   + + +   P  +R  L +NIV  GG+    +F  RL  +L
Sbjct: 322 IFFNPEIASSDFLTP-LPTVVDQTIQACPIDVRKGLYNNIVLSGGSTMFKDFGRRLQRDL 380

Query: 346 Q----------------RQCPTDWKVRVHQPKLDAALQGWKSMRQFSQTDSYKNSRVTRS 389
           +                +    D +V  H+ + +A    W      +QT  +K+   T+ 
Sbjct: 381 KSIVNNRIAQSELLSGTKSTGVDVQVISHRRQRNAV---WFGGSLLAQTAEFKSYCHTKQ 437

Query: 390 EYLEHG 395
           +Y E+G
Sbjct: 438 DYEEYG 443

>NCAS0A12270 Chr1 complement(2428834..2430198) [1365 bp, 454 aa]
           {ON} Anc_1.514
          Length = 454

 Score = 66.2 bits (160), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 81/367 (22%), Positives = 147/367 (40%), Gaps = 75/367 (20%)

Query: 59  PSELGQLISWELEEQIWDYCLFNPDEFGWELKDSKDVDLIASETCMTIPEISKNMDQVVF 118
           P   GQ+ +W+  E+ W+  +F      +   + +D   + +E  +  PE  + + ++ F
Sbjct: 120 PIRHGQVENWDHMERFWENSIFK-----YLRTEPEDHFFLLTEPPLNPPENREQIAEIFF 174

Query: 119 EEYEFGSMMKCPVAQFVPF-----DRARDYDIVGGAGEVVEAKSGYNNFQLVVDSGFNCT 173
           E +    +     A           +  D  + G                 V+DSG   T
Sbjct: 175 ESFNCAGLYIAVQAVLALAASWTSSKVTDRSLTG----------------TVIDSGDGVT 218

Query: 174 WVMPVIKGVPYYKATKKLDIGGR----FLNGLLKETISFRHYNVMDETI-LINNIKEQCC 228
            V+PV +G     A K + I GR    F+  LL+E          D ++     IK++ C
Sbjct: 219 HVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLLRER------GEADTSLRTAERIKQEYC 272

Query: 229 FMPP--VSYFDSFQRKEETRVEYILPDFQTSLIGYVRQPKQAIPKTSQILRLEDELFTVP 286
           ++ P  V  F+ F R  E   ++++ + +++                +I+ +  E F  P
Sbjct: 273 YVCPDIVKEFNKFDRDGEKFAQFVVENQEST--------------RKKIVDVGYERFLAP 318

Query: 287 ETFFHPEI--SNILKPGLVETILECVSMVPEVLRPLLVSNIVAVGGNFNIANFATRLATE 344
           E FF+PEI  S+ L P L   + + +   P  +R  L +NIV  GG+    +F  RL  +
Sbjct: 319 EIFFNPEIASSDFLTP-LPTVVDQTIQACPIDVRKGLYNNIVLSGGSTMFKDFGRRLQRD 377

Query: 345 LQ----------------RQCPTDWKVRVHQPKLDAALQGWKSMRQFSQTDSYKNSRVTR 388
           L+                +    + +V  H+ + +A    W      +QT  +K    T+
Sbjct: 378 LKGIVNNRIAQSEMLSGTKSTGVNVQVISHRKQRNAV---WFGGSLLAQTAEFKGYCHTK 434

Query: 389 SEYLEHG 395
            +Y E+G
Sbjct: 435 KDYDEYG 441

>Skud_8.190 Chr8 complement(336365..337519) [1155 bp, 384 aa] {ON}
           YHR129C (REAL)
          Length = 384

 Score = 65.5 bits (158), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 85/404 (21%), Positives = 161/404 (39%), Gaps = 57/404 (14%)

Query: 4   PLLMENGSYEIKFGPANLETP----------YRARNCLTRDRYGRYHLSNQMDQIRDISH 53
           P++++NGS  IK G +  E P           +    +     G   + N+  ++R +  
Sbjct: 14  PIVIDNGSGIIKVGFSGEERPKALEYSLVGHVKYEKVMLEGLQGDTFVGNKAQKLRGL-- 71

Query: 54  CHIRRPSELGQLISWELEEQIWDYCLFNPDEFGWELKDSKDVDLIASETCMTIPEISKNM 113
             +R P   G +  W+  E IW Y L   +E   +L++ ++  L+ +E  M   +  + M
Sbjct: 72  LRLRYPMTHGVVEDWDSMELIWSYML---NEV-LQLQNIEEHPLLITEAPMNPLKNREVM 127

Query: 114 DQVVFEEYEFGSMMKCPVAQFVPFDRARDYDIVGGAGEVVEAKSGYNNFQLVVDSGFNCT 173
            QV+FE +   ++     A    +   R        G VV+   GY            C+
Sbjct: 128 AQVLFETFNLPALYISNPAVLSLYASGRT------TGCVVDCGEGY------------CS 169

Query: 174 WVMPVIKGVPYYKATKKLDIGGR----FLNGLLKETISFRHYNVMDETILINNIKEQCCF 229
            V P+  G     +  ++DIGGR     L   L+++     ++   E  ++  IKE+ C 
Sbjct: 170 TV-PIYDGFALPASIMRMDIGGRDITEQLQFQLRKSAGISLFSS-SELEVVRMIKEKVC- 226

Query: 230 MPPVSYFDSFQRKEETRVEYILPDFQTSLIGYVRQPKQAIPKTSQILRLEDELFTVPETF 289
                Y     +KEE R      D  +            +P   + + + ++ +  PE  
Sbjct: 227 -----YLAKNIKKEEDRYLQGHHDLGSVF---------KLPD-GKCIEIGNDRYRAPEIL 271

Query: 290 FHPEISNILKPGLVETILECVSMVPEVLRPLLVSNIVAVGGNFNIANFATRLATELQRQC 349
           F P+I      GL +  ++ +  V   LR  L+S+I+  GG   +  F  R+  +L+   
Sbjct: 272 FSPQIIGSGYDGLSDMCMQSIWKVDLDLRKTLLSSIILSGGTTTLRGFGERMLHDLEALS 331

Query: 350 PTDWKVRVHQPKLDAALQGWKSMRQFSQTDSYKNSRVTRSEYLE 393
               K+++  P  +     W      +   +++     +S++LE
Sbjct: 332 KGTCKIKIIAPP-ERKYTTWVGGSILTGLSTFQKLWTKKSDWLE 374

>KAFR0D03700 Chr4 complement(718438..719787) [1350 bp, 449 aa] {ON}
           Anc_1.514 YJR065C
          Length = 449

 Score = 65.5 bits (158), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 81/369 (21%), Positives = 146/369 (39%), Gaps = 75/369 (20%)

Query: 59  PSELGQLISWELEEQIWDYCLFNPDEFGWELKDSKDVDLIASETCMTIPEISKNMDQVVF 118
           P   GQ+ +W+  E+ W+  +F      +   + +D   + +E  +  PE  + + ++ F
Sbjct: 115 PIRHGQIENWDHMERFWENSIFK-----YLRTEPEDHFFLLTEPPLNPPENREQVAEIFF 169

Query: 119 EEYEFGSMMKCPVAQFVPF-----DRARDYDIVGGAGEVVEAKSGYNNFQLVVDSGFNCT 173
           E +    +     A           +  D  + G                 V+DSG   T
Sbjct: 170 ESFNCAGLYIAVQAVLALAASWTSSKVTDRSLTG----------------TVIDSGDGVT 213

Query: 174 WVMPVIKGVPYYKATKKLDIGGR----FLNGLLKETISFRHYNVMDETI-LINNIKEQCC 228
            V+PV +G     A K + I GR    F+  LL+E          D ++     IK++ C
Sbjct: 214 HVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLLRER------GETDTSLRTAERIKQEYC 267

Query: 229 FMPP--VSYFDSFQRKEETRVEYILPDFQTSLIGYVRQPKQAIPKTSQILRLEDELFTVP 286
           ++ P  V  F+ F R  +   ++I+ + + +                +I+ +  E F  P
Sbjct: 268 YVCPDIVKEFNKFDRNPDKFAQFIVENQEKT--------------QKKIVDVGYERFLAP 313

Query: 287 ETFFHPEI--SNILKPGLVETILECVSMVPEVLRPLLVSNIVAVGGNFNIANFATRLATE 344
           E FF+PEI  S+ L P L   +   +   P  +R  L +NIV  GG+    +F  RL  +
Sbjct: 314 EIFFNPEIASSDFLTP-LPTIVDHTIQACPIDVRKGLYNNIVLSGGSTMFKDFGRRLQRD 372

Query: 345 LQ----------------RQCPTDWKVRVHQPKLDAALQGWKSMRQFSQTDSYKNSRVTR 388
           ++                +    D  V  H+ + +A    W      +QT  +K+   T+
Sbjct: 373 IKSIVNNRIAQSELLSGTKSTGVDVNVITHRKQRNAV---WFGGSLLAQTAEFKSYCHTK 429

Query: 389 SEYLEHGAD 397
            +Y E+G +
Sbjct: 430 KDYEEYGPE 438

>TBLA0D03680 Chr4 (914687..916063) [1377 bp, 458 aa] {ON} Anc_1.514
           YJR065C
          Length = 458

 Score = 65.1 bits (157), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 78/334 (23%), Positives = 144/334 (43%), Gaps = 49/334 (14%)

Query: 59  PSELGQLISWELEEQIWDYCLFNPDEFGWELKDSKDVDLIASETCMTIPEISKNMDQVVF 118
           P   GQ+ +W+  E+ W+  +F      +   + +D   + +E  +  PE  + + ++ F
Sbjct: 124 PIRHGQVENWDHMERFWENSIFK-----YLRTEPEDHYFLLTEPPLNPPENREQVAEIFF 178

Query: 119 EEYEFGSMMKCPVAQFVPFDRARDYDIVGGAGEVVE-AKSGYNNFQLVVDSGFNCTWVMP 177
           E +    +       ++             + +V++ + +G      V+DSG   T V+P
Sbjct: 179 ESFNCAGL-------YIAVQAVLALAASWTSSKVIDRSLTG-----TVIDSGDGVTHVIP 226

Query: 178 VIKGVPYYKATKKLDIGGRFLNGLLKETISFRHYNVMDETI-LINNIKEQCCFMPP--VS 234
           V +G     A K + I GR +   ++  +  R     D ++     IK++ C++ P  V 
Sbjct: 227 VAEGYVIGSAIKNIPIAGRDITEFIQSLL--RERGEADTSLRTAERIKQEYCYVCPDIVK 284

Query: 235 YFDSFQRKEETRVEYILPDFQTSLIGYVRQPKQAIPKTSQ-ILRLEDELFTVPETFFHPE 293
            F+ F R+ E   ++I+               ++  KT Q ++ +  E F  PE FF+PE
Sbjct: 285 EFNKFDRQPEKFAQFIV---------------ESQEKTKQKVVDVGYERFLAPEIFFNPE 329

Query: 294 I--SNILKPGLVETILECVSMVPEVLRPLLVSNIVAVGGNFNIANFATRLATELQRQCPT 351
           I  S+ L P L   + + +   P  +R  L +NIV  GG+    +F+ R    LQR   +
Sbjct: 330 IASSDYLTP-LPTVVDQTIQACPIDVRKGLYNNIVLSGGSTMFKDFSRR----LQRDMKS 384

Query: 352 DWKVRVHQPKLDAALQGWKSMRQFSQTDSYKNSR 385
               R+ Q   +  + G KS     Q  S++  R
Sbjct: 385 IVNARISQ---NEKMTGVKSSGVDVQVISHRKQR 415

>CAGL0F00517g Chr6 (54743..56107) [1365 bp, 454 aa] {ON} highly
           similar to uniprot|P47117 Saccharomyces cerevisiae
           YJR065c ACT4 actin related protein
          Length = 454

 Score = 65.1 bits (157), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 81/384 (21%), Positives = 153/384 (39%), Gaps = 69/384 (17%)

Query: 39  YHLSNQMDQIRDISHCHIRRPSELGQLISWELEEQIWDYCLFNPDEFGWELKDSKDVDLI 98
           +++ N+           +  P   GQ+ +W+  E+ W+  +F      +   + +D   +
Sbjct: 100 FYIGNEALAAAQGQSYSLSYPIRHGQVENWDHMERFWENSIFK-----YLRTEPEDHFFL 154

Query: 99  ASETCMTIPEISKNMDQVVFEEYEFGSMMKCPVAQFVPFD-----RARDYDIVGGAGEVV 153
            +E  +  PE  + + ++ FE +    +     A           +  D  + G      
Sbjct: 155 LTEPPLNPPENREQVAEIFFESFNCAGLYIAVQAVLALAASWTSPKVTDRSLTG------ 208

Query: 154 EAKSGYNNFQLVVDSGFNCTWVMPVIKGVPYYKATKKLDIGGRFLNGLLKETISFRHYNV 213
                      V+DSG   T V+PV +G     A K + I GR +   +++ +  R    
Sbjct: 209 ----------TVIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQQLL--RERGE 256

Query: 214 MDETI-LINNIKEQCCFMPP--VSYFDSFQRKEETRVEYILPDFQTSLIGYVRQPKQAIP 270
            D ++     IK++ C++ P  V  F+ F R      ++++               ++  
Sbjct: 257 QDTSLKTAERIKQEYCYVCPDIVKEFNKFDRDASKFAQFVV---------------ESQE 301

Query: 271 KT-SQILRLEDELFTVPETFFHPEI--SNILKPGLVETILECVSMVPEVLRPLLVSNIVA 327
           KT  +I+ +  E F  PE FF+PEI  S+ L P L   + E +   P  +R  L +NIV 
Sbjct: 302 KTRKKIVDVGYERFLAPEIFFNPEIASSDFLTP-LPTVVDETIQACPIDVRKGLYNNIVL 360

Query: 328 VGGNFNIANFATRLATELQ----------------RQCPTDWKVRVHQPKLDAALQGWKS 371
            GG+    +F  RL  +++                +    D +V  H+ + +A    W  
Sbjct: 361 SGGSTMFKDFGRRLQRDMKSIVNNRIAQSEALSGTKSTGVDVQVISHRKQRNAV---WFG 417

Query: 372 MRQFSQTDSYKNSRVTRSEYLEHG 395
               +QT  +K+   T+ +Y E+G
Sbjct: 418 GSLLAQTAEFKSYCHTKKDYDEYG 441

>NDAI0A03970 Chr1 (895219..896607) [1389 bp, 462 aa] {ON} Anc_1.514
          Length = 462

 Score = 64.7 bits (156), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 81/368 (22%), Positives = 144/368 (39%), Gaps = 73/368 (19%)

Query: 59  PSELGQLISWELEEQIWDYCLFNPDEFGWELKDSKDVDLIASETCMTIPEISKNMDQVVF 118
           P   GQ+ +W+  E+ W+  +F      +   + +D   + +E  +  PE  + + ++ F
Sbjct: 128 PIRHGQVENWDHMERFWENSIFK-----YLRTEPEDHFFLLTEPPLNPPENREQIAEIFF 182

Query: 119 EEYEFGSMMKCPVAQFVPF-----DRARDYDIVGGAGEVVEAKSGYNNFQLVVDSGFNCT 173
           E +    +     A           +  D  + G                 V+DSG   T
Sbjct: 183 ESFNCAGLYIAVQAVLALAASWTSSKVTDRSLTG----------------TVIDSGDGVT 226

Query: 174 WVMPVIKGVPYYKATKKLDIGGR----FLNGLLKETISFRHYNVMDETILINNIKEQCCF 229
            V+PV +G     A K + I GR    F+  LL+E        V         IK++ C+
Sbjct: 227 HVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLLRE-----RGEVDTSLKTAERIKQEYCY 281

Query: 230 MPP--VSYFDSFQRKEETRVEYILPDFQTSLIGYVRQPKQAIPKTSQILRLEDELFTVPE 287
           + P  V  F+ F R      ++I+ + + +                +++ +  E F  PE
Sbjct: 282 VCPDIVKEFNKFDRDGSKFAQFIVENQEQT--------------RKKVVDVGYERFLAPE 327

Query: 288 TFFHPEI--SNILKPGLVETILECVSMVPEVLRPLLVSNIVAVGGNFNIANFATRLATEL 345
            FF+PEI  S+ L P L   +   +   P  +R  L +NIV  GG+    +F  RL  +L
Sbjct: 328 IFFNPEIASSDFLTP-LPTVVDHTIQACPIDVRKGLYNNIVLSGGSTMFKDFGRRLQRDL 386

Query: 346 Q----------------RQCPTDWKVRVHQPKLDAALQGWKSMRQFSQTDSYKNSRVTRS 389
           +                +    D +V  H+ + +A    W      +QT  +K+   T+ 
Sbjct: 387 KSIVSNRIAQSERLSGTKSTGVDVQVISHRKQRNAV---WFGGSLLAQTAEFKSYCHTKK 443

Query: 390 EYLEHGAD 397
           +Y E+G +
Sbjct: 444 DYEEYGPE 451

>KNAG0H03650 Chr8 complement(678598..679761) [1164 bp, 387 aa] {ON}
           Anc_2.117 YHR129C
          Length = 387

 Score = 64.3 bits (155), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 86/407 (21%), Positives = 164/407 (40%), Gaps = 59/407 (14%)

Query: 4   PLLMENGSYEIKFGPANLETPY----------RARNCLTRDRYGRYHLSNQMDQIRDISH 53
           P++++NGS  +K G +  ETP           R +  +T     R  + N+  ++R    
Sbjct: 13  PVVLDNGSAILKAGFSGDETPAILEYTMAGKPRYKKVMTTGLEDRTFVGNEAQRLR--GL 70

Query: 54  CHIRRPSELGQLISWELEEQIWDYCLFNPDEFGWELKDSKDVDLIASETCMTIPEISKNM 113
             +RRP   G++ +W+  E +W +  ++  + G       D  L+ +E  +   +  + M
Sbjct: 71  LALRRPISRGEVTNWDDMELLWSHIFYSKLQLGQGNSQIGDHPLLITEAPLNSTKNRETM 130

Query: 114 DQVVFEEYEFGSMMKCPVAQFVPFDRARDYDIVGGAGEVVEAKSGYNNFQLVVDSGFNCT 173
            ++++E + F ++     A    +   +        G V+E   GY+             
Sbjct: 131 CEILYETFNFDALYVAHPAVLSLYATGQT------TGCVLECGEGYSA------------ 172

Query: 174 WVMPVIKGVPYYKATKKLDIGGR----FLNGLLKETISFRHYNVMDETILINNIKEQCCF 229
              PV +G     + +++DIGGR     L   ++++     ++  ++ I +  IKE+  +
Sbjct: 173 -STPVYQGFALPSSIRRIDIGGRDITQELQFYIRKSTGLSLFSNSEQEI-VRTIKEKANY 230

Query: 230 MPPVSYFDS---FQRKEETRVEYILPDFQTSLIGYVRQPKQAIPKTSQILRLEDELFTVP 286
           +     F+    F  + E      LPD Q    G      +   +TS+IL          
Sbjct: 231 VALDYKFEEEKFFIHERENTSTVKLPDGQELTFG------KGKYRTSEIL---------- 274

Query: 287 ETFFHPEISNILKPGLVETILECVSMVPEVLRPLLVSNIVAVGGNFNIANFATRLATELQ 346
              F P++       + E +LE ++ V   LR  L+ NIV  GG   +  F  R  +E +
Sbjct: 275 ---FQPQLIGSECVSVPEMLLESINKVDMDLRTQLLENIVLSGGTTMLKGFDQRTMSETK 331

Query: 347 RQCPTDWKVRVHQPKLDAALQGWKSMRQFSQTDSYKNSRVTRSEYLE 393
           +  P   KV++     + +   W      S    ++N  +TR  Y E
Sbjct: 332 KMLPKHTKVKIRSLA-ERSYIAWIGGSILSGLYGFRNLWLTREMYEE 377

>Smik_8.210 Chr8 complement(339093..340247) [1155 bp, 384 aa] {ON}
           YHR129C (REAL)
          Length = 384

 Score = 64.3 bits (155), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 83/407 (20%), Positives = 162/407 (39%), Gaps = 63/407 (15%)

