Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
AGR090CsingletonON1571417511e-103
AGL119C8.395ON45937790.052
Skud_4.4558.395ON46337730.34
Ecym_41728.395ON46137720.40
Kpol_1030.28.395ON46137720.42
KLTH0F08536g8.395ON45937720.43
KAFR0H019308.395ON46037720.44
SAKL0H13728g8.395ON46155720.47
Kwal_23.32688.395ON45937710.54
YDR190C (RVB1)8.395ON46337710.56
Suva_2.3598.395ON46337710.58
Smik_4.4398.395ON46337710.60
KLLA0D18502g8.395ON45752710.61
KNAG0A026608.395ON46637700.67
TBLA0H008808.395ON46137700.76
KNAG0A060102.408ON49070700.85
TDEL0F051908.395ON46537700.87
TPHA0L009208.395ON46437690.96
NCAS0C028708.395ON49037691.0
SAKL0D01716g8.831ON94269654.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AGR090C
         (157 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AGR090C Chr7 complement(905952..906425) [474 bp, 157 aa] {ON} NO...   293   e-103
AGL119C Chr7 complement(483651..485030) [1380 bp, 459 aa] {ON} S...    35   0.052
Skud_4.455 Chr4 complement(807254..808645) [1392 bp, 463 aa] {ON...    33   0.34 
Ecym_4172 Chr4 (364002..365387) [1386 bp, 461 aa] {ON} similar t...    32   0.40 
Kpol_1030.2 s1030 (2743..4128) [1386 bp, 461 aa] {ON} (2743..412...    32   0.42 
KLTH0F08536g Chr6 (739646..741025) [1380 bp, 459 aa] {ON} highly...    32   0.43 
KAFR0H01930 Chr8 (360162..361544) [1383 bp, 460 aa] {ON} Anc_8.3...    32   0.44 
SAKL0H13728g Chr8 (1174638..1176023) [1386 bp, 461 aa] {ON} high...    32   0.47 
Kwal_23.3268 s23 (223136..224515) [1380 bp, 459 aa] {ON} YDR190C...    32   0.54 
YDR190C Chr4 complement(840604..841995) [1392 bp, 463 aa] {ON}  ...    32   0.56 
Suva_2.359 Chr2 complement(631676..633067) [1392 bp, 463 aa] {ON...    32   0.58 
Smik_4.439 Chr4 complement(796422..797813) [1392 bp, 463 aa] {ON...    32   0.60 
KLLA0D18502g Chr4 complement(1560764..1562137) [1374 bp, 457 aa]...    32   0.61 
KNAG0A02660 Chr1 (286643..288043) [1401 bp, 466 aa] {ON} Anc_8.3...    32   0.67 
TBLA0H00880 Chr8 (194638..196023) [1386 bp, 461 aa] {ON} Anc_8.3...    32   0.76 
KNAG0A06010 Chr1 complement(904060..905532) [1473 bp, 490 aa] {O...    32   0.85 
TDEL0F05190 Chr6 complement(971500..972897) [1398 bp, 465 aa] {O...    32   0.87 
TPHA0L00920 Chr12 complement(186549..187943) [1395 bp, 464 aa] {...    31   0.96 
NCAS0C02870 Chr3 (541600..543072) [1473 bp, 490 aa] {ON} Anc_8.395     31   1.0  
SAKL0D01716g Chr4 (135836..138664) [2829 bp, 942 aa] {ON} simila...    30   4.1  

>AGR090C Chr7 complement(905952..906425) [474 bp, 157 aa] {ON}
           NOHBY737; No homolog in Saccharomyces cerevisiae
          Length = 157

 Score =  293 bits (751), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 141/141 (100%), Positives = 141/141 (100%)

Query: 1   MYSSPRDCWLPARPKSLHWTGYRDYGSYMPAHRPHSVRQGETGWHIFRKSGACSWGPRML 60
           MYSSPRDCWLPARPKSLHWTGYRDYGSYMPAHRPHSVRQGETGWHIFRKSGACSWGPRML
Sbjct: 1   MYSSPRDCWLPARPKSLHWTGYRDYGSYMPAHRPHSVRQGETGWHIFRKSGACSWGPRML 60