Query: 4   PLLMENGSYEIKFGPANLETPYRARNCLT-RDRY---------GRYHLSNQMDQIRDISH 53
           P++++NGS  IK G +  E P      L    +Y         G   + N+  ++R +  
Sbjct: 14  PIVIDNGSGIIKAGFSGEERPKALEYSLVGHTKYDKVMLEGLQGDTFVGNKAQKLRGL-- 71

Query: 54  CHIRRPSELGQLISWELEEQIWDYCLFNPDEFGWELKDSKDVDLIASETCMTIPEISKNM 113
             +R P + G +  W+  E IW Y L        +L++ ++  L+ +E  M   +  + +
Sbjct: 72  LRLRYPMKHGVVEDWDSMELIWSYVLNEV----LQLQNIEEHPLLITEAPMNPLKNREMI 127

Query: 114 DQVVFEEYEFGSMMKCPVAQFVPFDRARDYDIVGGAGEVVEAKSGYNNFQLVVDSGFNCT 173
            QV+FE +   ++     A    +   R        G VV+   GY            C+
Sbjct: 128 AQVMFETFNLSAIYVSDPAVLSLYASGRT------TGCVVDCGEGY------------CS 169

Query: 174 WVMPVIKGVPYYKATKKLDIGGRFLNGLLKETISFRHYNVMDETI-------LINNIKEQ 226
            V P+  G     +  ++DIGG    G + E + F+       ++       ++  IKE+
Sbjct: 170 SV-PIYDGFALPASIMRMDIGG----GDITEQLQFQIRKSAGVSLFSSSEREIVRTIKEK 224

Query: 227 CCFMPPVSYFDSFQRKEETRVEYILPDFQTSLIGYVRQPKQAIPKTSQILRLEDELFTVP 286
            C++   +      +KEE +      D    LI   + P        + + + ++ +  P
Sbjct: 225 VCYLAKDA------KKEEDKYLQGTQD----LISAFKLPD------GKSIEVGNDRYRAP 268

Query: 287 ETFFHPEISNILKPGLVETILECVSMVPEVLRPLLVSNIVAVGGNFNIANFATRLATELQ 346
           E  F P+I      GL    ++ +  V   LR  L+S+++  GG   +  F  R+  +L+
Sbjct: 269 EILFSPQIIGSGYDGLSNMCMQSIWKVDLDLRKNLLSSVILSGGTTTLKGFGDRMLHDLE 328

Query: 347 RQCPTDWKVRVHQPKLDAALQGWKSMRQFSQTDSYKNSRVTRSEYLE 393
                  K+++  P  +     W      +   +++     +S++LE
Sbjct: 329 ALTKGTSKIKIIAPP-ERKYTAWIGGSILTGLSTFQKLWTKKSDWLE 374

>Ecym_3153 Chr3 (288213..289589) [1377 bp, 458 aa] {ON} similar to
           Ashbya gossypii AFR419C
          Length = 458

 Score = 64.3 bits (155), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 85/366 (23%), Positives = 143/366 (39%), Gaps = 73/366 (19%)

Query: 59  PSELGQLISWELEEQIWDYCLFNPDEFGWELKDSKDVDLIASETCMTIPEISKNMDQVVF 118
           P + GQ+ +W   E+ W+  +F      +   + +D   + +E  +  PE  + + ++ F
Sbjct: 124 PIKHGQVENWNHMERFWENSIFK-----YLRTEPEDHFFLLTEPPLNPPENREQVAEIFF 178

Query: 119 EEYEFGSMMKCPVAQFVPF-----DRARDYDIVGGAGEVVEAKSGYNNFQLVVDSGFNCT 173
           E +    +     A           +  D  + G                 V+DSG   T
Sbjct: 179 ESFNCAGLYIAVQAVLALAASWTSSKVTDRSLTG----------------TVIDSGDGVT 222

Query: 174 WVMPVIKGVPYYKATKKLDIGGR----FLNGLLKETISFRHYNVMDETILINNIKEQCCF 229
            V+PV +G     A K + I GR    F+  LL+E        V         IK++ C+
Sbjct: 223 HVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLLRE-----RGEVDTSLKTAERIKQEYCY 277

Query: 230 MPP--VSYFDSFQRKEETRVEYILPDFQTSLIGYVRQPKQAIPKTSQILRLEDELFTVPE 287
           + P  V  F+ F R      ++I+ +          Q K       +I+ +  E F  PE
Sbjct: 278 VCPDIVKEFNKFDRDVGKFSQFIIEN----------QGK----TQKKIVDVGYERFLAPE 323

Query: 288 TFFHPEI--SNILKPGLVETILECVSMVPEVLRPLLVSNIVAVGGNFNIANFATRLATEL 345
            FF+PEI  S+ L P L   +   +   P  +R  L SNIV  GG+    +F  RL  +L
Sbjct: 324 IFFNPEIASSDFLTP-LPTIVDHTIQACPIDVRKGLYSNIVLSGGSTMFKDFGRRLQRDL 382

Query: 346 Q----------------RQCPTDWKVRVHQPKLDAALQGWKSMRQFSQTDSYKNSRVTRS 389
           +                +    D +V  H+ + +A    W      +QT  +K+   T+ 
Sbjct: 383 RSIVNDRIAQSELLSGTKSTGVDVQVISHRRQRNAV---WFGGSLLAQTAEFKSYCHTKR 439

Query: 390 EYLEHG 395
           +Y E+G
Sbjct: 440 DYEEYG 445

>Smik_10.355 Chr10 complement(546673..548022) [1350 bp, 449 aa] {ON}
           YJR065C (REAL)
          Length = 449

 Score = 63.9 bits (154), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 80/367 (21%), Positives = 144/367 (39%), Gaps = 75/367 (20%)

Query: 59  PSELGQLISWELEEQIWDYCLFNPDEFGWELKDSKDVDLIASETCMTIPEISKNMDQVVF 118
           P   GQ+ +W+  E+ W+  +F      +   + +D   + +E  +  PE  + + ++ F
Sbjct: 115 PIRHGQVENWDHMERFWENSIFK-----YLRTEPEDHFFLLTEPPLNPPENREQVAEIFF 169

Query: 119 EEYEFGSMMKCPVAQFVPF-----DRARDYDIVGGAGEVVEAKSGYNNFQLVVDSGFNCT 173
           E +    +     A           +  D  + G                 V+DSG   T
Sbjct: 170 ESFNCAGLYIAVQAVLALAASWTSSKVTDRSLTG----------------TVIDSGDGVT 213

Query: 174 WVMPVIKGVPYYKATKKLDIGGR----FLNGLLKETISFRHYNVMDETI-LINNIKEQCC 228
            V+PV +G     A K + I GR    F+  LL+E          D ++     IK++ C
Sbjct: 214 HVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLLRER------GEADTSLRTAEKIKQEYC 267

Query: 229 FMPP--VSYFDSFQRKEETRVEYILPDFQTSLIGYVRQPKQAIPKTSQILRLEDELFTVP 286
           ++ P  V  F+ F R      ++++ + + +                +++ +  E F  P
Sbjct: 268 YVCPDIVKEFNKFDRDPSKFAQFVVENQEKT--------------RRKVVDIGYERFLAP 313

Query: 287 ETFFHPEI--SNILKPGLVETILECVSMVPEVLRPLLVSNIVAVGGNFNIANFATRLATE 344
           E FF+PEI  S+ L P L   + + +   P  +R  L +NIV  GG+    +F  RL  +
Sbjct: 314 EIFFNPEIASSDFLTP-LPTVVDQTIQACPIDVRKGLYNNIVLSGGSTMFKDFGRRLQRD 372

Query: 345 LQ----------------RQCPTDWKVRVHQPKLDAALQGWKSMRQFSQTDSYKNSRVTR 388
           L+                +    D  V  H+ + +A    W      +QT  +K    T+
Sbjct: 373 LKSIVNNRIAQSELLSGTKSTGVDVSVISHRKQRNAV---WFGGSLLAQTAEFKGYCHTK 429

Query: 389 SEYLEHG 395
            +Y E+G
Sbjct: 430 KDYEEYG 436

>Skud_10.289 Chr10 complement(515300..516649) [1350 bp, 449 aa] {ON}
           YJR065C (REAL)
          Length = 449

 Score = 63.5 bits (153), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 80/367 (21%), Positives = 144/367 (39%), Gaps = 75/367 (20%)

Query: 59  PSELGQLISWELEEQIWDYCLFNPDEFGWELKDSKDVDLIASETCMTIPEISKNMDQVVF 118
           P   GQ+ +W+  E+ W+  +F      +   + +D   + +E  +  PE  + + ++ F
Sbjct: 115 PIRHGQVENWDHMERFWENSIFK-----YLRTEPEDHFFLLTEPPLNPPENREQVAEIFF 169

Query: 119 EEYEFGSMMKCPVAQFVPF-----DRARDYDIVGGAGEVVEAKSGYNNFQLVVDSGFNCT 173
           E +    +     A           +  D  + G                 V+DSG   T
Sbjct: 170 ESFNCAGLYIAVQAVLALAASWTSSKVTDRSLTG----------------TVIDSGDGVT 213

Query: 174 WVMPVIKGVPYYKATKKLDIGGR----FLNGLLKETISFRHYNVMDETI-LINNIKEQCC 228
            V+PV +G     A K + I GR    F+  LL+E          D ++     IK++ C
Sbjct: 214 HVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLLRER------GEADTSLRTAEKIKQEYC 267

Query: 229 FMPP--VSYFDSFQRKEETRVEYILPDFQTSLIGYVRQPKQAIPKTSQILRLEDELFTVP 286
           ++ P  V  F+ F R      ++++ + + +                +++ +  E F  P
Sbjct: 268 YVCPDIVKEFNKFDRDPSKFAQFVVENQEKT--------------RRKVVDIGYERFLAP 313

Query: 287 ETFFHPEI--SNILKPGLVETILECVSMVPEVLRPLLVSNIVAVGGNFNIANFATRLATE 344
           E FF+PEI  S+ L P L   + + +   P  +R  L +NIV  GG+    +F  RL  +
Sbjct: 314 EIFFNPEIASSDFLTP-LPMVVDQTIQACPIDVRKGLYNNIVLSGGSTMFKDFGRRLQRD 372

Query: 345 LQ----------------RQCPTDWKVRVHQPKLDAALQGWKSMRQFSQTDSYKNSRVTR 388
           L+                +    D  V  H+ + +A    W      +QT  +K    T+
Sbjct: 373 LKSIVNSRIAQSELLSGTKSTGVDVSVISHRKQRNAV---WFGGSLLAQTAEFKGYCHTK 429

Query: 389 SEYLEHG 395
            +Y E+G
Sbjct: 430 KDYEEYG 436

>TDEL0F00470 Chr6 (80760..82145) [1386 bp, 461 aa] {ON} Anc_1.514
           YJR065C
          Length = 461

 Score = 63.2 bits (152), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 77/359 (21%), Positives = 149/359 (41%), Gaps = 59/359 (16%)

Query: 59  PSELGQLISWELEEQIWDYCLFNPDEFGWELKDSKDVDLIASETCMTIPEISKNMDQVVF 118
           P   GQ+ +W+  E+ W+  +F      +   + +D   + +E  +  PE  + + ++ F
Sbjct: 127 PIRHGQVENWDHMERFWENSIFK-----YLRTEPEDHCFLLTEPPLNPPENREQVAEIFF 181

Query: 119 EEYEFGSMMKCPVAQFVPFDRARDYDIVGGAGEVVE-AKSGYNNFQLVVDSGFNCTWVMP 177
           E +    +       ++             + +V++ + +G      V+DSG   T V+P
Sbjct: 182 ESFNCAGL-------YIAVQAVLALAASWTSSKVIDRSLTG-----TVIDSGDGVTHVIP 229

Query: 178 VIKGVPYYKATKKLDIGGRFLNGLLKETISFRHYNVMDETI-LINNIKEQCCFMPP--VS 234
           V +G     A K + I GR +   +++ +  R     D ++     IK++ C++ P  V 
Sbjct: 230 VAEGYVIGSAIKNIPIAGRDITLFIQQLL--RERGEEDTSLRTAERIKQEYCYVCPDIVK 287

Query: 235 YFDSFQRKEETRVEYILPDFQTSLIGYVRQPKQAIPKTSQILRLEDELFTVPETFFHPEI 294
            F+ F R  E   ++++   + +                +++ +  E F  PE FF+PEI
Sbjct: 288 EFNKFDRDSEKFAQFVVESQEKT--------------RRKVVDVGCERFMAPEIFFNPEI 333

Query: 295 --SNILKPGLVETILECVSMVPEVLRPLLVSNIVAVGGNFNIANFATRLATELQ------ 346
             S+ L P L   +   +   P  +R  L +NIV  GG+    +F  RL  +L+      
Sbjct: 334 ASSDFLTP-LPTIVDHTIQACPIDVRKGLYNNIVLSGGSTMFKDFGRRLQRDLKSIVNNR 392

Query: 347 ----------RQCPTDWKVRVHQPKLDAALQGWKSMRQFSQTDSYKNSRVTRSEYLEHG 395
                     +    D +V  H+ + +A    W      +QT  +K+   T+ +Y E G
Sbjct: 393 IVQSEYLSGTKSTGVDVQVISHRKQRNAV---WFGGSLLAQTAEFKSYCHTKKDYEEIG 448

>Suva_15.326 Chr15 complement(565392..566546) [1155 bp, 384 aa] {ON}
           YHR129C (REAL)
          Length = 384

 Score = 62.8 bits (151), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 82/404 (20%), Positives = 165/404 (40%), Gaps = 57/404 (14%)

Query: 4   PLLMENGSYEIKFGPANLETPYRARNCLT-RDRY---------GRYHLSNQMDQIRDISH 53
           P++++NGS  IK G +  E P      L    +Y         G   + N+  ++R +  
Sbjct: 14  PIVIDNGSGIIKAGFSGEEKPKSLEYSLVGHAKYDKVMLEGLQGDTFVGNKAQRLRGL-- 71

Query: 54  CHIRRPSELGQLISWELEEQIWDYCLFNPDEFGWELKDSKDVDLIASETCMTIPEISKNM 113
             ++ P E G +  W+  E IW + L   +E   +L++ ++  L+ +E  M   +  + M
Sbjct: 72  LRLQYPIEHGVVEDWDSMELIWAHIL---NEV-LQLQNIEEHPLLITEAPMNPLKNREVM 127

Query: 114 DQVVFEEYEFGSMMKCPVAQFVPFDRARDYDIVGGAGEVVEAKSGYNNFQLVVDSGFNCT 173
            QV+FE +   ++     A    +   R        G V++   GY            C+
Sbjct: 128 AQVLFETFNLPALYVSNPAVLSLYASGRT------TGCVIDCGEGY------------CS 169

Query: 174 WVMPVIKGVPYYKATKKLDIGGR----FLNGLLKETISFRHYNVMDETILINNIKEQCCF 229
            V P+  G     +  ++DIGGR     L   L+++     ++  +  I +  IKE+ C+
Sbjct: 170 TV-PIYDGFALPASMMRMDIGGRDITKQLQFQLRKSAGVSLFSSSEREI-VRTIKEKVCY 227

Query: 230 MPPVSYFDSFQRKEETRVEYILPDFQTSLIGYVRQPKQAIPKTSQILRLEDELFTVPETF 289
           +         +++E T ++         L    + P        + + + ++ +  PE  
Sbjct: 228 LAT-----DIKKEENTYMQE-----SQDLTSVFKLPD------GKCIEIGNDRYRAPEIL 271

Query: 290 FHPEISNILKPGLVETILECVSMVPEVLRPLLVSNIVAVGGNFNIANFATRLATELQRQC 349
           F P+I      GL +  ++ +  V   LR  L+S+I+  GG   +  F  R+  +L+   
Sbjct: 272 FSPQIIGSGYDGLSDMCMQSIWKVDLDLRTTLLSSIILSGGTTTLRGFGDRMLHDLEAFT 331

Query: 350 PTDWKVRVHQPKLDAALQGWKSMRQFSQTDSYKNSRVTRSEYLE 393
               K+++  P  +     W      +   +++     +S++LE
Sbjct: 332 KGTSKIKIIAPP-ERKYTTWVGGSILTGLSTFQRLWTKKSDWLE 374

>Suva_12.154 Chr12 complement(235605..236954) [1350 bp, 449 aa] {ON}
           YJR065C (REAL)
          Length = 449

 Score = 62.8 bits (151), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 83/372 (22%), Positives = 143/372 (38%), Gaps = 85/372 (22%)

Query: 59  PSELGQLISWELEEQIWDYCLFNPDEFGWELKDSKDVDLIASETCMTIPEISKNMDQVVF 118
           P   GQ+ +W+  E+ W+  +F      +   + +D   + +E  +  PE  + + ++ F
Sbjct: 115 PIRHGQVENWDHMERFWENSIFK-----YLRTEPEDHFFLLTEPPLNPPENREQVAEIFF 169

Query: 119 EEYEFGSMMKCPVAQFVPF-----DRARDYDIVGGAGEVVEAKSGYNNFQLVVDSGFNCT 173
           E +    +     A           +  D  + G                 V+DSG   T
Sbjct: 170 ESFNCAGLYIAVQAVLALAASWTSSKVTDRSLTG----------------TVIDSGDGVT 213

Query: 174 WVMPVIKGVPYYKATKKLDIGGR----FLNGLLKETISFRHYNVMDETI-LINNIKEQCC 228
            V+PV +G     A K + I GR    F+  LL+E          D ++     IK++ C
Sbjct: 214 HVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLLRER------GEADTSLRTAEKIKQEYC 267

Query: 229 FMPP--VSYFDSFQRKEETRVEYILPDFQTSL-----IGYVRQPKQAIPKTSQILRLEDE 281
           ++ P  V  F+ F R      ++++ + + +      IGY R                  
Sbjct: 268 YVCPDIVKEFNKFDRDPSKFAQFVVENQEKTRRKAVDIGYER------------------ 309

Query: 282 LFTVPETFFHPEI--SNILKPGLVETILECVSMVPEVLRPLLVSNIVAVGGNFNIANFAT 339
            F  PE FF+PEI  S+ L P L   + + +   P  +R  L +NIV  GG+    +F  
Sbjct: 310 -FLAPEIFFNPEIASSDFLTP-LPTVVDQTIQACPIDVRKGLYNNIVLSGGSTMFKDFGR 367

Query: 340 RLATELQ----------------RQCPTDWKVRVHQPKLDAALQGWKSMRQFSQTDSYKN 383
           RL  +L+                +    D  V  H+ + +A    W      +QT  +K 
Sbjct: 368 RLQRDLKSIVNNRIAQSELLSGTKSTGVDVSVISHRKQRNAV---WFGGSLLAQTAEFKG 424

Query: 384 SRVTRSEYLEHG 395
              T+ +Y E+G
Sbjct: 425 YCHTKKDYEEYG 436

>KAFR0F00590 Chr6 (120359..121519) [1161 bp, 386 aa] {ON} Anc_2.117
           YHR129C
          Length = 386

 Score = 62.4 bits (150), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 93/411 (22%), Positives = 159/411 (38%), Gaps = 70/411 (17%)

Query: 4   PLLMENGSYEIKFG------PANLE-----TPYRARNCLTRDRYGRYHLSNQMDQIRDIS 52
           P++++NG+  IK G      P  LE     TP   +   +        + N+  + R I 
Sbjct: 14  PIVIDNGTNVIKGGFTGETKPRCLEYSIVGTPKYDKIMQSNGIESDSFIGNKAQKYRGI- 72

Query: 53  HCHIRRPSELGQLISWELEEQIWDYCLFNPDEFGWELKDSKDVDLIASETCMTIPEISKN 112
              +R P   G + +W+  E IW Y +F+   +   L++  +  ++ +E  +      + 
Sbjct: 73  -LKLRHPMLRGVVQNWDDMETIWQY-VFDDTLY---LENLNEHPILITEPPLNNMANRQK 127

Query: 113 MDQVVFEEYEFGS--MMKCPVAQFVPFDRARDYDIVGGAGEVVEAKSGYNNFQLVVDSGF 170
           M + +FE + F +  +   PV       +          G  V+   GY           
Sbjct: 128 MCEALFEIFGFPAVYISVSPVLSLYASGQT--------TGCAVDCGDGY----------- 168

Query: 171 NCTWVMPVIKGVPYYKATKKLDIGG-----RFLNGLLKETISFRHYNVMDETILINNIKE 225
            CT + PV  G     + KK+DIGG     +    +LK T  F + +   E  ++  IKE
Sbjct: 169 -CTSI-PVYNGFSLASSVKKIDIGGCDITEQLQFSILKNTGLFMYSS--SEREIVRTIKE 224

Query: 226 QCCFMPPVSYFDSFQ---RKEETRVEYILPDFQTSLIGYVRQPKQAIPKTSQILRLEDEL 282
           + C++      ++ +    +E+   ++ LPD                    ++L +    
Sbjct: 225 KVCYIATDYNLETEKYLFNEEKMASQFKLPD-------------------GKMLNISQGK 265

Query: 283 FTVPETFFHPEISNILKPGLVETILECVSMVPEVLRPLLVSNIVAVGGNFNIANFATRLA 342
           +T  E  F PE+       L E   + +  V   LR  L SNIV  GG      F +RL 
Sbjct: 266 YTSTEILFRPELIGSEFDSLPEICYQSIKKVDSDLRLPLYSNIVLSGGTTMCPGFGSRLL 325

Query: 343 TELQRQCPTDWKVRVHQPKLDAALQGWKSMRQFSQTDSYKNSRVTRSEYLE 393
            ELQ     D K+R+  P  +     W      S   ++    VT+S + E
Sbjct: 326 KELQTLTGYDTKIRIIAPP-ERKYTSWIGGSILSGLSTFSKIWVTKSMWEE 375

>YJR065C Chr10 complement(557809..559158) [1350 bp, 449 aa] {ON}
           ARP3Essential component of the Arp2/3 complex, which is
           a highly conserved actin nucleation center required for
           the motility and integrity of actin patches; involved in
           endocytosis and membrane growth and polarity
          Length = 449

 Score = 62.4 bits (150), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 79/367 (21%), Positives = 144/367 (39%), Gaps = 75/367 (20%)

Query: 59  PSELGQLISWELEEQIWDYCLFNPDEFGWELKDSKDVDLIASETCMTIPEISKNMDQVVF 118
           P   GQ+ +W+  E+ W+  +F      +   + +D   + +E  +  PE  + + ++ F
Sbjct: 115 PIRHGQVENWDHMERFWENSIFK-----YLRTEPEDHFFLLTEPPLNPPENREQVAEIFF 169

Query: 119 EEYEFGSMMKCPVAQFVPF-----DRARDYDIVGGAGEVVEAKSGYNNFQLVVDSGFNCT 173
           E +    +     A           +  D  + G                 V+DSG   T
Sbjct: 170 ESFNCAGLYIAVQAVLALAASWTSSKVTDRSLTG----------------TVIDSGDGVT 213

Query: 174 WVMPVIKGVPYYKATKKLDIGGR----FLNGLLKETISFRHYNVMDETI-LINNIKEQCC 228
            V+PV +G     A K + I GR    F+  LL+E          D ++     IK++ C
Sbjct: 214 HVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLLRER------GEADTSLRTAEKIKQEYC 267

Query: 229 FMPP--VSYFDSFQRKEETRVEYILPDFQTSLIGYVRQPKQAIPKTSQILRLEDELFTVP 286
           ++ P  V  F+ F +      ++++ + + +                +++ +  E F  P
Sbjct: 268 YVCPDIVKEFNKFDKDPSKFAQFVVENQEKT--------------RRKVVDIGYERFLAP 313

Query: 287 ETFFHPEI--SNILKPGLVETILECVSMVPEVLRPLLVSNIVAVGGNFNIANFATRLATE 344
           E FF+PEI  S+ L P L   + + +   P  +R  L +NIV  GG+    +F  RL  +
Sbjct: 314 EIFFNPEIASSDFLTP-LPTVVDQTIQACPIDVRKGLYNNIVLSGGSTMFKDFGRRLQRD 372

Query: 345 LQ----------------RQCPTDWKVRVHQPKLDAALQGWKSMRQFSQTDSYKNSRVTR 388
           L+                +    D  V  H+ + +A    W      +QT  +K    T+
Sbjct: 373 LKSIVNNRIAQSELLSGTKSTGVDVSVISHRKQRNAV---WFGGSLLAQTAEFKGYCHTK 429

Query: 389 SEYLEHG 395
            +Y E+G
Sbjct: 430 KDYEEYG 436

>AFR419C Chr6 complement(1186951..1188318) [1368 bp, 455 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJR065C
           (ARP3)
          Length = 455

 Score = 62.4 bits (150), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 82/366 (22%), Positives = 143/366 (39%), Gaps = 73/366 (19%)

Query: 59  PSELGQLISWELEEQIWDYCLFNPDEFGWELKDSKDVDLIASETCMTIPEISKNMDQVVF 118
           P   GQ+  W   E+ W+  +F      +   + +D   + +E  +  PE  + + ++ F
Sbjct: 121 PIRHGQVEDWNHMERFWENSIFK-----YLRTEPEDHFFLLTEPPLNPPENREQVAEIFF 175

Query: 119 EEYEFGSMMKCPVAQFVPF-----DRARDYDIVGGAGEVVEAKSGYNNFQLVVDSGFNCT 173
           E +    +     A           +  D  + G                 V+DSG   T
Sbjct: 176 ESFNCAGLYIAVQAVLALAASWTSSKVTDRSLTG----------------TVIDSGDGVT 219

Query: 174 WVMPVIKGVPYYKATKKLDIGGR----FLNGLLKETISFRHYNVMDETILINNIKEQCCF 229
            V+PV +G     A K + I GR    F+  LL+E        V         IK++ C+
Sbjct: 220 HVIPVAEGYVIGSAIKHIPIAGRDITLFIQSLLRE-----RGEVDTSLRTAERIKQEYCY 274

Query: 230 MPP--VSYFDSFQRKEETRVEYILPDFQTSLIGYVRQPKQAIPKTSQILRLEDELFTVPE 287
           + P  V  F+ F R      ++I+ +            K+   K  +++ +  E F  PE
Sbjct: 275 VCPDIVKEFNKFDRDATKFAQFIVEN------------KEKTQK--KVVDVGYERFLAPE 320

Query: 288 TFFHPEI--SNILKPGLVETILECVSMVPEVLRPLLVSNIVAVGGNFNIANFATRLATEL 345
            FF+PEI  S+ L P L   + + +   P  +R  L +NIV  GG+    +F  RL  +L
Sbjct: 321 IFFNPEIASSDFLTP-LPTVVDQTIQACPIDVRKGLYNNIVLSGGSTMFKDFGRRLQRDL 379

Query: 346 Q----------------RQCPTDWKVRVHQPKLDAALQGWKSMRQFSQTDSYKNSRVTRS 389
           +                +    + +V  H+ + +A    W      +QT  +K+   T+ 
Sbjct: 380 RSIVNNRIAQSELLSGTKSTGVEVQVISHRRQRNAV---WFGGSLLAQTAEFKSYCHTKK 436

Query: 390 EYLEHG 395
           +Y E+G
Sbjct: 437 DYEEYG 442

>KLTH0C02508g Chr3 (224722..226077) [1356 bp, 451 aa] {ON} highly
           similar to uniprot|P47117 Saccharomyces cerevisiae
           YJR065C ARP3 Essential component of the Arp2/3 complex
           which is a highly conserved actin nucleation center
           required for the motility and integrity of actin patches
           involved in endocytosis and membrane growth and polarity
          Length = 451

 Score = 62.4 bits (150), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 81/363 (22%), Positives = 150/363 (41%), Gaps = 67/363 (18%)

Query: 59  PSELGQLISWELEEQIWDYCLFNPDEFGWELKDSKDVDLIASETCMTIPEISKNMDQVVF 118
           P   GQ+ +W+  E+ W+  +F      +   + +D   + +E  +  PE  + + ++ F
Sbjct: 117 PIRHGQVENWDHMERFWENSIFK-----YLRTEPEDHFFLLTEPPLNPPENREQVAEIFF 171

Query: 119 EEYEFGSMMKCPVAQFVPFDRARDYDIVGGAGEVVE-AKSGYNNFQLVVDSGFNCTWVMP 177
           E +    +       ++             + +VV+ + +G      V+DSG   T V+P
Sbjct: 172 ESFNCAGL-------YIAVQAVLALAASWTSSKVVDRSLTG-----TVIDSGDGVTHVIP 219

Query: 178 VIKGVPYYKATKKLDIGGR----FLNGLLKETISFRHYNVMDETI-LINNIKEQCCFMPP 232
           V +G     A K + I GR    F+  LL+E          D T+     IK++ C++  
Sbjct: 220 VAEGYVIGSAIKNIPIAGRDITLFIQSLLRER------GEEDTTLRTAERIKQEYCYVCS 273

Query: 233 --VSYFDSFQRKEETRVEYILPDFQTSLIGYVRQPKQAIPKTSQILRLEDELFTVPETFF 290
             V  F+ F R  +   ++I+ + + +                +++ +  E F  PE FF
Sbjct: 274 DIVKEFNKFDRDPQKFAQFIVENSEKT--------------KRKVIDVGYERFLAPEIFF 319

Query: 291 HPEI--SNILKPGLVETILECVSMVPEVLRPLLVSNIVAVGGNFNIANFATRLATELQ-- 346
           +PEI  S+ L P L   + + +   P  +R  L +NIV  GG+    +F  RL  +L+  
Sbjct: 320 NPEIASSDFLTP-LPTVVDQTIQACPIDVRKGLYNNIVLSGGSTMFKDFGRRLQRDLKGI 378

Query: 347 --------------RQCPTDWKVRVHQPKLDAALQGWKSMRQFSQTDSYKNSRVTRSEYL 392
                         +    D +V  H+ + +A    W      +QT  +K+   T+ +Y 
Sbjct: 379 VNNRIALSEHLSGTKSTGVDVQVISHRRQRNAV---WFGGSLLAQTAEFKSYCHTKQDYE 435

Query: 393 EHG 395
           E G
Sbjct: 436 EIG 438

>Kwal_27.9958 s27 (139638..140975) [1338 bp, 445 aa] {ON} YJR065C
           (ARP3) - involved in the function of the actin
           cytoskeleton [contig 43] FULL
          Length = 445

 Score = 62.0 bits (149), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 78/337 (23%), Positives = 141/337 (41%), Gaps = 55/337 (16%)

Query: 59  PSELGQLISWELEEQIWDYCLFNPDEFGWELKDSKDVDLIASETCMTIPEISKNMDQVVF 118
           P   GQ+ +W+  E+ W+  +F      +   + +D   + +E  +  PE  + + ++ F
Sbjct: 111 PIRHGQVENWDHMERFWENSIFK-----YLRTEPEDHYFLLTEPPLNPPENREQVAEIFF 165

Query: 119 EEYEFGSMMKCPVAQFVPFDRARDYDIVGGAGEVVE-AKSGYNNFQLVVDSGFNCTWVMP 177
           E +    +       ++             + +VV+ + +G      V+DSG   T V+P
Sbjct: 166 ESFNCAGL-------YIAVQAVLALAASWTSSKVVDRSLTG-----TVIDSGDGVTHVIP 213

Query: 178 VIKGVPYYKATKKLDIGGR----FLNGLLKETISFRHYNVMDETI-LINNIKEQCCFMPP 232
           V +G     A K + I GR    F+  LL+E          D T+     IK++ C++  
Sbjct: 214 VAEGYVIGSAIKNIPIAGRDITLFIQSLLRER------GEEDTTLRTAERIKQEYCYVCS 267

Query: 233 --VSYFDSFQRKEETRVEYILPDFQTSLIGYVRQPKQAIPKTSQILRLEDELFTVPETFF 290
             V  F+ F R  E   ++I+ + + +                +++ +  E F  PE FF
Sbjct: 268 DIVKEFNKFDRDSEKFAQFIVENSEKT--------------RRKVIDVGYERFLAPEIFF 313

Query: 291 HPEI--SNILKPGLVETILECVSMVPEVLRPLLVSNIVAVGGNFNIANFATRLATELQRQ 348
           +PEI  S+ L P L   + + +   P  +R  L +NIV  GG+    +F  RL  +L+  
Sbjct: 314 NPEIASSDFLTP-LPTIVDQTIQACPIDVRKGLYNNIVLSGGSTMFKDFGRRLQRDLK-- 370

Query: 349 CPTDWKVRVHQPKLDAALQGWKSMRQFSQTDSYKNSR 385
                 +  ++  L   L G KS     Q  S++  R
Sbjct: 371 -----GIVNNRIALSEHLSGTKSTGVDVQVISHRRQR 402

>SAKL0E08602g Chr5 (702206..704449) [2244 bp, 747 aa] {ON} similar
           to uniprot|P53946 Saccharomyces cerevisiae YNL059C ARP5
           Nuclear actin-related protein involved in chromatin
           remodeling component of chromatin-remodeling enzyme
           complexes
          Length = 747

 Score = 62.4 bits (150), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 41/141 (29%), Positives = 67/141 (47%), Gaps = 15/141 (10%)

Query: 276 LRLEDELFTVPETFFHPEISNILKPGLVETILECVSM--VPEVLRPL------LVSNIVA 327
           + L  E   VPE  F P +  + + G++E + E + M       R L      + +N+  
Sbjct: 605 MHLNVERIRVPEVIFQPPMGGLDQAGIIE-LSETIIMNKFGSSRRQLSSVSQEMANNVFL 663

Query: 328 VGGNFNIANFATRLATELQRQCP--TDWKVRVHQPKLDAALQGWKSMRQFSQTDS-YKNS 384
            GGN  +     R+  E     P  T + ++V     D A+  WK M +F+Q+ + YK S
Sbjct: 664 TGGNVRVPGLRDRIVREFTEFLPVGTKYNIKVAS---DPAIDAWKGMAKFAQSSTDYKGS 720

Query: 385 RVTRSEYLEHGADWCTKHRFG 405
            VT+ EY E+G D+  +H+ G
Sbjct: 721 YVTKKEYEEYGPDYIKEHKLG 741

>Kpol_1023.18 s1023
           complement(36072..36143,36193..36201,36244..37112,
           37854..37863) [960 bp, 319 aa] {ON}
           complement(36072..36143,36193..36201,36244..37112,
           37854..37863) [960 nt, 320 aa]
          Length = 319

 Score = 61.2 bits (147), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 60/264 (22%), Positives = 106/264 (40%), Gaps = 55/264 (20%)

Query: 56  IRRPSELGQLISWELEEQIWDYCLFNPDEFGWELKDS-KDVDLIASETCMTIPEISKNMD 114
           +R P E G + +W+  E+IW +  +N      EL+ + ++  ++ +E  M      + M 
Sbjct: 67  LRYPIEHGIVTNWDDMEKIWHHTFYN------ELRVAPEEHPVLLTEAPMNPKSNREKMT 120

Query: 115 QVVFEEYEFGSMMKCPVAQFVPFDRARDYDIVGGAGEVVEAKSGYNNFQLVVDSGFNCTW 174
           Q++FE +   +      A    +   R   IV                   +DSG   T 
Sbjct: 121 QIMFETFNVPAFYVSIQAVLSLYSSGRTTGIV-------------------LDSGDGVTH 161

Query: 175 VMPVIKGVPYYKATKKLDIGGRFLNGLLKETISFRHY--NVMDETILINNIKEQCCFMPP 232
           V+P+  G        ++D+ GR L   L + +S R Y  +   E  ++ +IKE+ C++  
Sbjct: 162 VVPIYAGFSMPHGILRIDLAGRDLTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYV-A 220

Query: 233 VSYFDSFQRKEETRV---EYILPDFQTSLIGYVRQPKQAIPKTSQILRLEDELFTVPETF 289
           + +    Q   ++      Y LPD Q   IG                   +E F  PE  
Sbjct: 221 LDFEQEMQTAAQSSSIEKSYELPDGQVITIG-------------------NERFRAPEAL 261

Query: 290 FHPEISNILKPGLVET----ILEC 309
           FHP +  +   G+ +T    I++C
Sbjct: 262 FHPSVLGLESSGIDQTTYNSIMKC 285

>KLTH0G09482g Chr7 complement(789233..791470) [2238 bp, 745 aa] {ON}
           similar to uniprot|P53946 Saccharomyces cerevisiae
           YNL059C ARP5 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin-remodeling
           enzyme complexes
          Length = 745

 Score = 61.2 bits (147), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 40/139 (28%), Positives = 60/139 (43%), Gaps = 11/139 (7%)

Query: 276 LRLEDELFTVPETFFHPEISNILKPGLVE--------TILECVSMVPEVLRPLLVSNIVA 327
           + L  E   VPE  F P ++ + + G+ E              S + E  + L  +N+  
Sbjct: 604 MHLNVERIRVPEVIFQPSMAGLDQAGVTEICETNFLKKFGSTRSQLSEGSKKL-AANVFL 662

Query: 328 VGGNFNIANFATRLATELQRQCPTDWKVRVHQPKLDAALQGWKSMRQFSQTDS-YKNSRV 386
            GGN  +     R+  E     P    + V     D+A+  W+ M + SQ  S YK S +
Sbjct: 663 TGGNMRLPGVRERIVREFTGMLPMGSNLNVRMAS-DSAVDAWRGMAKLSQAGSQYKGSYI 721

Query: 387 TRSEYLEHGADWCTKHRFG 405
           TR EY E GAD+  +H  G
Sbjct: 722 TRKEYQELGADYIKEHNLG 740

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 56/253 (22%), Positives = 103/253 (40%), Gaps = 42/253 (16%)

Query: 3   VPLLMENGSYEIKFGPANLETP---YRARNCLTRDRYGRYHLS-NQMDQIRDIS-HCHIR 57
           VP+ ++ GS E++ G  N + P   +  R    RDR    +L+    D   D+S     +
Sbjct: 37  VPIAIDFGSSEVRAGFGNQDQPSHIFTNRISRWRDRRKNRNLTFIGNDTNLDLSVRSQAK 96

Query: 58  RPSELGQLISWELEEQIWDYCLFNPDEFGWELKDSKDVDLIASETCMTIPEISKNMDQVV 117
            P +   + +W+  E+I +Y   +    G    D     ++ +E   T+    +N  Q++
Sbjct: 97  SPYDGAIVSNWDYTEEIMEYTFHH---LGVNGNDGVSNPILMTEKLATLQSQRENWYQLL 153

Query: 118 FE-----EYEFGSMMKCPVAQFVPFDRARDYDIVGGAGEVVEAKSGYNNFQLVVDSGFNC 172
           FE     +  FG      +     F    D    G                LV++SG   
Sbjct: 154 FECFGVPQVTFG------IDSLFSFYANNDATASG----------------LVINSGNED 191

Query: 173 TWVMPVIKGVPYYKATKKLDIGGR----FLNGLLKETISFRHYNVMDETILINNIKEQCC 228
           T V+PV+ G       K+++ GGR    +L+ LL   + + ++ +   T    ++ E  C
Sbjct: 192 THVIPVMNGKGVLSEAKRINWGGRQSVEYLSNLL--ALKYPYFPIKPSTHQFQSLYEDFC 249

Query: 229 FMPPVSYFDSFQR 241
           ++  V Y D  ++
Sbjct: 250 YV-SVDYQDEIRK 261

>TPHA0C03160 Chr3 complement(699424..701691) [2268 bp, 755 aa] {ON}
           Anc_2.248 YNL059C
          Length = 755

 Score = 61.2 bits (147), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 39/132 (29%), Positives = 62/132 (46%), Gaps = 15/132 (11%)

Query: 285 VPETFFHPEISNILKPGLVE----TILECVSMVPEVLR---PLLVSNIVAVGGNFNIANF 337
           VPE  F P +    + G++E     +L+     P  L      +  N+   GG+  +   
Sbjct: 622 VPEILFQPRMGGCDQAGIIELSETMLLKKFGSKPSKLSDQAEAMAKNVWITGGHAQLPGL 681

Query: 338 ATRLATELQRQCPTDWKVRVH---QPKLDAALQGWKSMRQFSQTDS-YKNSRVTRSEYLE 393
            TR+  E     P D K  V+    P LDA    WK M +FS  D+ +K+S +++ EY E
Sbjct: 682 KTRIVKEFTSFLPNDAKFSVNISKHPSLDA----WKGMAKFSSDDADFKSSLISKKEYEE 737

Query: 394 HGADWCTKHRFG 405
           +G ++  +HR G
Sbjct: 738 YGPEYIKEHRLG 749

>KLLA0F03421g Chr6 complement(321000..323243) [2244 bp, 747 aa] {ON}
           similar to uniprot|P53946 Saccharomyces cerevisiae
           YNL059C ARP5 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin-remodeling
           enzyme complexes
          Length = 747