Query: 61  SNTQEKRRSGFGSHAGTQNVAKAHGIPPSALRRLFMHRRGAYHATENLQHPPKLAIEIGI 120
           SNTQEKRRSGFGSHAGTQNVAKAHGIPPSALRRLFMHRRGAYHATENLQHPPKLAIEIGI
Sbjct: 61  SNTQEKRRSGFGSHAGTQNVAKAHGIPPSALRRLFMHRRGAYHATENLQHPPKLAIEIGI 120

Query: 121 ELRKWHCVHGRESGSWGHAPF 141
           ELRKWHCVHGRESGSWGHAPF
Sbjct: 121 ELRKWHCVHGRESGSWGHAPF 141

>AGL119C Chr7 complement(483651..485030) [1380 bp, 459 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR190C
           (RVB1)
          Length = 459

 Score = 35.0 bits (79), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 15/37 (40%), Positives = 20/37 (54%)

Query: 70  GFGSHAGTQNVAKAHGIPPSALRRLFMHRRGAYHATE 106
           G  +  GT++V  AHGIPP  + RL + R   Y   E
Sbjct: 339 GMTTVRGTEDVVSAHGIPPDLIDRLLIVRTLPYTQDE 375

>Skud_4.455 Chr4 complement(807254..808645) [1392 bp, 463 aa] {ON}
           YDR190C (REAL)
          Length = 463

 Score = 32.7 bits (73), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 13/37 (35%), Positives = 20/37 (54%)

Query: 70  GFGSHAGTQNVAKAHGIPPSALRRLFMHRRGAYHATE 106
           G  +  GT++V   HG+PP  + RL + R   Y + E
Sbjct: 343 GMTTVRGTEDVISPHGVPPDLIDRLLIVRTLPYDSDE 379

>Ecym_4172 Chr4 (364002..365387) [1386 bp, 461 aa] {ON} similar to
           Ashbya gossypii AGL119C
          Length = 461

 Score = 32.3 bits (72), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 14/37 (37%), Positives = 19/37 (51%)

Query: 70  GFGSHAGTQNVAKAHGIPPSALRRLFMHRRGAYHATE 106
           G  +  GT +V   HGIPP  + RL + R   Y+  E
Sbjct: 341 GMNTVRGTDDVVSPHGIPPDLIDRLLIVRTLPYNRQE 377

>Kpol_1030.2 s1030 (2743..4128) [1386 bp, 461 aa] {ON} (2743..4128)
           [1386 nt, 462 aa]
          Length = 461

 Score = 32.3 bits (72), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 13/37 (35%), Positives = 19/37 (51%)

Query: 70  GFGSHAGTQNVAKAHGIPPSALRRLFMHRRGAYHATE 106
           G  +  GT ++   HGIPP  + RL + R   Y+  E
Sbjct: 340 GMTTVRGTDDIVSPHGIPPDLIDRLLIVRTLPYNKDE 376

>KLTH0F08536g Chr6 (739646..741025) [1380 bp, 459 aa] {ON} highly
           similar to uniprot|Q03940 Saccharomyces cerevisiae
           YDR190C RVB1 RUVB-like protein TIP49a Homologue
          Length = 459

 Score = 32.3 bits (72), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 12/37 (32%), Positives = 20/37 (54%)

Query: 70  GFGSHAGTQNVAKAHGIPPSALRRLFMHRRGAYHATE 106
           G  +  GT+++   HG+PP  + RL + R   Y+  E
Sbjct: 339 GMTTVRGTEDIVSPHGVPPDLIDRLLIVRTLPYNKNE 375

>KAFR0H01930 Chr8 (360162..361544) [1383 bp, 460 aa] {ON} Anc_8.395
           YDR190C
          Length = 460

 Score = 32.3 bits (72), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 13/37 (35%), Positives = 20/37 (54%)

Query: 70  GFGSHAGTQNVAKAHGIPPSALRRLFMHRRGAYHATE 106
           G  +  GT++V   HG+PP  + RL + R   Y+  E
Sbjct: 340 GMTTVRGTEDVVSPHGVPPDLIDRLLIVRTLPYNRDE 376

>SAKL0H13728g Chr8 (1174638..1176023) [1386 bp, 461 aa] {ON} highly
           similar to uniprot|Q03940 Saccharomyces cerevisiae
           YDR190C RVB1 RUVB-like protein TIP49a Homologue
           RUVB-like protein
          Length = 461

 Score = 32.3 bits (72), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 17/55 (30%), Positives = 23/55 (41%), Gaps = 12/55 (21%)