 Score = 60.8 bits (146), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 40/146 (27%), Positives = 65/146 (44%), Gaps = 26/146 (17%)

Query: 276 LRLEDELFTVPETFFHPEISNILKPGLVE---TIL-------------ECVSMVPEVLRP 319
           L L  E    PE  F P +  + + G+ E    IL             +C+ M       
Sbjct: 606 LHLNIERIRAPEVIFQPSMGGLDQAGIAELADGILTKKFGSGSSKLSQQCLDMA------ 659

Query: 320 LLVSNIVAVGGNFNIANFATRLATELQRQCPTDWKVRVHQPKLDAALQGWKSMRQFSQTD 379
              SNI   GGN  I N   R+  E     P +  + V+  + + +L  WK M +F+++D
Sbjct: 660 ---SNIFITGGNTKIPNLRERIVNEFTGFLPVNTPLNVNYAQ-NVSLDAWKGMAKFARSD 715

Query: 380 SYKNSRVTRSEYLEHGADWCTKHRFG 405
           +Y ++ VT+ EY E G ++  +H+ G
Sbjct: 716 TYSSTCVTKVEYEEFGPNYIKEHKLG 741

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 45/214 (21%), Positives = 82/214 (38%), Gaps = 27/214 (12%)

Query: 3   VPLLMENGSYEIKFGPANLETPYRARNCLTRDRYGRYHLSNQMD------QIRDISHCHI 56
            P+ ++ GSYE++ G  + +TP          RY    +   +        + +    H 
Sbjct: 40  TPIALDFGSYEVRAGFTSQDTPSHVFPTKIV-RYKERKIQKALTFIGNDCSLDNAVRSHS 98

Query: 57  RRPSELGQLISWELEEQIWDYCLFNPDEFGWELKDSKDVDLIASETCMTIPEISKNMDQV 116
           R P +   + +WE  E +  Y   +    G +  D     +I +E   T+     N  Q+
Sbjct: 99  RSPYDGSLITNWEYMEDMLSYTFHH---LGVQPNDGISNPMILTEKMATVQAQRSNWYQL 155

Query: 117 VFEEYEFGSMMKCPVAQFVPFDRARDYDIVGGAGEVVEAKSGYNNFQLVVDSGFNCTWVM 176
           +FE Y    +       F  +                 A +  ++  L+++SG   T ++
Sbjct: 156 LFECYGIPQVTFGIDGLFSFY-----------------ANNSPDSTGLIINSGHEDTNII 198

Query: 177 PVIKGVPYYKATKKLDIGGRFLNGLLKETISFRH 210
           PVIKG       K++D GG      LK  +S ++
Sbjct: 199 PVIKGKGILSEAKRIDWGGNQSIDYLKSLLSLKY 232

>Kwal_23.4848 s23 complement(892162..894399) [2238 bp, 745 aa] {ON}
           YNL059C (ARP5) - Actin-related protein [contig 5] FULL
          Length = 745

 Score = 60.5 bits (145), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 40/139 (28%), Positives = 63/139 (45%), Gaps = 11/139 (7%)

Query: 276 LRLEDELFTVPETFFHPEISNILKPGLVETILEC--------VSMVPEVLRPLLVSNIVA 327
           + L  E   VPE  F P +  + + G++E I E                +   L SN+  
Sbjct: 604 MHLNVERIRVPEVIFQPSMGGLDQAGIIE-ICETNFLKKFGSSRSELSSISRSLASNVFL 662

Query: 328 VGGNFNIANFATRLATELQRQCPTDWKVRVHQPKLDAALQGWKSMRQFSQTDS-YKNSRV 386
            GGN  +     R+  E +   P   ++ V     D AL  W+ M + S+TDS ++++ V
Sbjct: 663 TGGNMRLPGMRERVVREFRGLLPIGTELNVRMAN-DCALDAWRGMAKLSRTDSLFRDTYV 721

Query: 387 TRSEYLEHGADWCTKHRFG 405
           TR EY E+G D+  +H  G
Sbjct: 722 TRQEYHEYGPDYIKEHNLG 740

 Score = 37.7 bits (86), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 56/241 (23%), Positives = 96/241 (39%), Gaps = 32/241 (13%)

Query: 10  GSYEIKFGPANLETP---YRARNCLTRDRYGRYHLS-NQMDQIRDIS-HCHIRRPSELGQ 64
           GS E++ G  N E P   +  R    RDR    +L+    D   D+S     R P +   
Sbjct: 44  GSSEVRAGYGNQERPSHIFPNRIARWRDRKLNRNLTFIGNDTNLDLSVRSQSRSPYDGAL 103

Query: 65  LISWELEEQIWDYCLFNPDEFGWELKDSKDVDLIASETCMTIPEISKNMDQVVFEEYEFG 124
           + +W+  E I +Y   +    G +  D     +I +E    +     N  Q++FE     
Sbjct: 104 VTNWDYTEDIMEYTFHH---LGVKGTDGIPNPIIMTEKLGALHSQRDNWYQLLFE----- 155

Query: 125 SMMKCPVAQFVPFDRARDYDIVGGAGEVVEAKSGYNNFQLVVDSGFNCTWVMPVIKGVPY 184
               C  A  V F     +           A +  +   LV+ SG   T ++PV+ G   
Sbjct: 156 ----CFGAPQVTFGLDSLFSFY--------ANNDASASGLVISSGNEDTHIIPVVDGKGV 203

Query: 185 YKATKKLDIGGR----FLNGLLKETISFRHYNVMDETILINNIKEQCCFMPPVSYFDSFQ 240
               K+++ GGR    +L+ LL   + + ++ +   T     + ++ C++ P  Y D  Q
Sbjct: 204 LGEAKRINWGGRQSVDYLSNLL--ALKYPYFPIKPSTHQFKALYDEFCYVSP-DYQDEIQ 260

Query: 241 R 241
           R
Sbjct: 261 R 261

>Kpol_1003.16 s1003 complement(43655..45904) [2250 bp, 749 aa] {ON}
           complement(43655..45904) [2250 nt, 750 aa]
          Length = 749

 Score = 58.9 bits (141), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 36/137 (26%), Positives = 61/137 (44%), Gaps = 8/137 (5%)

Query: 276 LRLEDELFTVPETFFHPEISNILKPGLVE----TILECVSMVPEVLRPL---LVSNIVAV 328
           + L  E   VPE  F P +    + G+ E     +L+     P  L      + +NI   
Sbjct: 608 MHLNIERIRVPEVLFQPTMGGCDQAGVAELCETILLKKFGSSPNQLSKTAEDMANNIWLS 667

Query: 329 GGNFNIANFATRLATELQRQCPTDWKVRVHQPKLDAALQGWKSMRQFSQTDSYKNSRVTR 388
           GGN  +     R+  E     P   K+ V+    D  L  WK M ++++++ Y  S +T+
Sbjct: 668 GGNAKVPGLKNRIVKEFTSFLPVGTKLSVNMSS-DPLLDSWKGMAKWAKSEDYNKSFITK 726

Query: 389 SEYLEHGADWCTKHRFG 405
            EY E+G ++  +H+ G
Sbjct: 727 KEYEEYGPEYIKEHKMG 743

>ADL253C Chr4 complement(255550..257805) [2256 bp, 751 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL059C
           (ARP5)
          Length = 751

 Score = 58.5 bits (140), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 39/138 (28%), Positives = 63/138 (45%), Gaps = 9/138 (6%)

Query: 281 ELFTVPETFFHPEISNILKPGLVE----TILECVSMVPEVLRPL---LVSNIVAVGGNFN 333
           E   VPE  F P I  + + G+VE     +L+        L      +  N+   GGN  
Sbjct: 614 ERIRVPEVIFQPSIGGLDQAGVVELCETVLLKKFDSSRRALSATCEKMAKNVFITGGNTK 673

Query: 334 IANFATRLATELQRQCPTDWKVRVHQPKLDAALQGWKSMRQF-SQTDSYKNSRVTRSEYL 392
           +     R+  E     P   +++V   K D +L  WK M +F S   SYK+S +T+ EY 
Sbjct: 674 LPGIRERIVREFTGFLPVGTELKVTLAK-DPSLSAWKGMAKFASDPTSYKSSILTKREYE 732

Query: 393 EHGADWCTKHRFGYEQWI 410
           E+G ++  +H  G  +++
Sbjct: 733 EYGPEYIKEHNLGNAKFM 750

>TDEL0C04140 Chr3 (732580..734829) [2250 bp, 749 aa] {ON} Anc_2.248
           YNL059C
          Length = 749

 Score = 57.8 bits (138), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 36/138 (26%), Positives = 62/138 (44%), Gaps = 9/138 (6%)

Query: 276 LRLEDELFTVPETFFHPEISNILKPGLVE----TILECVSMVPEVLRPL---LVSNIVAV 328
           + L  E   VPE FF P +    + G+ E     +L      P  +  +   +  N+   
Sbjct: 607 MHLNVERIRVPEVFFQPTMCGEDQAGVSELCERVLLSKFGASPRQMSSITSEMAKNVWVT 666

Query: 329 GGNFNIANFATRLATELQRQCPTDWKVRVHQPKLDAALQGWKSMRQFSQTDS-YKNSRVT 387
           GGN  I     R+  E     P +    V+    D +L  W+ M +++Q ++ YK S ++
Sbjct: 667 GGNAKIPGLRERIVKEFTGFLPVNTSFNVNISS-DPSLDAWRGMAKYAQNETDYKKSFIS 725

Query: 388 RSEYLEHGADWCTKHRFG 405
           + EY E+G D+  +H+ G
Sbjct: 726 KKEYEEYGPDYIKEHKLG 743

>NDAI0D01060 Chr4 complement(238631..240892) [2262 bp, 753 aa] {ON}
           Anc_2.248 YNL059C
          Length = 753

 Score = 55.5 bits (132), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 41/162 (25%), Positives = 74/162 (45%), Gaps = 14/162 (8%)

Query: 256 TSLIGYVRQPK----QAIPKTSQILRLEDELFTVPETFFHPEISNILKPGLVE----TIL 307
           ++L  ++R P+    + I +  QI  L  E   VPE  F P +  + + G+ E     +L
Sbjct: 588 STLHLFLRGPRPHDSEDIHQQHQI-HLNVERIRVPEIVFQPSMGGLDQAGIAELSETILL 646

Query: 308 ECVSMVPEVLRPL---LVSNIVAVGGNFNIANFATRLATELQRQCPTDWKVRVHQPKLDA 364
                 P+ L  L   + +NI   GGN  I     R+  E +   P + +  V+    D 
Sbjct: 647 RKFGSEPKHLSELSLTMANNIWLTGGNSKIPGLRERIVKEFREFLPVNTQFNVNMTS-DP 705

Query: 365 ALQGWKSMRQFSQTDS-YKNSRVTRSEYLEHGADWCTKHRFG 405
               W  M + +Q ++ YK + +++ EY E+G ++  +H+ G
Sbjct: 706 TFDAWNGMAKLAQNETDYKKTIISKKEYEEYGPEYIKEHKLG 747

>Smik_14.267 Chr14 complement(493008..495275) [2268 bp, 755 aa] {ON}
           YNL059C (REAL)
          Length = 755

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 38/142 (26%), Positives = 62/142 (43%), Gaps = 9/142 (6%)

Query: 276 LRLEDELFTVPETFFHPEISNILKPG---LVETIL-ECVSMVPEVLRPL---LVSNIVAV 328
           + L  E   VPE  F P +    + G   L ETIL +     P  L      + +N+   
Sbjct: 612 MHLNVERTRVPEIVFQPTMGGQDQAGICELAETILLKKFGSQPGKLSQTSIDMANNVFIT 671

Query: 329 GGNFNIANFATRLATELQRQCPTDWKVRVHQPKLDAALQGWKSMRQFSQTDS-YKNSRVT 387
           GGN  +     R+  E     P    + ++    D +L  WK M   +Q +  YK + ++
Sbjct: 672 GGNAKVPGLKERIVKEFTGFLPVGTNININMSS-DPSLDAWKGMAALAQNEEEYKRTIIS 730

Query: 388 RSEYLEHGADWCTKHRFGYEQW 409
           R EY E+G D+  +H+ G  ++
Sbjct: 731 RKEYEEYGPDYIKEHKLGNTKY 752

 Score = 32.3 bits (72), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 48/221 (21%), Positives = 86/221 (38%), Gaps = 50/221 (22%)

Query: 2   RVPLLMENGSYEIKFGPANLETPYRA-RNCLT--RDRYGRYHLS-----NQMDQ-IRDIS 52
           ++P+ ++ GS +++ G  N   P     N LT  RDR    + +       +DQ +R  S
Sbjct: 37  QLPIAIDFGSSKLRAGFVNQSAPTHVFPNVLTKFRDRKLNKNFTFVGNDTLLDQAVRSQS 96

Query: 53  HCHIRRPSELGQLISWELEEQIWDYCLFNPDEFGWELKDSKDVDLIASETCMTIPEISKN 112
                 P     + +W   E+I DY   +    G   ++     ++ +E   T+     N
Sbjct: 97  KSPFDGPF----VTNWNFTEEILDYTFHH---LGIVPENGISNPILLTERMATVQSQRAN 149

Query: 113 MDQVVFEEYEFGSMMKCPVAQFVPFDRARDYDIVGGAGEVVEAKSGYNNF-------QLV 165
             Q++FE Y                        V G    +++  G+ N+        LV
Sbjct: 150 WYQILFETYN-----------------------VPGVTFGIDSLYGFYNYYPSGKQTGLV 186

Query: 166 VDSGFNCTWVMPVIKGVPYYKATKKLDIGGR----FLNGLL 202
           +D G   T V+P++ G       K+++ GG     +LN L+
Sbjct: 187 IDCGHEDTNVIPIVDGAGILTDAKRINWGGHQAVDYLNDLM 227

>Suva_14.281 Chr14 complement(511583..513850) [2268 bp, 755 aa] {ON}
           YNL059C (REAL)
          Length = 755

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 39/138 (28%), Positives = 60/138 (43%), Gaps = 9/138 (6%)

Query: 276 LRLEDELFTVPETFFHPEISNILKPG---LVETIL-ECVSMVPEVLRPL---LVSNIVAV 328
           + L  E   VPE  F P +    + G   L ETIL +     P  L      +V+N+   
Sbjct: 612 MHLNVERIRVPEVVFQPTLGGQDQAGICELSETILLKKFGSQPGKLSSTSLDMVNNVFIT 671

Query: 329 GGNFNIANFATRLATELQRQCPTDWKVRVHQPKLDAALQGWKSMRQFSQT-DSYKNSRVT 387
           GGN  +     R+  E     P      V+    D +L  WK M   +Q  + YK + ++
Sbjct: 672 GGNSKVPGLRERIVREFTEFLPVGTNFSVNMSS-DPSLDAWKGMAALAQNKEEYKKTVIS 730

Query: 388 RSEYLEHGADWCTKHRFG 405
           + EY E+G D+  +H+ G
Sbjct: 731 KKEYEEYGPDYIKEHKLG 748

 Score = 37.0 bits (84), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 49/216 (22%), Positives = 84/216 (38%), Gaps = 30/216 (13%)

Query: 3   VPLLMENGSYEIKFGPANLETPYRA-RNCLT--RDRYGRYHLS-----NQMDQIRDISHC 54
           VP+ ++ GS +++ G  N   P     N LT  RDR    + +       +DQ       
Sbjct: 38  VPIAIDFGSSKLRAGFVNQAAPTHIFPNVLTKFRDRKLNKNFTFVGNDTLLDQA---VRS 94

Query: 55  HIRRPSELGQLISWELEEQIWDYCLFNPDEFGWELKDSKDVDLIASETCMTIPEISKNMD 114
             R P +   + +W   E+I DY   +    G    +     ++ +E   T+     N  
Sbjct: 95  QSRSPFDGPFVTNWNFTEEIMDYTFHH---LGVSPNNGVRNPILLTERMATVQSQRANWY 151

Query: 115 QVVFEEYEFGSMMKCPVAQFVPFDRARDYDIVGGAGEVVEAKSGYNNFQLVVDSGFNCTW 174
           Q++FE Y    +                + I    G   +  SG N   LV+D G   T 
Sbjct: 152 QIMFETYNVPGVT---------------FGIDSLYGFYNQNTSG-NKTGLVIDCGHEDTN 195

Query: 175 VMPVIKGVPYYKATKKLDIGGRFLNGLLKETISFRH 210
           V+PV+ G       K+++ GGR     L + ++ ++
Sbjct: 196 VIPVVDGTGVLTDAKRINWGGRQAVDYLSDLMALKY 231

>KAFR0J01160 Chr10 (212425..214680) [2256 bp, 751 aa] {ON} Anc_2.248
           YNL059C
          Length = 751

 Score = 54.7 bits (130), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 41/138 (29%), Positives = 63/138 (45%), Gaps = 9/138 (6%)

Query: 276 LRLEDELFTVPETFFHPEISNILKPG---LVETILEC-VSMVPEVLRPL---LVSNIVAV 328
           L L  E   VPE  F P I    + G   L ETIL       P  L      +  NI   
Sbjct: 609 LHLNVERIRVPEILFQPIIGGQDQAGISELCETILSNKFGSKPRELSETSLGMAKNIWLT 668

Query: 329 GGNFNIANFATRLATELQRQCPTDWKVRVHQPKLDAALQGWKSMRQFSQTDS-YKNSRVT 387
           GG+  +     R+  E     P   K+ V   K + +L  W  MR+ +Q ++ YK+S ++
Sbjct: 669 GGHSKLPGLRERIVKEFTGFLPVGTKLGVKMSK-NPSLDAWYGMRKLAQNEADYKDSIIS 727

Query: 388 RSEYLEHGADWCTKHRFG 405
           + +Y E+GA++  +H+ G
Sbjct: 728 KKDYEEYGAEYIKEHKLG 745

>YNL059C Chr14 complement(512668..514935) [2268 bp, 755 aa] {ON}
           ARP5Nuclear actin-related protein involved in chromatin
           remodeling, component of chromatin-remodeling enzyme
           complexes
          Length = 755

 Score = 53.9 bits (128), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 37/142 (26%), Positives = 65/142 (45%), Gaps = 9/142 (6%)

Query: 276 LRLEDELFTVPETFFHPEISNILKPG---LVETIL-ECVSMVPEVLRPL---LVSNIVAV 328
           + L  E   VPE  F P +    + G   L ETIL +     P  L      +V+N++  
Sbjct: 612 MHLNVERIRVPEVIFQPTMGGQDQAGICELSETILLKKFGSQPGKLSQTSIDMVNNVLIT 671

Query: 329 GGNFNIANFATRLATELQRQCPTDWKVRVHQPKLDAALQGWKSMRQFSQTD-SYKNSRVT 387
           GGN  +     R+  E     PT   + V+    D +L  WK M   ++ +  Y+ + ++
Sbjct: 672 GGNAKVPGLKERIVKEFTGFLPTGTNITVNMSS-DPSLDAWKGMAALARNEEQYRKTVIS 730

Query: 388 RSEYLEHGADWCTKHRFGYEQW 409
           + EY E+G ++  +H+ G  ++
Sbjct: 731 KKEYEEYGPEYIKEHKLGNTKY 752

>Ecym_3285 Chr3 complement(539184..541424) [2241 bp, 746 aa] {ON}
           similar to Ashbya gossypii ADL253C
          Length = 746

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 35/146 (23%), Positives = 64/146 (43%), Gaps = 15/146 (10%)

Query: 276 LRLEDELFTVPETFFHPEISNILKPGLVETILECVSMVPEV----------LRPLLVSNI 325
           + L  E   VPE  F P I  + + G+VE    C +++ +           +  ++  NI
Sbjct: 604 MHLNVERIRVPEVIFQPSIGGLDQAGIVEL---CETLLLKKFGSNRRELSEISKMMAKNI 660

Query: 326 VAVGGNFNIANFATRLATELQRQCPTDWKVRVHQPKLDAALQGWKSMRQFSQTDS-YKNS 384
              GGN  +     R+  E     P    + V   + D ++  W+ M +F+   S Y+ S
Sbjct: 661 FITGGNAKLPGIRERVVREFTGFLPVGTNLNVKLAE-DPSMSAWRGMAKFANNTSLYETS 719

Query: 385 RVTRSEYLEHGADWCTKHRFGYEQWI 410
            +T+ EY E G ++  +H  G  +++
Sbjct: 720 IMTKKEYEELGPEYIKEHNLGNAKFV 745

 Score = 30.8 bits (68), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 15/43 (34%), Positives = 25/43 (58%), Gaps = 4/43 (9%)

Query: 164 LVVDSGFNCTWVMPVIKGVPYYKATKKLDIGGR----FLNGLL 202
           + ++SG   T V+PV+ G       K+++ GG+    +LNGLL
Sbjct: 183 IAINSGNEDTSVIPVVNGKGILTEAKRINWGGQQSVGYLNGLL 225

>ZYRO0A01584g Chr1 complement(130119..132365) [2247 bp, 748 aa] {ON}
           highly similar to uniprot|P53946 Saccharomyces
           cerevisiae YNL059C ARP5 Nuclear actin-related protein
           involved in chromatin remodeling component of chromatin-
           remodeling enzyme complexes
          Length = 748

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 35/135 (25%), Positives = 60/135 (44%), Gaps = 13/135 (9%)

Query: 281 ELFTVPETFFHPEISNILKPG---LVETILECVSMVPEVLRPL------LVSNIVAVGGN 331
           E   VPE  F P +    + G   L ET+L  +       R L      +  N+   GGN
Sbjct: 611 ERIRVPEVLFQPNMGGEDQAGIPELCETLL--LRKFGSTQRQLSDVSTSMAQNVWITGGN 668

Query: 332 FNIANFATRLATELQRQCPTDWKVRVHQPKLDAALQGWKSMRQFSQ-TDSYKNSRVTRSE 390
             +     R+  E     P+     + + + D +L  W+ M + +Q T+ +K+  +T+ E
Sbjct: 669 AKLPGLRERIVKEFSEFLPSGSPFSIRKSQ-DPSLDAWRGMAKLAQNTEDFKHGYITKQE 727

Query: 391 YLEHGADWCTKHRFG 405
           YLE+G ++  +H  G
Sbjct: 728 YLEYGPEYIKEHNLG 742

>Skud_14.272 Chr14 complement(502920..505187) [2268 bp, 755 aa] {ON}
           YNL059C (REAL)
          Length = 755

 Score = 51.6 bits (122), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 48/173 (27%), Positives = 81/173 (46%), Gaps = 21/173 (12%)

Query: 253 DFQTSLIG-YVRQPK----QAIPKTSQILRLEDELFTVPETFFHPEISNILKPG---LVE 304
           D++ SL+  ++R P+    + I +  Q + L  E   VPE  F P +    + G   L E
Sbjct: 585 DWRNSLLHLFLRGPRPHDSENIHEQHQ-MHLNVERIRVPEVVFQPTMGGQDQAGICELSE 643

Query: 305 TIL--ECVSMVPEVLRPLL--VSNIVAVGGNFNIANFATRLATELQRQCPTDWKVRVH-- 358
           TIL  +  S   ++    L  V+NI+  GGN  +     R+  E     P    V V+  
Sbjct: 644 TILMKKFGSQRGKLSSTSLDMVNNILITGGNAKVPGLRERIVKEFTEFLPVGTNVAVNIS 703

Query: 359 -QPKLDAALQGWKSMRQFSQTDS-YKNSRVTRSEYLEHGADWCTKHRFGYEQW 409
             P LDA    W+ M   ++  + YK + +++ EY E+G D+  +H+ G  ++
Sbjct: 704 SNPSLDA----WRGMAALARNKAEYKKTVISKEEYEEYGPDYIKEHKLGNTKY 752

 Score = 30.4 bits (67), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 48/218 (22%), Positives = 81/218 (37%), Gaps = 46/218 (21%)

Query: 3   VPLLMENGSYEIKFGPANLETPYRA-RNCLT--RDRYGRYHLS-----NQMDQIRDISHC 54
           +P+ ++ GS  ++ G  N  TP     N LT  RDR    + +       +DQ       
Sbjct: 38  LPIAIDFGSSRLRAGFVNQATPTHIFPNVLTKFRDRKLNKNFTFVGNDTLLDQA---VRS 94

Query: 55  HIRRPSELGQLISWELEEQIWDYCLFNPDEFGWELKDSKDVDLIASETCMTIPEISKNMD 114
             R P +   + +W   E+I DY   +    G    +     ++ +E   T+     N  
Sbjct: 95  QSRSPFDGPFVTNWNFTEEIMDYTFHH---LGVLPNNGISNPILLTERMATVQSQRANWY 151

Query: 115 QVVFEEYEFGSMMKCPVAQFVPFDRARDYDIVGGAGEVVEAKSGYNN------FQLVVDS 168
           Q++FE Y                      ++ G    +    S YNN        LV+D 
Sbjct: 152 QILFETY----------------------NVPGVTFGIDSLYSFYNNNPSGNKTGLVIDC 189

Query: 169 GFNCTWVMPVIKGVPYYKATKKLDIGGR----FLNGLL 202
               T V+P++ G       K+++ GG     +LN L+
Sbjct: 190 SHEDTSVVPIVDGAGILTDAKRINWGGHQAVDYLNDLM 227

>TBLA0E03860 Chr5 complement(969721..972000) [2280 bp, 759 aa] {ON}
           Anc_2.248 YNL059C
          Length = 759

 Score = 50.8 bits (120), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 36/144 (25%), Positives = 61/144 (42%), Gaps = 9/144 (6%)

Query: 270 PKTSQILRLEDELFTVPETFFHPEISNILKPGLVET----ILECVSMVPEVLRPL---LV 322
           P     + +  E   VPE  F P I    + G+ E      L   +  P  L  +   ++
Sbjct: 611 PHQQHQIHMNVERIRVPEVMFQPSIGGCDQAGISELSETLFLRKFNSSPRKLSSISERML 670

Query: 323 SNIVAVGGNFNIANFATRLATELQRQCPTDWKVRVHQPKLDAALQGWKSMRQF-SQTDSY 381
           +N+   GG+  +     R+  E     P   K+ ++    D +L  WK M +  S TD  
Sbjct: 671 NNVWLTGGHAKLPGLKERIVKEYTEFLPVGTKMSINISN-DPSLDTWKGMAKLASNTDYL 729

Query: 382 KNSRVTRSEYLEHGADWCTKHRFG 405
           K  +VT+ +Y E+G ++  +H  G
Sbjct: 730 KKIQVTKKDYEEYGPEYMMEHNLG 753

 Score = 43.9 bits (102), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 56/242 (23%), Positives = 101/242 (41%), Gaps = 34/242 (14%)

Query: 3   VPLLMENGSYEIKFGPANLETPYRA-RNCLTRDRYGRYHLSNQMDQIRDISHC------H 55
           +P+ ++ GSY +K G  N   P     N LTR  Y    L+  M  I + ++        
Sbjct: 37  IPIAIDFGSYNVKAGYTNQSLPTHVFTNKLTR--YRDRKLAKTMTFIGNDTNLDQPLRIQ 94

Query: 56  IRRPSELGQLISWELEEQIWDYCLFNPDEFGWELKD-SKDVDLIASETCMTIPEISKNMD 114
            +RP +   + +WE  E+I+DY L +    G +  + S    +I +E    +     N  
Sbjct: 95  AKRPYDGLFIANWEYAEEIFDYTLHH---LGVQTTNGSISNPIILTEKMACLQSQRANWY 151

Query: 115 QVVFEEYEFGSMMKCPVAQFVPFDRARDYDIVGGAGEVVEAKSGYNNFQLVVDSGFNCTW 174
           Q++FE ++       P A F   D    Y          E+        LV++ G   T 
Sbjct: 152 QLLFETFD------VPSATF-GLDSL--YAFYNNCANPFESDG------LVINCGHEDTN 196

Query: 175 VMPVIKGVPYYKATKKLDIGGR----FLNGLLKETISFRHYNVMDETILINNIKEQCCFM 230
           ++P+++G       K+++ GGR    +L+ LL  T+ + ++           + E  C++
Sbjct: 197 IVPIVQGKGILTEAKRINWGGRHSTEYLSSLL--TLKYPYFPTKLSEFQYQTMYEDFCYV 254

Query: 231 PP 232
            P
Sbjct: 255 SP 256

>Kpol_282.4 s282 (8483..9988) [1506 bp, 501 aa] {ON} (8483..9988)
           [1506 nt, 502 aa]
          Length = 501

 Score = 50.1 bits (118), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 35/115 (30%), Positives = 51/115 (44%), Gaps = 2/115 (1%)

Query: 291 HPEISNILKPGLVETILECVSMVPEVLRPLLVSNIVAVGGNFNIANFATRLATELQRQCP 350
           +P  S+++ PG+V+ I   +      LR  L  NIV  GG   I  F+ RL  EL ++ P
Sbjct: 387 NPTESSVI-PGIVDLIESSIMATDVDLRASLAHNIVLTGGTSCIPGFSDRLMLELNKKLP 445

Query: 351 T-DWKVRVHQPKLDAALQGWKSMRQFSQTDSYKNSRVTRSEYLEHGADWCTKHRF 404
              ++V       +   Q W      S   ++    V + EY E GAD   K RF
Sbjct: 446 ALKFRVLTTGQTRERQYQAWLGGSILSSLGTFHQLWVGKQEYEESGADRLLKDRF 500

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 38/148 (25%), Positives = 61/148 (41%), Gaps = 23/148 (15%)

Query: 63  GQLISWELEEQIWDYCLFNPDEFGWELKDSKDVDLIASETCMTIPEISKNMDQVVFEEYE 122
           G++I W+  ++ WD+ L N       L+ +  +    +E      E  K   +V+ E  +
Sbjct: 95  GEVIDWDGAQEQWDWALKN----ALYLESNSGIPAFLTEPIWNTVENRKKSLEVLLEGLQ 150

Query: 123 FGSMMKCPVAQFVPFDRARDYDIVGGAGEVVEAKSGYNNFQLVVDSGFNCTWVMPVIKGV 182
           F +    P    + F                   SG  N  LVVD G +   V PVI G+
Sbjct: 151 FEACYLSPTPTCISF------------------ASGRPNC-LVVDIGHDVASVSPVIDGM 191

Query: 183 PYYKATKKLDIGGRFLNGLLKETISFRH 210
              K++ +  I GRF+N  +KE +  R 
Sbjct: 192 TLSKSSMRNFISGRFINEKIKEFLKPRE 219

>CAGL0J10054g Chr10 complement(985402..987666) [2265 bp, 754 aa]
           {ON} highly similar to uniprot|P53946 Saccharomyces
           cerevisiae YNL059c ARP5 Actin-related protein
          Length = 754

 Score = 50.1 bits (118), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 37/136 (27%), Positives = 57/136 (41%), Gaps = 15/136 (11%)

Query: 281 ELFTVPETFFHPEISNILKPGLVET----ILECVSMVPEVLRPL---LVSNIVAVGGNFN 333
           E   VPE  F P +    + G+ E     I +     P  L      +  N+  VGGN  
Sbjct: 617 ERIRVPEVMFQPILGGQDQAGITEICETIITKKFGSTPRNLSQQSLDMAKNVWLVGGNAQ 676

Query: 334 IANFATRLATELQRQCPTDWKVRVH---QPKLDAALQGWKSMRQFSQT-DSYKNSRVTRS 389
           +    +R+  E     P+D K+ V+    P LD     W  M + + T + Y+ + VT  
Sbjct: 677 VPGLKSRVVKEFTEFLPSDTKINVNISEAPTLDV----WNGMYRLANTEEDYQRTIVTSE 732

Query: 390 EYLEHGADWCTKHRFG 405
           EY E G D+  +H+  
Sbjct: 733 EYDECGVDYLKEHKLS 748

 Score = 38.9 bits (89), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 49/213 (23%), Positives = 89/213 (41%), Gaps = 37/213 (17%)

Query: 3   VPLLMENGSYEIKFGPANLETP---YRARNCLTRDRYGRYHL-----SNQMDQIRDISHC 54
           +P+ ++ GSYE++ G  N+  P   +  R    RDR    +L        +DQ    +  
Sbjct: 41  IPIAIDFGSYELRAGYTNISRPSHIFPNRFSKYRDRKTNKYLPCIGYDTWLDQT---TRS 97

Query: 55  HIRRPSELGQLISWELEEQIWDYCLFNPDEFGWELKDSKDVDLIASETCMTIPEISKNMD 114
             R P +   +++W++ E I  Y   +    G +  +     +I +E    +     N  
Sbjct: 98  QARSPFDGPLVVNWDMVEDILQYTFHH---LGVQPDNGVTNPIIINEKLACLQSQRSNWY 154

Query: 115 QVVFEEYEFG-SMMKCPVAQFVPFDRARDYDIVGGAGEVVEAKSGYNNFQLVVDSGFNCT 173
           Q +FE   FG   +   V   + F     Y   GG+       +G     +V+D G+  T
Sbjct: 155 QTLFES--FGVPKVSMAVEGMLAF-----YGHNGGSS------TG-----IVIDCGYEDT 196

Query: 174 WVMPVIKGVPYYKATKKLDIGGR----FLNGLL 202
            V+P+++G       K+++ GG     +L+ LL
Sbjct: 197 NVIPIVEGQGMMLDAKRINWGGHSSIDYLSNLL 229

>NDAI0G05580 Chr7 complement(1374852..1376399) [1548 bp, 515 aa]
           {ON} Anc_1.287
          Length = 515

 Score = 49.7 bits (117), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 40/149 (26%), Positives = 67/149 (44%), Gaps = 23/149 (15%)

Query: 55  HIRRPSELGQLISWELEEQIWDYCLFNPDEFGWELKDSKDVDLIASETCMTIPEISKNMD 114
            I+R  E G++  W+  ++ WD+ L N + F   LK +  + ++ +E      E  K   
Sbjct: 73  EIKRIVENGEIADWDTAQEQWDWVLKN-ELF---LKSNSGIPVLLTEPIWNSVENRKKSL 128

Query: 115 QVVFEEYEFGSMMKCPVAQFVPFDRARDYDIVGGAGEVVEAKSGYNNFQLVVDSGFNCTW 174
           +V+ E  +F +    PV+  V F   R                      LVVD G + T 
Sbjct: 129 EVLLEGMDFEACYLSPVSTCVSFAAGRPN-------------------CLVVDIGHDTTS 169

Query: 175 VMPVIKGVPYYKATKKLDIGGRFLNGLLK 203
           V PVI G+   K++ +  I GR++N L++
Sbjct: 170 VSPVIDGMTLSKSSTRNFIAGRYINHLIE 198

 Score = 33.5 bits (75), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 24/89 (26%), Positives = 35/89 (39%), Gaps = 1/89 (1%)

Query: 317 LRPLLVSNIVAVGGNFNIANFATRLATELQRQCPT-DWKVRVHQPKLDAALQGWKSMRQF 375
           LR  L  N+V  GG   I     RL  EL ++ P   +++       +   Q W      
Sbjct: 426 LRASLAHNVVITGGTSCIPRLNDRLMYELSKRLPALKFRILTTGHLREKQYQAWLGGSIL 485

Query: 376 SQTDSYKNSRVTRSEYLEHGADWCTKHRF 404
           +   ++    V + EY E GAD     RF
Sbjct: 486 TSLGTFHQLWVGKEEYKEVGADRLLVDRF 514

>AFR105C Chr6 complement(625098..626537) [1440 bp, 479 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJL081C
           (ARP4)
          Length = 479

 Score = 46.6 bits (109), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 70/325 (21%), Positives = 130/325 (40%), Gaps = 53/325 (16%)

Query: 5   LLMENGSYEIKFGPANLETPYRARNCLTRDRYGRYHLSNQMDQIRDISHCHIRRPSEL-- 62
           ++++ GS+    G +  + P      +    YG+Y    + +   + S    R+  E+  
Sbjct: 17  VVIDPGSFTTNIGYSGTDCP----QAILPSCYGKYTEGEKDELFSEQSIGLPRKDYEIHN 72

Query: 63  ----GQLISWELEEQIWDYCLFNPDEFGWELKDSKDVDLIASETCMTIPEISKNMDQVVF 118
               G+++ WE  E+ WD+ + +   F    + +  +  + +E      E  K   +V+ 
Sbjct: 73  IVQNGEVVDWEKAEKQWDWAIRSELRF----ETNSGMPALLTEPIWNSEENRKKSLEVLL 128

Query: 119 EEYEFGSMMKCPVAQFVPFDRARDYDIVGGAGEVVEAKSGYNNFQLVVDSGFNCTWVMPV 178
           E  +F +    P A  V F   R                      LVVD G + T V PV
Sbjct: 129 ESMDFSACYLVPTATAVSFAMGRPT-------------------CLVVDIGHDVTSVCPV 169

Query: 179 IKGVPYYKATKKLDIGGRFLNGLLKETISFRH----YNVMDETILINNIKEQCCFMPPVS 234
           + G+   K++ +  I G  LN L++  ++ R     + V     +    K      P + 
Sbjct: 170 VDGMTLSKSSMRSYIAGSLLNELIRSQLAPRKVIPLFQVAQRRPVFMERKFDYEIHPSLQ 229

Query: 235 YFDS----FQRKEETRVEYILP--------DFQTSLIGYVRQP--KQAIPKTSQILRLED 280
            F +    FQ  +ET ++ + P        + +T+    +  P  ++ +  + Q L   +
Sbjct: 230 KFVNERQFFQEFKETMLQ-VAPTSISKFKSEIETTSKRSIEAPWGEELVYDSLQRLEFAE 288

Query: 281 ELFTVPETFFHPEISNILKPGLVET 305
           +LFT P+    PE   I K G+VET
Sbjct: 289 QLFT-PDLSQFPEDWPISKDGVVET 312

 Score = 43.9 bits (102), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 28/105 (26%), Positives = 43/105 (40%), Gaps = 1/105 (0%)

Query: 301 GLVETILECVSMVPEVLRPLLVSNIVAVGGNFNIANFATRLATELQRQCPT-DWKVRVHQ 359
           GL + I   +      LR  L  N+V  GG  ++     R++ EL R  P   +++    
Sbjct: 374 GLADLIYSSIMSTDVDLRTTLSHNVVITGGTSSLPGLMDRISAELNRSLPALKFRMLTSG 433

Query: 360 PKLDAALQGWKSMRQFSQTDSYKNSRVTRSEYLEHGADWCTKHRF 404
              +   QGW      +   ++    V + EY E GAD   K RF
Sbjct: 434 QLRERQYQGWLGGSILASLGTFHQLWVGKQEYAEVGADRLLKDRF 478

>TBLA0D05360 Chr4 (1321243..1323033) [1791 bp, 596 aa] {ON}
           Anc_1.287 YJL081C
          Length = 596

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 35/141 (24%), Positives = 59/141 (41%), Gaps = 2/141 (1%)

Query: 265 PKQAIPKTSQILRLEDELFTVPETFFHPEISNILKPGLVETILECVSMVPEVLRPLLVSN 324
           P + I +  +    + E   VP+     +I NI+ PG+ + +   V+     LR  L  N
Sbjct: 456 PSENINENGKRSIEDGENVDVPKKSDKKDIDNII-PGIADLVEATVNSSDVDLRATLAHN 514

Query: 325 IVAVGGNFNIANFATRLATELQRQCPT-DWKVRVHQPKLDAALQGWKSMRQFSQTDSYKN 383
           ++  GG   I   A RL  EL ++ P   +++     + +   Q W      +   ++  
Sbjct: 515 VILTGGTSLIPGLADRLMYELNKKLPALKFRILSSGHRRERKYQAWLGGSILTSLGTFHQ 574

Query: 384 SRVTRSEYLEHGADWCTKHRF 404
             V + EY E G D   K RF
Sbjct: 575 LWVGKREYEEVGPDRLLKDRF 595

 Score = 39.7 bits (91), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 40/162 (24%), Positives = 64/162 (39%), Gaps = 29/162 (17%)

Query: 52  SHCHIRRPSELGQLISWELEEQIWDYCLFNP---DEFGWELKDSKDVDLIASETCMTIPE 108
           S   ++R  E G +  W++ E+ W + L      D F       K +  + +E      +
Sbjct: 157 SDYQVKRIIENGMVADWDIAEEQWSWALREKLYMDSF-------KGIPALLTEPVWNTVQ 209

Query: 109 ISKNMDQVVFEEYEFGSMMKCPVAQFVPFDRARDYDIVGGAGEVVEAKSGYNNFQLVVDS 168
             K   +V+ E+ EF +     +   V F                   +G  N  LVVD 
Sbjct: 210 NRKKSLEVLLEKMEFEACYLTTIPTNVSF------------------AAGKPNC-LVVDV 250

Query: 169 GFNCTWVMPVIKGVPYYKATKKLDIGGRFLNGLLKETISFRH 210
           G +   V PVI G+   K+ ++    GR+LN LL+  I  R 
Sbjct: 251 GHDTCSVSPVIDGMTLTKSVRRNFFAGRYLNRLLENYIKPRE 292

>YJL081C Chr10 complement(283802..285271) [1470 bp, 489 aa] {ON}
           ARP4Nuclear actin-related protein involved in chromatin
           remodeling, component of chromatin-remodeling enzyme
           complexes
          Length = 489

 Score = 44.7 bits (104), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 45/209 (21%), Positives = 80/209 (38%), Gaps = 34/209 (16%)

Query: 5   LLMENGSYEIKFGPANLETPYRARNCLTRDRYGRYHLSNQMDQIRDISHCHIRRPS---- 60
           ++++ GSY    G +  + P      +    YG+Y       +I       I R      
Sbjct: 17  VVIDPGSYTTNIGYSGSDFP----QSILPSVYGKYTADEGNKKIFSEQSIGIPRKDYELK 72

Query: 61  ---ELGQLISWELEEQIWDYCLFNPDEFGWELKDSKDVDLIASETCMTIPEISKNMDQVV 117
              E G +I W+  ++ W + L N       L  +  +  + +E      E  K   +V+
Sbjct: 73  PIIENGLVIDWDTAQEQWQWALQNE----LYLNSNSGIPALLTEPVWNSTENRKKSLEVL 128

Query: 118 FEEYEFGSMMKCPVAQFVPFDRARDYDIVGGAGEVVEAKSGYNNFQLVVDSGFNCTWVMP 177
            E  +F +    P +  V F   R                      LVVD G +   V P
Sbjct: 129 LEGMQFEACYLAPTSTCVSFAAGRPN-------------------CLVVDIGHDTCSVSP 169

Query: 178 VIKGVPYYKATKKLDIGGRFLNGLLKETI 206
           ++ G+   K+T++  I G+F+N L+K+ +
Sbjct: 170 IVDGMTLSKSTRRNFIAGKFINHLIKKAL 198

 Score = 38.9 bits (89), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 25/105 (23%), Positives = 43/105 (40%), Gaps = 1/105 (0%)

Query: 301 GLVETILECVSMVPEVLRPLLVSNIVAVGGNFNIANFATRLATELQRQCPT-DWKVRVHQ 359
           GL + +   +      LR  L  N+V  GG  +I   + RL TEL +  P+  +++    
Sbjct: 384 GLADLVYSSIMSSDVDLRATLAHNVVLTGGTSSIPGLSDRLMTELNKILPSLKFRILTTG 443

Query: 360 PKLDAALQGWKSMRQFSQTDSYKNSRVTRSEYLEHGADWCTKHRF 404
             ++   Q W      +   ++    V + EY E G +     RF
Sbjct: 444 HTIERQYQSWLGGSILTSLGTFHQLWVGKKEYEEVGVERLLNDRF 488

>TPHA0I01030 Chr9 complement(236150..237661) [1512 bp, 503 aa] {ON}
           Anc_1.287 YJL081C
          Length = 503

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 29/106 (27%), Positives = 45/106 (42%), Gaps = 1/106 (0%)

Query: 300 PGLVETILECVSMVPEVLRPLLVSNIVAVGGNFNIANFATRLATELQRQCPT-DWKVRVH 358
           PG+V+ I   ++     LR  L  N+V  GG   I   + R+  EL ++ P   ++V  +
Sbjct: 397 PGIVDLIESSINAADVDLRTSLAHNVVLTGGTSCIPGLSDRILLELNKRLPALKFRVLAN 456

Query: 359 QPKLDAALQGWKSMRQFSQTDSYKNSRVTRSEYLEHGADWCTKHRF 404
               +   Q W      S   ++    V + EY E GAD     RF
Sbjct: 457 GQTRERQYQSWLGGSILSSLGTFHQLWVGKQEYEEIGADRLLTDRF 502

 Score = 40.0 bits (92), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 36/148 (24%), Positives = 65/148 (43%), Gaps = 23/148 (15%)

Query: 63  GQLISWELEEQIWDYCLFNPDEFGWELKDSKDVDLIASETCMTIPEISKNMDQVVFEEYE 122
           G+++ W+  ++ W + L N + F   LK ++ V  + +E      E  K   +V+ E   
Sbjct: 101 GEVVDWDAAQEQWSWALEN-ELF---LKSNEGVPALLTEPIWNTVENRKKSLEVLLEGMG 156

Query: 123 FGSMMKCPVAQFVPFDRARDYDIVGGAGEVVEAKSGYNNFQLVVDSGFNCTWVMPVIKGV 182
           F +         V F                   +G +N  LVVD G +   V PV+ G+
Sbjct: 157 FEACYLSATPTCVSF------------------AAGRSNC-LVVDIGHDIISVSPVVDGM 197

Query: 183 PYYKATKKLDIGGRFLNGLLKETISFRH 210
            + K+T++  I G++LN L+ + +  R 
Sbjct: 198 TFSKSTRRNVISGKYLNVLINDFLKPRE 225

>Kwal_14.2377 s14 complement(733179..734624) [1446 bp, 481 aa] {ON}
           YJL081C (ARP4) - 54.8 kDa actin-related protein [contig
           225] FULL
          Length = 481

 Score = 43.9 bits (102), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 30/112 (26%), Positives = 51/112 (45%), Gaps = 9/112 (8%)

Query: 294 ISNILKPGLVETILECVSMVPEVLRPLLVSNIVAVGGNFNIANFATRLATELQRQCPT-D 352
           ++N++   ++ET ++        LR  L  N+V  GG+ +I   A RL TEL ++ P   
Sbjct: 377 LANLVNTAIMETDVD--------LRATLAHNLVVTGGSSSILGLADRLMTELNKKLPALK 428

Query: 353 WKVRVHQPKLDAALQGWKSMRQFSQTDSYKNSRVTRSEYLEHGADWCTKHRF 404
           +++       +   + W      S   ++    V R EY E GA+   K RF
Sbjct: 429 FRILTSGHLRERQSRAWLGGSILSSLGTFHQLWVGRQEYEEVGAERLLKDRF 480

 Score = 43.9 bits (102), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 47/214 (21%), Positives = 83/214 (38%), Gaps = 35/214 (16%)

Query: 5   LLMENGSYEIKFGPANLETPYRARNCLTRDRYGRYHLSNQ------MDQIRDISH--CHI 56
           ++++ GSY    G +  ++P           YG+Y    +       DQ   ++     I
Sbjct: 17  VVIDPGSYSTNIGYSGTDSP----QINIPSSYGQYTGGEKEGKKSFNDQFMGMARPDFEI 72

Query: 57  RRPSELGQLISWELEEQIWDYCLFNPDEFGWELKDSKDVDLIASETCMTIPEISKNMDQV 116
           +R  E G ++ WE  ++ W + + +  +FG      K      +E      E  K   +V
Sbjct: 73  KRILEDGCVVDWEAAQEQWTWAIRDELKFG----SFKGTPAFLTEAIWNSEENRKKSLEV 128

Query: 117 VFEEYEFGSMMKCPVAQFVPFDRARDYDIVGGAGEVVEAKSGYNNFQLVVDSGFNCTWVM 176
           + E  EF +    P A  V F   R                      LVVD G +   V 
Sbjct: 129 LLEGMEFEACYIAPTATCVSFAMGRPT-------------------CLVVDIGHDVASVC 169

Query: 177 PVIKGVPYYKATKKLDIGGRFLNGLLKETISFRH 210
           PV+ G+   K++ +  + G+ LN L+++ +  R 
Sbjct: 170 PVVDGMTLSKSSTRNFLAGKLLNKLIEKHLEPRE 203

>Suva_6.154 Chr6 (266531..268000) [1470 bp, 489 aa] {ON} YJL081C
           (REAL)
          Length = 489

 Score = 43.5 bits (101), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 35/146 (23%), Positives = 60/146 (41%), Gaps = 23/146 (15%)

Query: 61  ELGQLISWELEEQIWDYCLFNPDEFGWELKDSKDVDLIASETCMTIPEISKNMDQVVFEE 120
           E G +I W+  ++ W + L N       L  +  +  + +E      E  K   +V+ E 
Sbjct: 76  ENGLVIDWDTAQEQWQWALKNE----LYLDSNSGIPALLTEPVWNSTENRKKSLEVLLEG 131

Query: 121 YEFGSMMKCPVAQFVPFDRARDYDIVGGAGEVVEAKSGYNNFQLVVDSGFNCTWVMPVIK 180
            +F +    P +  V F   R                      LVVD G +   V P++ 
Sbjct: 132 MQFEACYLAPTSTCVSFAAGRPN-------------------CLVVDIGHDTCSVSPIVD 172

Query: 181 GVPYYKATKKLDIGGRFLNGLLKETI 206
           G+   K+T++  I G+F+N L+K+ I
Sbjct: 173 GMTLSKSTRRNFIAGKFINHLIKKAI 198

 Score = 39.3 bits (90), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 26/105 (24%), Positives = 42/105 (40%), Gaps = 1/105 (0%)

Query: 301 GLVETILECVSMVPEVLRPLLVSNIVAVGGNFNIANFATRLATELQRQCPT-DWKVRVHQ 359
           GL + +   +      LR  L  N+V  GG  +I   + RL TEL +  P+  +++    
Sbjct: 384 GLADLVYSSIMSSDVDLRATLAHNVVLTGGTSSIPGLSDRLMTELNKILPSLKFRILTTG 443

Query: 360 PKLDAALQGWKSMRQFSQTDSYKNSRVTRSEYLEHGADWCTKHRF 404
              +   Q W      +   ++    V + EY E G D     RF
Sbjct: 444 HTRERQYQSWLGGSILTSLGTFHQLWVGKQEYEEVGVDRLLNDRF 488

>KLTH0H09702g Chr8 complement(835255..836700) [1446 bp, 481 aa] {ON}
           similar to uniprot|P80428 Saccharomyces cerevisiae
           YJL081C ARP4 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin-remodeling
           enzyme complexes
          Length = 481

 Score = 43.1 bits (100), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 28/105 (26%), Positives = 45/105 (42%), Gaps = 1/105 (0%)

Query: 301 GLVETILECVSMVPEVLRPLLVSNIVAVGGNFNIANFATRLATELQRQCPT-DWKVRVHQ 359
           GL + +   ++     LR  L  N+V  GG+ +I     RL TEL ++ P   +++    
Sbjct: 376 GLADLVNTAITATDVDLRATLAHNLVVTGGSSSIPGLTDRLMTELNKKLPALKFRILTSG 435

Query: 360 PKLDAALQGWKSMRQFSQTDSYKNSRVTRSEYLEHGADWCTKHRF 404
              +   + W      S   ++    V R EY E GA+   K RF
Sbjct: 436 HLRERQSRAWLGGSILSSLGTFHQLWVGRQEYEEVGAERLLKDRF 480

 Score = 40.4 bits (93), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 47/215 (21%), Positives = 81/215 (37%), Gaps = 37/215 (17%)

Query: 5   LLMENGSYEIKFGPANLETP-YRARNCLTRDRYGRYHLSNQMDQ--------IRDISHCH 55
           ++++ GSY    G +  ++P     +C     YG+Y    +  Q        I       
Sbjct: 17  VVIDPGSYSTNIGYSGTDSPQLNIPSC-----YGQYTAGGKEGQKSFNDQFMIMPRPDFE 71

Query: 56  IRRPSELGQLISWELEEQIWDYCLFNPDEFGWELKDSKDVDLIASETCMTIPEISKNMDQ 115
           I+R  E G ++ WE  ++ W + +   DE  +E    K      +E      E  K   +
Sbjct: 72  IKRILENGCVVDWEAAQEQWAWAIR--DELKFE--SFKGTPAFLTEAIWNPEENRKKSLE 127

Query: 116 VVFEEYEFGSMMKCPVAQFVPFDRARDYDIVGGAGEVVEAKSGYNNFQLVVDSGFNCTWV 175
           V+ E  EF +    P A    F   R                      LV+D G +   V
Sbjct: 128 VLLEGMEFEACYIAPTATCTSFAMGRPT-------------------CLVLDIGHDVASV 168

Query: 176 MPVIKGVPYYKATKKLDIGGRFLNGLLKETISFRH 210
            PV+ G+   K++ +  + G+ LN L++  +  R 
Sbjct: 169 CPVVDGMTLSKSSTRNFLAGKLLNKLIENHLKPRE 203

>Ecym_6330 Chr6 (632900..634342) [1443 bp, 480 aa] {ON} similar to
           Ashbya gossypii AFR105C
          Length = 480

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 30/114 (26%), Positives = 46/114 (40%), Gaps = 2/114 (1%)

Query: 292 PEISNILKPGLVETILECVSMVPEVLRPLLVSNIVAVGGNFNIANFATRLATELQRQCPT 351
           PE  N +  GL + I   +      LR  L  N+V  GG+ +I     R+  EL +  P 
Sbjct: 367 PEAKNEIS-GLADLIHSSIMSTDVDLRTTLAHNVVITGGSSSIPGLTDRILAELNKSLPA 425

Query: 352 -DWKVRVHQPKLDAALQGWKSMRQFSQTDSYKNSRVTRSEYLEHGADWCTKHRF 404
             +++       +   Q W      +   ++    V + EY E GAD   K RF
Sbjct: 426 LKFRMLTSGQAREKQYQSWLGGSILASLGTFHQLWVGKQEYAEVGADRLLKDRF 479

 Score = 38.5 bits (88), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 33/148 (22%), Positives = 62/148 (41%), Gaps = 23/148 (15%)

Query: 63  GQLISWELEEQIWDYCLFNPDEFGWELKDSKDVDLIASETCMTIPEISKNMDQVVFEEYE 122
           G+++ W+  ++ W++ + +   F    + +K +  + +E      +  K   +V+ E  +
Sbjct: 78  GEVVDWDKAQEQWEWAIKSVLLF----ESNKGLPALLTEPIWNSEDNRKKSLEVLLEGMD 133

Query: 123 FGSMMKCPVAQFVPFDRARDYDIVGGAGEVVEAKSGYNNFQLVVDSGFNCTWVMPVIKGV 182
           F +    P A  V F   R                      LVVD G + T V PVI G+
Sbjct: 134 FEACYLTPTATAVSFAMGRPT-------------------CLVVDIGHDITSVSPVIDGM 174

Query: 183 PYYKATKKLDIGGRFLNGLLKETISFRH 210
              K++ +  I G  LN L++ ++  R 
Sbjct: 175 TLSKSSMRSFIAGGLLNELIRTSLKPRE 202

>CAGL0M03201g Chr13 complement(364771..366252) [1482 bp, 493 aa]
           {ON} similar to uniprot|P80428 Saccharomyces cerevisiae
           YJL081c ACT3 protein Actin-like protein ARP4
          Length = 493

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 35/156 (22%), Positives = 60/156 (38%), Gaps = 23/156 (14%)

Query: 55  HIRRPSELGQLISWELEEQIWDYCLFNPDEFGWELKDSKDVDLIASETCMTIPEISKNMD 114
            ++R  E GQ+  W+   + W + L N       ++ ++ +  + +E      E      
Sbjct: 82  EVKRVVENGQVCDWDSAVEQWSWALRNE----LHIESNRGIPAMLTEPLWNSKENRSKSL 137

Query: 115 QVVFEEYEFGSMMKCPVAQFVPFDRARDYDIVGGAGEVVEAKSGYNNFQLVVDSGFNCTW 174
           +++ E  EF +      +  V F   R                      L+VD G +   
Sbjct: 138 EILLEGMEFEACYLTATSTAVSFATGRPN-------------------SLIVDIGHDIAS 178

Query: 175 VMPVIKGVPYYKATKKLDIGGRFLNGLLKETISFRH 210
           V PVI G+   K+T+     GRFLN LL + +  R 
Sbjct: 179 VTPVIDGMSLSKSTRCNHFAGRFLNKLLTDYLKPRE 214

 Score = 38.5 bits (88), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 25/106 (23%), Positives = 44/106 (41%), Gaps = 1/106 (0%)

Query: 300 PGLVETILECVSMVPEVLRPLLVSNIVAVGGNFNIANFATRLATELQRQCPT-DWKVRVH 358
           PG+V+ I   +S     +R  L  N+V  GG+  I   + R+  EL  + P   ++V   
Sbjct: 387 PGIVDLISSSISSCDVDIRASLAHNLVITGGSSTIPGLSDRILNELNMKFPALKFRVLAT 446

Query: 359 QPKLDAALQGWKSMRQFSQTDSYKNSRVTRSEYLEHGADWCTKHRF 404
              ++   Q W      S   ++    + + EY E G++     R 
Sbjct: 447 GQSIERQYQSWLGGSILSSLGTFHQLWIGKKEYEEVGSERLLHDRL 492

>Smik_10.161 Chr10 complement(275455..276924) [1470 bp, 489 aa] {ON}
           YJL081C (REAL)
          Length = 489

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 45/209 (21%), Positives = 80/209 (38%), Gaps = 34/209 (16%)

Query: 5   LLMENGSYEIKFGPANLETPYRARNCLTRDRYGRYHLSNQMDQIRDISHCHI-RRPSEL- 62
           ++++ GSY    G +  + P      +    YG+Y        I       I R+  EL 
Sbjct: 17  VVIDPGSYTTNIGYSGSDFP----QSILPSVYGKYTADEGKKNIFSEQSIGIPRKDYELK 72

Query: 63  -----GQLISWELEEQIWDYCLFNPDEFGWELKDSKDVDLIASETCMTIPEISKNMDQVV 117
                G +I W+  ++ W + L N       L  +     + +E      E  K   +V+
Sbjct: 73  PIVKDGLVIDWDTAQEQWQWALKNE----LYLNSNSGTPALLTEPVWNSTENRKKSLEVL 128

Query: 118 FEEYEFGSMMKCPVAQFVPFDRARDYDIVGGAGEVVEAKSGYNNFQLVVDSGFNCTWVMP 177
            E  +F +    P +  V F   R                      LVVD G +   V P
Sbjct: 129 LEGMQFEACYLAPTSTCVSFAAGRPN-------------------CLVVDIGHDTCSVSP 169

Query: 178 VIKGVPYYKATKKLDIGGRFLNGLLKETI 206
           ++ G+   K+T++  + G+F+N L+K+ +
Sbjct: 170 IVDGMTLSKSTRRNFLAGKFINHLIKKAL 198

 Score = 36.6 bits (83), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 25/105 (23%), Positives = 41/105 (39%), Gaps = 1/105 (0%)

Query: 301 GLVETILECVSMVPEVLRPLLVSNIVAVGGNFNIANFATRLATELQRQCPT-DWKVRVHQ 359
           GL   +   +      LR  L  N+V  GG   I   + RL TEL +  P+  +++    
Sbjct: 384 GLAHLVYSSIMSSDVDLRATLAHNVVLTGGTSLIPGLSDRLMTELNKILPSLKFRILTTG 443

Query: 360 PKLDAALQGWKSMRQFSQTDSYKNSRVTRSEYLEHGADWCTKHRF 404
             ++   Q W      +   ++    V + EY E G +     RF
Sbjct: 444 HTMERQYQSWLGGSILTSLGTFHQLWVGKKEYEEVGVERLLNDRF 488

>Skud_10.132 Chr10 complement(251748..253214) [1467 bp, 488 aa] {ON}
           YJL081C (REAL)
          Length = 488

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 44/206 (21%), Positives = 81/206 (39%), Gaps = 28/206 (13%)

Query: 5   LLMENGSYEIKFGPANLETPYR----ARNCLTRDRYGRYHLSNQMDQIRDISHCHIRRPS 60
           ++++ GSY    G +  + P          LT D   +   S Q   I    +  ++   
Sbjct: 17  VVIDPGSYTTNIGYSGSDFPQSILPSVYGKLTADENSKKMFSEQSIGIPRKDY-ELKPII 75

Query: 61  ELGQLISWELEEQIWDYCLFNPDEFGWELKDSKDVDLIASETCMTIPEISKNMDQVVFEE 120
           E G +I W+  ++ W + L N       L  +  +  + +E      E  K   +V+ E 
Sbjct: 76  ENGLVIDWDTAQEQWQWALRNE----LYLDSNSGIPALLTEPVWNSMENRKKSLEVLLEG 131

Query: 121 YEFGSMMKCPVAQFVPFDRARDYDIVGGAGEVVEAKSGYNNFQLVVDSGFNCTWVMPVIK 180
            +F +    P +  V F   R                      LVVD G +   V P++ 
Sbjct: 132 MQFEACYLAPTSTCVSFAAGRPN-------------------CLVVDIGHDTCSVSPIVD 172

Query: 181 GVPYYKATKKLDIGGRFLNGLLKETI 206
           G+   K+T++  I G+F+N L+++ +
Sbjct: 173 GMTLSKSTRRNFIAGKFINHLIQKAL 198

 Score = 35.0 bits (79), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 23/89 (25%), Positives = 37/89 (41%), Gaps = 1/89 (1%)

Query: 317 LRPLLVSNIVAVGGNFNIANFATRLATELQRQCPT-DWKVRVHQPKLDAALQGWKSMRQF 375
           LR  L  N+V  GG  +I   + RL TEL +  P+  +++       +   Q W      
Sbjct: 399 LRATLAHNVVLTGGTSSIPGLSDRLMTELNKILPSLKFRILTTGHIRERQYQSWLGGSIL 458

Query: 376 SQTDSYKNSRVTRSEYLEHGADWCTKHRF 404
           +   ++    V + EY E G +     RF
Sbjct: 459 TSLGTFHQLWVGKQEYEEVGIERLLNDRF 487

>ZYRO0G21428g Chr7 (1766725..1768176) [1452 bp, 483 aa] {ON} highly
           similar to uniprot|P80428 Saccharomyces cerevisiae
           YJL081C ARP4 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin- remodeling
           enzyme complexes
          Length = 483

 Score = 40.8 bits (94), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 27/105 (25%), Positives = 45/105 (42%), Gaps = 1/105 (0%)

Query: 301 GLVETILECVSMVPEVLRPLLVSNIVAVGGNFNIANFATRLATELQRQCPT-DWKVRVHQ 359
           G+ + +   ++     LR  L  NIV  GG+ ++  F+ RL  EL ++ P   ++V    
Sbjct: 378 GISDLVHSSITSADVDLRATLAHNIVLTGGSSSVPGFSDRLMNELTKKLPALKFRVLTTG 437

Query: 360 PKLDAALQGWKSMRQFSQTDSYKNSRVTRSEYLEHGADWCTKHRF 404
              +   Q W      +   S+    V + EY E GA+     RF
Sbjct: 438 HLRERQYQSWLGGSILTSLGSFHQLWVGKREYEEVGAERLLNDRF 482

 Score = 37.7 bits (86), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 55/278 (19%), Positives = 97/278 (34%), Gaps = 73/278 (26%)

Query: 61  ELGQLISWELEEQIWDYCLFNPDEFGWELKDSKDVDLIASETCMTIPEISKNMDQVVFEE 120
           E G ++ W+  ++ WD+ L N       L+ +K V  + +E+     E      +V+ E 
Sbjct: 84  ENGLVVDWDAAQEQWDWALRNV----LHLESNKGVPALMTESIWNTMENKTKSLEVLLET 139

Query: 121 YEFGSMMKCPVAQFVPFDRARDYDIVGGAGEVVEAKSGYNNFQLVVDSGFNCTWVMPVIK 180
            +F +         V F   R                      LVVD G +     PV+ 
Sbjct: 140 LDFEACYISSTPTCVSFATGRPN-------------------CLVVDVGHDTASSSPVVD 180

Query: 181 GVPYYKATKKLDIGGRFLNGLLKETISFRH---------------------------YNV 213
           G+   ++T++  I G+F++ L+ + +  R                            YN 
Sbjct: 181 GMTLSRSTRRNFISGKFVDQLIGKYLQPREIIPLFEIAQRRPEFKKKNFEFNIDPSLYNF 240

Query: 214 MDETILINNIKEQCCFMPPVSYFDSFQRKEETRVEYILPDFQTSLIGYVRQPKQAIPKTS 273
            +E       KE  C + P +                L  F+  L    ++  +A P T 
Sbjct: 241 ANERGFFQECKETLCQIAPTT----------------LDKFKPELESTAKRSIEA-PWTE 283

Query: 274 QILRLEDELFTVPETFFHPEISNI------LKPGLVET 305
           +I+      +   E  F+P+  +I       K G+VET
Sbjct: 284 EIVFDNPSRYGFAEQLFYPQSEDIPEGWPVSKDGIVET 321

>TDEL0D01550 Chr4 complement(305973..307415) [1443 bp, 480 aa] {ON}
           Anc_1.287 YJL081C
          Length = 480

 Score = 40.4 bits (93), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 26/89 (29%), Positives = 38/89 (42%), Gaps = 1/89 (1%)

Query: 317 LRPLLVSNIVAVGGNFNIANFATRLATELQRQCPT-DWKVRVHQPKLDAALQGWKSMRQF 375
           LR  L  NIV  GG  +I  F+ RL +EL ++ P   +++       +   Q W      
Sbjct: 391 LRATLAHNIVLTGGTSSIPGFSDRLMSELNKKLPALKFRILTTGHLRERQYQAWLGGSIL 450

Query: 376 SQTDSYKNSRVTRSEYLEHGADWCTKHRF 404
           +   S+    V + EY E G D     RF
Sbjct: 451 TSLGSFHQLWVGKQEYEEVGPDRLLSDRF 479

 Score = 32.3 bits (72), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 26/43 (60%)

Query: 164 LVVDSGFNCTWVMPVIKGVPYYKATKKLDIGGRFLNGLLKETI 206
           LVVD G + T V PV+ G+   K+T +  + G  +N L+K+ +
Sbjct: 159 LVVDLGHDTTSVSPVVDGMTLSKSTMRNFLAGNCINELIKKPL 201

>SAKL0D05874g Chr4 complement(479873..481366) [1494 bp, 497 aa] {ON}
           similar to uniprot|P80428 Saccharomyces cerevisiae
           YJL081C ARP4 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin-remodeling
           enzyme complexes
          Length = 497

 Score = 40.4 bits (93), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 30/115 (26%), Positives = 45/115 (39%), Gaps = 2/115 (1%)

Query: 291 HPEISNILKPGLVETILECVSMVPEVLRPLLVSNIVAVGGNFNIANFATRLATELQRQCP 350
           +PE  N +  GL + I   +      LR  L  N+V  GG  +I     R+  EL +  P
Sbjct: 383 NPESKNEIA-GLTDLIYSSIMATDVDLRATLAHNVVVTGGTSSIPGLTDRIMAELNKSLP 441

Query: 351 T-DWKVRVHQPKLDAALQGWKSMRQFSQTDSYKNSRVTRSEYLEHGADWCTKHRF 404
              +++       +   Q W      S   ++    V + EY E GA    K RF
Sbjct: 442 ALKFRMLTSGHLKERQYQSWLGGSILSSLGTFHQLWVGKQEYEEVGASRLLKDRF 496

 Score = 38.1 bits (87), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 33/144 (22%), Positives = 54/144 (37%), Gaps = 23/144 (15%)

Query: 63  GQLISWELEEQIWDYCLFNPDEFGWELKDSKDVDLIASETCMTIPEISKNMDQVVFEEYE 122
           G +I W+  ++ W + + +   F    + +K +    +E      E  K   +V+ E  E
Sbjct: 92  GSVIDWDSAQEQWSWAIQHELHF----ESTKGMPAFLTEPIWNTEENRKKSLEVLLENME 147

Query: 123 FGSMMKCPVAQFVPFDRARDYDIVGGAGEVVEAKSGYNNFQLVVDSGFNCTWVMPVIKGV 182
           F +    P    V F   R                      LVVD G +   V PV+ G+
Sbjct: 148 FEACFLSPTPTCVSFAMGRPT-------------------CLVVDIGHDVCSVSPVVDGM 188

Query: 183 PYYKATKKLDIGGRFLNGLLKETI 206
              K++    I G  LN LL + +
Sbjct: 189 TLSKSSTSNFIAGSLLNALLSKQL 212

>KNAG0B01920 Chr2 complement(362300..363817) [1518 bp, 505 aa] {ON}
           Anc_1.287 YJL081C
          Length = 505

 Score = 39.7 bits (91), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 44/221 (19%), Positives = 85/221 (38%), Gaps = 49/221 (22%)

Query: 5   LLMENGSYEIKFGPANLETPYRARNCLTRDRYGRYHLSNQMDQIRDIS-------HCHI- 56
           ++++ GSY    G +  + P+     +   RYG +  +N+     D           HI 
Sbjct: 17  VVIDPGSYSTNIGYSGTDCPH----SILPSRYGSFKKTNKDSGDEDTKSDESATKRAHIF 72

Query: 57  --------RRPSEL------GQLISWELEEQIWDYCLFNPDEFGWELKDSKDVDLIASET 102
                   R+  E+      G +  W+  ++ W++ L N + F   L+ +K +  + +E 
Sbjct: 73  SEQSLGLPRKDYEIKTIVENGAVTDWDAAQEQWEWALKN-ELF---LESTKGIPALLTEP 128

Query: 103 CMTIPEISKNMDQVVFEEYEFGSMMKCPVAQFVPFDRARDYDIVGGAGEVVEAKSGYNNF 162
                +  K   + + E   F +    P +  V F   R                     
Sbjct: 129 VWNTKKNRKKSLETLLESMNFEACYLAPTSTCVSFATGRAN------------------- 169

Query: 163 QLVVDSGFNCTWVMPVIKGVPYYKATKKLDIGGRFLNGLLK 203
            LVVD G +   V PV+ G+   K+T++    G+++N L++
Sbjct: 170 CLVVDIGHDTCSVSPVVDGMTLSKSTRRSFFAGKYINHLIE 210

 Score = 36.6 bits (83), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 27/105 (25%), Positives = 40/105 (38%), Gaps = 1/105 (0%)

Query: 301 GLVETILECVSMVPEVLRPLLVSNIVAVGGNFNIANFATRLATELQRQCPT-DWKVRVHQ 359
           GL + +   +      LR  L  N+   GG   I   + RL  EL  + P   +++    
Sbjct: 400 GLADLVHSSIMASDVDLRASLAHNVQLTGGTSLIPGLSDRLMLELNARLPALKFRILTTG 459

Query: 360 PKLDAALQGWKSMRQFSQTDSYKNSRVTRSEYLEHGADWCTKHRF 404
            K +   Q W      +   ++    V R EY E GAD     RF
Sbjct: 460 HKKEREYQSWLGGSVLTSLGTFHQLWVGRQEYEEVGADRLLNDRF 504

>KAFR0A01560 Chr1 complement(311746..313203) [1458 bp, 485 aa] {ON}
           Anc_1.287 YJL081C
          Length = 485

 Score = 38.5 bits (88), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 46/214 (21%), Positives = 83/214 (38%), Gaps = 38/214 (17%)

Query: 5   LLMENGSYEIKFGPANLETPYRARNCLTRDRYGRYHLSNQMDQIR-----DISHCHIRRP 59
           ++++ GSY    G +  + P      +    YG Y  ++  +  +     + S C  R+ 
Sbjct: 17  VVIDPGSYSTNIGYSGTDCP----QAILPSCYGDYTNTDDPEGKKKKVFSEQSICIPRKD 72

Query: 60  SEL------GQLISWELEEQIWDYCLFNPDEFGWELKDSKDVDLIASETCMTIPEISKNM 113
            E+      G +I W+  ++ W + L N       L+ +  +  + +E      E  K  
Sbjct: 73  YEIKPIVENGVVIDWDAAQEQWSWALENQ----LYLRSNSGIPALLTEPIWNTVENRKKS 128

Query: 114 DQVVFEEYEFGSMMKCPVAQFVPFDRARDYDIVGGAGEVVEAKSGYNNFQLVVDSGFNCT 173
            +++ E  +F +         V F   R                   +  LVVD G +  
Sbjct: 129 LELLLEGMDFEACYLASTPTCVSFGTGR-------------------SSCLVVDLGHDTC 169

Query: 174 WVMPVIKGVPYYKATKKLDIGGRFLNGLLKETIS 207
            V PV+ G+   K+TK+    G +LN L+K  IS
Sbjct: 170 SVSPVVDGMTLSKSTKRNFFAGGYLNELIKNYIS 203

 Score = 33.9 bits (76), Expect = 0.83,   Method: Compositional matrix adjust.
 Identities = 22/89 (24%), Positives = 34/89 (38%), Gaps = 1/89 (1%)

Query: 317 LRPLLVSNIVAVGGNFNIANFATRLATELQRQCPT-DWKVRVHQPKLDAALQGWKSMRQF 375
           LR  L  N+V  GG   I   + RL  EL  + P   +++       +   Q W      
Sbjct: 396 LRATLAHNVVLTGGTSTIPGLSDRLMAELNSRLPALKFRMITTGHTRERQYQSWLGGSVL 455

Query: 376 SQTDSYKNSRVTRSEYLEHGADWCTKHRF 404
           +   ++    V + EY + G D     RF
Sbjct: 456 TSLGTFHQLWVGKEEYQDVGVDRLLADRF 484

>ACR184C Chr3 complement(669411..670616) [1206 bp, 401 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPR034W
           (ARP7)
          Length = 401

 Score = 38.5 bits (88), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 40/86 (46%), Gaps = 4/86 (4%)

Query: 311 SMVPEVLRPLLVSNIVAVGGNFNIANFATRLATELQRQCPTDWKVRVHQ--PKLDAALQG 368
           S  PE +   L++N+V +GG   +     RL  +L  Q P  +K+  +     +D  LQ 
Sbjct: 313 SATPEQIHAALLTNVVIIGGTSLLQGLEQRLVNDLSLQFP-QYKLSTYATPAHVDRQLQS 371

Query: 369 WKSMRQFSQTDSYK-NSRVTRSEYLE 393
           W+          +K  S VT+ EYLE
Sbjct: 372 WQGGVNMCHLPDWKLGSWVTKQEYLE 397

>NCAS0B06060 Chr2 complement(1146248..1147741) [1494 bp, 497 aa]
           {ON} 
          Length = 497

 Score = 38.1 bits (87), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 33/156 (21%), Positives = 63/156 (40%), Gaps = 23/156 (14%)

Query: 55  HIRRPSELGQLISWELEEQIWDYCLFNPDEFGWELKDSKDVDLIASETCMTIPEISKNMD 114
            I+R  E G ++ W+  ++ W + L    +    L+ +  +  + +E      E  K   
Sbjct: 77  EIKRIVENGSIMDWDAAQEQWSWAL----KSQLHLQSTSGIPALLTEPIWNSVENRKKSL 132

Query: 115 QVVFEEYEFGSMMKCPVAQFVPFDRARDYDIVGGAGEVVEAKSGYNNFQLVVDSGFNCTW 174
           +++ E   F +     V   V F   R                      LVVD G + T 
Sbjct: 133 EILLEGMNFEACYLSSVPTCVSFAAGRPN-------------------CLVVDIGHDTTS 173

Query: 175 VMPVIKGVPYYKATKKLDIGGRFLNGLLKETISFRH 210
           V PV+ G+   K++ +  I G+++N L+++ +  R 
Sbjct: 174 VSPVVDGMTLSKSSMRNFIAGKYINTLIEKYLQPRE 209

 Score = 37.4 bits (85), Expect = 0.072,   Method: Compositional matrix adjust.
 Identities = 35/148 (23%), Positives = 59/148 (39%), Gaps = 8/148 (5%)

Query: 264 QPKQAIPKTSQILRLEDELFTVPETFFHPEISNILKP------GLVETILECVSMVPEVL 317
           QPK      +    L++   TV E    P + +I +P      GL + +   +      L
Sbjct: 350 QPKAEDTSATTTETLDNISDTVNENGKRP-VDDISEPTKNDIAGLADLVYSAIIKSDVDL 408

Query: 318 RPLLVSNIVAVGGNFNIANFATRLATELQRQCPT-DWKVRVHQPKLDAALQGWKSMRQFS 376
           R  L  N+V  GG+ +I   + RL  EL R+ P   +++       +   Q W      +
Sbjct: 409 RASLAHNVVLTGGSSSIPGLSDRLILELNRRLPALKFRILSTGHTKERQYQAWLGGSILT 468

Query: 377 QTDSYKNSRVTRSEYLEHGADWCTKHRF 404
              ++    V ++EY E G +     RF
Sbjct: 469 SLGTFHQLWVGKNEYNEVGVERLLMDRF 496

>KLLA0D02288g Chr4 complement(194724..196286) [1563 bp, 520 aa] {ON}
           similar to uniprot|P80428 Saccharomyces cerevisiae
           YJL081C ARP4 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin-remodeling
           enzyme complexes
          Length = 520

 Score = 37.4 bits (85), Expect = 0.065,   Method: Compositional matrix adjust.
 Identities = 32/150 (21%), Positives = 61/150 (40%), Gaps = 23/150 (15%)

Query: 61  ELGQLISWELEEQIWDYCLFNPDEFGWELKDSKDVDLIASETCMTIPEISKNMDQVVFEE 120
           E   ++ W+  ++ W+Y L N D    + + +K   ++ +E         K   +++ E 
Sbjct: 76  ENSTIVDWDRAQEQWEYAL-NTD---LKFESNKGTPVLLTEPIWNSEASRKKSLEILLES 131

Query: 121 YEFGSMMKCPVAQFVPFDRARDYDIVGGAGEVVEAKSGYNNFQLVVDSGFNCTWVMPVIK 180
            EF +      +  V F   R                      LVVD G + + V PVI 
Sbjct: 132 MEFEACYLAANSSAVSFAMGRPT-------------------CLVVDIGHDVSTVSPVID 172

Query: 181 GVPYYKATKKLDIGGRFLNGLLKETISFRH 210
           G+   K++ +  + G++LN L+ + +  R 
Sbjct: 173 GMTLSKSSTRNYVAGKYLNHLIAKNLKPRE 202

 Score = 37.4 bits (85), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 27/105 (25%), Positives = 43/105 (40%), Gaps = 1/105 (0%)

Query: 301 GLVETILECVSMVPEVLRPLLVSNIVAVGGNFNIANFATRLATELQRQCPT-DWKVRVHQ 359
           G+V+ I + +      LR  L  N+V  GG   I   + R+  EL +  P   +++    
Sbjct: 415 GIVDLINKSMMEADVDLRATLAHNVVLTGGTSKIPGLSDRIMHELNKSLPALKFRMLSSG 474

Query: 360 PKLDAALQGWKSMRQFSQTDSYKNSRVTRSEYLEHGADWCTKHRF 404
              +   QGW      +   ++    V R EY E G +   K RF
Sbjct: 475 HLRERQYQGWLGGSILASLGTFHQLWVGREEYEEVGPERLLKDRF 519

>NCAS0G03050 Chr7 complement(560525..562756) [2232 bp, 743 aa] {ON}
           Anc_2.117 YHR129C
          Length = 743

 Score = 37.0 bits (84), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 33/126 (26%), Positives = 52/126 (41%), Gaps = 19/126 (15%)

Query: 276 LRLEDELFTVPETFFHPEISNILKPGLV---ETIL------ECVSMVPEVLRPLLVSNIV 326
           + L  E   VPE  F P +    + G++   ETIL      E   + P  L   + +N+ 
Sbjct: 609 MHLNVERIRVPEILFQPSMGGQDQAGIIELCETILTKKFGSEQRKLSPTAL--AMANNLW 666

Query: 327 AVGGNFNIANFATRLATELQRQCPTDWKVRVHQ---PKLDAALQGWKSMRQFS-QTDSYK 382
             GGN  +     R+  E     P      V Q   P LDA    W  M + +  ++ YK
Sbjct: 667 ITGGNSKLPGMKERIVKEFTGFLPVGTAFNVKQSYNPSLDA----WNGMAKLTLNSEDYK 722

Query: 383 NSRVTR 388
           N+ +++
Sbjct: 723 NTIISK 728

 Score = 34.3 bits (77), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 53/238 (22%), Positives = 100/238 (42%), Gaps = 33/238 (13%)

Query: 3   VPLLMENGSYEIKFGPANLETPYRA-RNCLTRDRYGRYH-----LSNQMDQIRDISHCHI 56
           +P+ ++ GS +I+ G  N  TP     N LTR R  + +     + N +   + I     
Sbjct: 37  IPIAIDFGSSQIRAGYTNQSTPSHIFPNRLTRYRDRKINKTFTFIGNDVSLDQAI-RTQS 95

Query: 57  RRPSELGQLISWELEEQIWDYCLFNPDEFGWELKDSKDVDLIASETCMTIPEISKNMDQV 116
           + P +   + +W+  E I  Y +FN    G    +     ++ +E   T+     N  Q+
Sbjct: 96  KSPFDGSIITNWDYVEDIMQY-IFN--HLGVVGHNGVSNPILLTEKLATLQSQRSNWYQL 152

Query: 117 VFEEYEFGSMMKCPVAQFVPFDRARDYDIVGGAGEVVEAKSGYNNFQLVVDSGFNCTWVM 176
           +FE ++   +     + F  +          G  E   + +G     LV+D G   T V+
Sbjct: 153 LFECFDIPEVTLGIDSMFAFY----------GLNE--RSSTG-----LVIDCGNEETDVI 195

Query: 177 PVIKGVPYYKATKKLDIGGR----FLNGLLKETISFRHYNVMDETILINNIKEQCCFM 230
           PV++G       K+++ GGR    +LN LL  T+ + ++     T     + +  C++
Sbjct: 196 PVVEGAGMLTDAKRINWGGRQAVDYLNDLL--TLKYPYFPTKLSTAQYQRVYQDYCYV 251

>NDAI0A01300 Chr1 complement(280662..282359) [1698 bp, 565 aa] {ON}
           Anc_7.448 YPR034W
          Length = 565

 Score = 36.2 bits (82), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 41/149 (27%), Positives = 59/149 (39%), Gaps = 39/149 (26%)

Query: 67  SWELEEQIWDYCLFN------PDEFGWELKDSKDVDLIASETCMTIPEISKNMDQVVFEE 120
           +WE  EQ W+Y LFN      P+E+                  +TIP + K +D  V E+
Sbjct: 83  NWEALEQQWNY-LFNDVLRCSPEEY---------------PLVITIPSMKKEIDGEVLEK 126

Query: 121 YEFGSMM---KCPVAQFVPFDRARDYDIVGGAGEVVEAKSGYNNFQLVVDSGFNCTWVMP 177
           Y F  +    K PV Q +    A    +   +G             LV+D G +   V P
Sbjct: 127 Y-FSLVFERFKFPVFQIILEPLAITLSLGKSSG-------------LVIDMGSSGCRVTP 172

Query: 178 VIKGVPYYKATKKLDIGGRFLNGLLKETI 206
           +I G     A      GG FL+  + ET+
Sbjct: 173 IIDGTVIKNAVLSSKYGGAFLDYQIIETL 201

>SAKL0F13772g Chr6 (1099703..1100971) [1269 bp, 422 aa] {ON} similar
           to uniprot|Q12406 Saccharomyces cerevisiae YPR034W ARP7
           Actin-related protein involved in transcriptional
           regulation subunit of the chromatin remodeling Snf/Swi
           complex
          Length = 422

 Score = 35.0 bits (79), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 64/300 (21%), Positives = 103/300 (34%), Gaps = 82/300 (27%)

Query: 161 NFQLVVDSGFNCTWVMPVIKGVPYYKATKKLDIGGRFLNGLLKETISFRHYNVMDETILI 220
           N  LVVD G +   V P+I G     A  +    G FL+           Y V +     
Sbjct: 138 NTSLVVDIGASKITVTPIIDGSVVKPAVLRSKFAGDFLD-----------YQVAE----- 181

Query: 221 NNIKEQCCFMPP---VSYFDSFQRKEETRVEYILPDFQTSLIGYVRQPKQAI-------- 269
            N+K      P        +SF+  E +R    + DF+ +++       Q +        
Sbjct: 182 -NLKNSLPIEPAGEDSKVPESFKYWESSRT--WIHDFKATMLQVSPSKIQELEGMQDTMA 238

Query: 270 --------------PKTSQILRLED-ELFTVPETFFHPEISN---ILKPGLVETILECV- 310
                          K ++ L LE  E + + E  F P++++     K GL E +++ V 
Sbjct: 239 FSHNPLDNKKYFLYKKGNKTLTLEQRECYKLAEMLFQPQLASDQFAAKEGLAELVVKAVK 298

Query: 311 -------------------------------SMVPEVLRPLLVSNIVAVGGNFNIANFAT 339
                                          +  PE +   L++NIV  G    +     
Sbjct: 299 KAGAAVTTSNSGPAGGGGPSGSSSMGIGASSTTTPEQIHAALLTNIVITGSTSLVPGVEQ 358

Query: 340 RLATELQRQCPTDWKVRVHQPK-LDAALQGWKSMRQFSQTDSYK-NSRVTRSEYLEHGAD 397
           R+  EL  Q P         P  LD  LQ W+     S   S++  + +TR EY  +G +
Sbjct: 359 RIVNELSYQFPQYKLSSFANPMVLDRKLQSWQGGVTMSNLPSWELGNWITRQEYDANGIN 418

>ZYRO0G17182g Chr7 (1417793..1419190) [1398 bp, 465 aa] {ON} similar
           to uniprot|Q12406 Saccharomyces cerevisiae YPR034W ARP7
           Actin-related protein involved in transcriptional
           regulation subunit of the chromatin remodeling Snf/Swi
           complex
          Length = 465

 Score = 34.7 bits (78), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 72/319 (22%), Positives = 122/319 (38%), Gaps = 56/319 (17%)

Query: 5   LLMENGSYEIKFGPANLETP-------YRARNCLTRDR-YGRYHLSNQMDQIRDISHCHI 56
           +++ NGS++   G +N ETP       Y  R+     + +G + + ++  +    S+ + 
Sbjct: 9   VVIHNGSWQTVAGFSNRETPQCVIPSSYIQRDGQREAQIFGTFEMLDETQENDPNSNVYT 68

Query: 57  RRPSELGQLISWELEEQIWDYCLFNPDEFGWELK-DSKDVDLIASETCMTIPEISKNMD- 114
              S  G   +WE  E  W Y       +  +L+ D  ++ LI     +++P  S  +D 
Sbjct: 69  IIDSR-GLPYNWEALESQWRYI------YEKQLQIDPSELPLI-----ISVPASSSEVDM 116

Query: 115 QVVFEEYEFG-SMMKCPVAQFVPFDRARDYDIVGGAGEVVEAKSGYNNFQLVVDSGFNCT 173
           ++V + +E     ++ P  Q V                +  A S   +  LV+D G    
Sbjct: 117 KIVHKYFELAFEKLRVPTLQIV-------------VEPLAIALSMSKSSALVIDIGAREC 163

Query: 174 WVMPVIKGVPYYKATKKLDIGGRFLNGLLKETISFRH----------YNVMDETILINNI 223
            + PVI G        K    G FL+  + E +  R           YN         N 
Sbjct: 164 KITPVIDGTVVKSGVMKSKFAGDFLDFQVTELLKDRLPPAESSCQMWYNSQTWIQQFKNT 223

Query: 224 KEQCCFMPPVSYFDSFQRKEETRVEYILP-DFQTSLIGYVRQPKQAIPKTS----QILRL 278
             Q C    V      QR  E +   + P  FQ      + QPK  + KT+    Q + +
Sbjct: 224 MLQVCDRNLV----EVQRLHEEQSNQLQPVGFQQFTSNSLTQPKNFLLKTANGSKQTISV 279

Query: 279 E-DELFTVPETFFHPEISN 296
           E  +   +PE  F P++SN
Sbjct: 280 ELKDCLKLPEYLFQPQLSN 298

>TDEL0C03120 Chr3 (558606..559922) [1317 bp, 438 aa] {ON} Anc_7.448
           YPR034W
          Length = 438

 Score = 34.7 bits (78), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 47/207 (22%), Positives = 80/207 (38%), Gaps = 34/207 (16%)

Query: 1   MRVPLLMENGSYEIKFGPANLETPYR--ARNCLTRDRYGRYHLSNQMDQIRDISHCHIRR 58
           M+  +++ NGS     G +N+E P    + + + +     +     +D+      C +  
Sbjct: 3   MKKCVVIHNGSSSTVAGFSNMELPQSIISSSYVQKGNERVFGTFAMLDECESKEECEVYT 62

Query: 59  PSEL-GQLISWELEEQIWDYCLFNPDEFGWELK-DSKDVDLIASETCMTIPEISKNMDQV 116
             +  G   +WE  E  W Y       + +ELK D +++ L+     +++P     +D  
Sbjct: 63  IMDKNGMPYNWEALEAQWRYL------YEYELKVDPQELPLV-----ISVPATHSEIDPQ 111

Query: 117 VFEEYEFGSMMKCPVAQFVPFDRARDYDIVGGAGEVVE----AKSGYNNFQLVVDSGFNC 172
           V E Y               FD A +   V     VVE    A +   +  LV+D G   
Sbjct: 112 VVENY---------------FDLALNKLQVPALQIVVEPLAVALAMGKSSALVIDVGARG 156

Query: 173 TWVMPVIKGVPYYKATKKLDIGGRFLN 199
           T V P++ G        K   GG FL+
Sbjct: 157 TTVTPIVDGTVVRSGVMKSRFGGDFLD 183

>NDAI0E00390 Chr5 complement(61806..65318) [3513 bp, 1170 aa] {ON}
           Anc_8.824 YML104C
          Length = 1170

 Score = 34.3 bits (77), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 27/89 (30%), Positives = 43/89 (48%), Gaps = 15/89 (16%)

Query: 156 KSGYNNFQLVVDSGFNCTWVMPVIKGVPYYKATKKLDIGGRFLNGLLKETISFRHYNVMD 215
           K+  NNF+  +   FN  + +   K +P        DIG ++LNGL ++ +S     ++D
Sbjct: 177 KALQNNFEFQLAVEFNKNYKLH--KAIPLRSNELDNDIG-KYLNGLSQQLLS----EIID 229

Query: 216 E--------TILINNIKEQCCFMPPVSYF 236
           E        +IL+  I + C F P VS F
Sbjct: 230 ENELKSPFVSILLREIMDSCIFNPLVSKF 258

>NDAI0H01950 Chr8 complement(474375..476945) [2571 bp, 856 aa] {ON}
           Anc_7.21 YAL047C
          Length = 856

 Score = 33.1 bits (74), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 41/173 (23%), Positives = 73/173 (42%), Gaps = 29/173 (16%)

Query: 14  IKFGPANLETPYRARNCLTRDRYGRYHLSNQMDQIRDISHCHIRRPSELGQLISWELE-- 71
           IKF    L +     N L      +++L NQ+ Q   I   +     +  Q+I  E E  
Sbjct: 499 IKFK---LSSSQAIENALYEKLSNQFNLLNQIQQY--IQESNNDTGEKESQIIQLEKELN 553

Query: 72  --------EQIWDYCLFNPDEFGWE-----LKDSKDVDLIAS---ETCMTIPEISKNMDQ 115
                   E++ +  L N  E  W+     L++  D++ + S   +    I E+SKN++ 
Sbjct: 554 LLEKKLNNEKVNNTKLMNLKEENWQDLIGQLEN--DIEYLTSNKDDLTSLIDELSKNIEH 611

Query: 116 VVFEEYEFGSMMKCPVAQFVPFDRARDYDIVGGAGEVVEAKSGYNNFQLVVDS 168
           + FE  +  S++K    Q     R +D D      E+ + K   NN Q ++++
Sbjct: 612 LRFENDDISSLVK----QLTEEKRNKDNDFSNLLVELNDMKLQNNNLQNIIEN 660

>ZYRO0G19954g Chr7 (1653353..1655455) [2103 bp, 700 aa] {ON} highly
           similar to uniprot|P07342 Saccharomyces cerevisiae
           YMR108W ILV2 Acetolactate synthase catalyses the first
           common step in isoleucine and valine biosynthesis and is
           the target of several classes of inhibitors localizes to
           the mitochondria expression of the gene is under general
           amino acid control
          Length = 700

 Score = 32.3 bits (72), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 23/105 (21%), Positives = 45/105 (42%), Gaps = 11/105 (10%)

Query: 86  GWELKDSKDVDLIASETCMTIPEISKNMDQVVFEEYEFGSMMKCPVAQFVPFDRARDYDI 145
            ++ +D+K +D++    C T     +N D ++     F   + C +++F P  R    + 
Sbjct: 352 AFDQEDTKSLDMLGMHGCATANLAIQNADLILAVGARFDDRVTCNISKFAPEARRAALE- 410

Query: 146 VGGAGEVVEAKSGYNNFQLVV--------DSGFNCTWVMPVIKGV 182
             G G +V  +    N   VV        D+  N   ++P++ GV
Sbjct: 411 --GRGGIVHFEMTPKNISKVVETQVAVHGDAATNIQKLIPLVFGV 453

>Kpol_1030.3 s1030 complement(4345..6324) [1980 bp, 659 aa] {ON}
           complement(4345..6324) [1980 nt, 660 aa]
          Length = 659

 Score = 32.3 bits (72), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 25/129 (19%), Positives = 55/129 (42%), Gaps = 13/129 (10%)

Query: 31  LTRDRYGRYHLSNQMDQIRDISHCHIRRPSELGQLISW-ELEEQIWDYCLFNPDEFGWEL 89
           L  DRY  YHL+   +  RD+     ++ +++G+     ++ +Q  D+ +  P+ F  E+
Sbjct: 125 LKSDRYSDYHLNFSSNLPRDLLEDLAKQVTQIGKSDRIKQVYDQYLDFVVTEPELFSLEI 184

Query: 90  KDSKDVDLIASETCMTIPEISKNMDQVVFEEYEFGSMMKCPVAQFVPFDRARDYDIVGGA 149
            ++  +        +  P  ++ +   + E+   G          +P  R+     +GG 
Sbjct: 185 SNTYSI--------LNNPSTTEEIINTLCEQIATGLYNTVITTNTIPIIRSP----IGGP 232

Query: 150 GEVVEAKSG 158
            E++  K G
Sbjct: 233 AEIISEKLG 241

>KLLA0E06315g Chr5 complement(567309..568625) [1317 bp, 438 aa] {ON}
           similar to uniprot|Q75BT7 Ashbya gossypii ACR184C
           ACR184Cp and weakly similar to uniprot|Q12406
           Saccharomyces cerevisiae YPR034W ARP7 Actin-related
           protein involved in transcriptional regulation subunit
           of the chromatin remodeling Snf/Swi complex
          Length = 438

 Score = 31.6 bits (70), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 28/65 (43%), Gaps = 4/65 (6%)

Query: 311 SMVPEVLRPLLVSNIVAVGGNFNIANFATRL----ATELQRQCPTDWKVRVHQPKLDAAL 366
           S   E L+ LL++NI+  G   NI     R+    +  L        K+   Q KLD   
Sbjct: 354 SYTSEQLQSLLLTNILVTGSTSNIQGLEQRILNDVSVSLNDLTTVRPKILFKQTKLDRNF 413

Query: 367 QGWKS 371
           Q W+S
Sbjct: 414 QSWQS 418

>KLLA0E03213g Chr5 complement(299014..301380) [2367 bp, 788 aa] {ON}
           similar to uniprot|Q12386 Saccharomyces cerevisiae
           YOR141C ARP8 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin-remodeling
           enzyme complexes
          Length = 788

 Score = 30.8 bits (68), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 34/154 (22%), Positives = 62/154 (40%), Gaps = 29/154 (18%)

Query: 157 SGYNNFQLVVDSGFNCTWVMPVIKGVPYYKATKKLDIGGR-----FLNGLLKETISFRHY 211
           +G +N   V+D G   T +  V  GV    +  +L+ GG      F + LL+    +  +
Sbjct: 371 AGLSNSTCVIDIGAKQTKIACVDDGVVVKNSALRLNYGGDDITRLFAHMLLQNKFPYADW 430

Query: 212 NVMDET--ILINNIKEQCCFMPPVSYFDSFQRKEETRVEYILPDFQTSLIGYVRQPKQAI 269
           N+ +     L   +K+QC     +++ D+              D    L  ++++   A 
Sbjct: 431 NINEPNGWTLAETLKKQC-----ITFQDA--------------DIAIQLYSFIKRDPYAR 471

Query: 270 PKTSQI---LRLEDELFTVPETFFHPEISNILKP 300
             T       +L DE+   P   F P+I  ++KP
Sbjct: 472 KYTQSHKYEYKLFDEVMCAPMGIFFPDIFEVIKP 505

>AEL042C Chr5 complement(557191..558834) [1644 bp, 547 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL156W
           (HXT11)
          Length = 547

 Score = 30.8 bits (68), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 31/102 (30%), Positives = 44/102 (43%), Gaps = 12/102 (11%)

Query: 158 GYNNFQLVVDSGFNCTWVMPVIKGVPYYKATKKLDIGGRFL--NGLLKETISF-----RH 210
           GY +  L   + F   W M ++ GV    AT  L    R+L  +G   ET        R 
Sbjct: 177 GYGSVSLNSVASFRVAWSMQLVPGVVLLLATFLLPESPRWLANHGRWDETTLVVEKVGRS 236

Query: 211 YNVMDE--TILINNIKEQCCF---MPPVSYFDSFQRKEETRV 247
            NV DE   I IN I+E+          +Y D F+RK + ++
Sbjct: 237 VNVSDEELRIHINEIRERVALDEMARDFTYADLFRRKTQRKI 278

>YGR266W Chr7 (1022656..1024761) [2106 bp, 701 aa] {ON} Protein of
           unknown function, predicted to contain a single
           transmembrane domain; mutant has increased aneuploidy
           tolerance; localized to both the mitochondrial outer
           membrane and the plasma membrane
          Length = 701

 Score = 30.8 bits (68), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 14/55 (25%), Positives = 27/55 (49%), Gaps = 5/55 (9%)

Query: 355 VRVHQPKLDAALQGWKSMRQFSQTDSYKNSRVTRSEYLEHGADWCTKHRFGYEQW 409
           +++H P L A L+    +++++   + +     R  YLEH  +W     +GY  W
Sbjct: 201 IKLHAPNLKAWLETKDPIKKYNTQTTEETKEQIRQFYLEHYLNW-----YGYGHW 250

>TPHA0B01460 Chr2 complement(325847..327304) [1458 bp, 485 aa] {ON}
           Anc_7.448 YPR034W
          Length = 485

 Score = 30.4 bits (67), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 45/191 (23%), Positives = 75/191 (39%), Gaps = 34/191 (17%)

Query: 36  YGRYHLSNQMDQIRDISHCHIRRPSELGQLISWELEEQIWDYCLFNPDEFGWELKDSKDV 95
           +G + + ++  +  D         S+ G   +WE  E+ W Y       +   LK S D 
Sbjct: 44  FGTFEMLDEAAKNEDNDEVFTIMDSKFGVPYNWEALEKQWRYI------YEEHLKVSPDQ 97

Query: 96  DLIASETCMTIPEI-SKN--MDQVVFEEYEFGSMMKCPVAQF---VPFDRARDYDIVGGA 149
             +A    +T+P I +KN  ++  + EEY       C +A     +P  R  +  +    
Sbjct: 98  LPLA----ITVPSILTKNVELETKIIEEY-------CKIAFLKLGIPSLRVVNESLA--- 143

Query: 150 GEVVEAKSGYNNFQLVVDSGFNCTWVMPVIKGVPYYKATKKLDIGGRFL----NGLLKET 205
              +    G  N  ++  SG  C+ V P++ G+       K   GG FL    N ++ E 
Sbjct: 144 ---ISLSLGKKNSLIIDLSGSGCS-VTPILDGILIKNGILKSKFGGDFLDFEVNKIINEK 199

Query: 206 ISFRHYNVMDE 216
           I       MDE
Sbjct: 200 IKESDKEEMDE 210

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.322    0.138    0.431 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 45,617,130
Number of extensions: 2012732
Number of successful extensions: 4873
Number of sequences better than 10.0: 157
Number of HSP's gapped: 4702
Number of HSP's successfully gapped: 192
Length of query: 410
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 298
Effective length of database: 40,638,807
Effective search space: 12110364486
Effective search space used: 12110364486
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 67 (30.4 bits)