Query: 70  GFGSHAGTQNVAKAHGIPPSALRRLFMHRRGAYH------------ATENLQHPP 112
           G  +  GT +V   HG+PP  + RL + R   Y+              ENLQ  P
Sbjct: 341 GMTTVRGTDDVVSPHGVPPDLIDRLLIVRTLPYNKEEIRTIIEKRSTIENLQLEP 395

>Kwal_23.3268 s23 (223136..224515) [1380 bp, 459 aa] {ON} YDR190C
           (RVB1) - RUVB-like protein [contig 251] FULL
          Length = 459

 Score = 32.0 bits (71), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 13/37 (35%), Positives = 20/37 (54%)

Query: 70  GFGSHAGTQNVAKAHGIPPSALRRLFMHRRGAYHATE 106
           G  +  GT++V   HG+PP  + RL + R   Y+  E
Sbjct: 339 GMTTVRGTEDVVSPHGVPPDLIDRLLIVRTLPYNRDE 375

>YDR190C Chr4 complement(840604..841995) [1392 bp, 463 aa] {ON}
           RVB1ATP-dependent DNA helicase, also known as pontin;
           member of the AAA+ and RuvB-like protein families;
           similar to Rvb2p; conserved component of multiple
           complexes including the INO80 complex, the Swr1 complex,
           and the R2TP complex (Rvb1-Rvb2-Tah1-Pih1); involved in
           multiple processes such as chromatin remodeling, box C/D
           snoRNP assembly, and RNA polymerase II assembly
          Length = 463

 Score = 32.0 bits (71), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 13/37 (35%), Positives = 19/37 (51%)

Query: 70  GFGSHAGTQNVAKAHGIPPSALRRLFMHRRGAYHATE 106
           G  +  GT++V   HG+PP  + RL + R   Y   E
Sbjct: 343 GMTTVRGTEDVISPHGVPPDLIDRLLIVRTLPYDKDE 379

>Suva_2.359 Chr2 complement(631676..633067) [1392 bp, 463 aa] {ON}
           YDR190C (REAL)
          Length = 463

 Score = 32.0 bits (71), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 13/37 (35%), Positives = 19/37 (51%)

Query: 70  GFGSHAGTQNVAKAHGIPPSALRRLFMHRRGAYHATE 106
           G  +  GT++V   HG+PP  + RL + R   Y   E
Sbjct: 343 GMTTVRGTEDVISPHGVPPDLIDRLLIVRTLPYDKDE 379

>Smik_4.439 Chr4 complement(796422..797813) [1392 bp, 463 aa] {ON}
           YDR190C (REAL)
          Length = 463

 Score = 32.0 bits (71), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 13/37 (35%), Positives = 19/37 (51%)

Query: 70  GFGSHAGTQNVAKAHGIPPSALRRLFMHRRGAYHATE 106
           G  +  GT++V   HG+PP  + RL + R   Y   E
Sbjct: 343 GMTTVRGTEDVISPHGVPPDLIDRLLIVRTLPYDKDE 379

>KLLA0D18502g Chr4 complement(1560764..1562137) [1374 bp, 457 aa]
           {ON} highly similar to uniprot|Q03940 Saccharomyces
           cerevisiae YDR190C RVB1 RUVB-like protein TIP49a
           Homologue
          Length = 457

 Score = 32.0 bits (71), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 23/52 (44%), Gaps = 12/52 (23%)

Query: 70  GFGSHAGTQNVAKAHGIPPSALRRLFMHRRGAYH------------ATENLQ 109
           G  +  GT +V   HG+PP  + RL + R   Y+            A ENLQ
Sbjct: 337 GMITVRGTDDVVSPHGVPPDLIDRLLIVRTLPYNREEIKTIISKRAAVENLQ 388

>KNAG0A02660 Chr1 (286643..288043) [1401 bp, 466 aa] {ON} Anc_8.395
           YDR190C
          Length = 466

 Score = 31.6 bits (70), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 13/37 (35%), Positives = 20/37 (54%)

Query: 70  GFGSHAGTQNVAKAHGIPPSALRRLFMHRRGAYHATE 106
           G  +  GT++V   HG+PP  + RL + R   Y+  E
Sbjct: 346 GMTTVRGTEDVISPHGVPPDLIDRLLIVRTLPYNRDE 382

>TBLA0H00880 Chr8 (194638..196023) [1386 bp, 461 aa] {ON} Anc_8.395
           YDR190C
          Length = 461

 Score = 31.6 bits (70), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 14/37 (37%), Positives = 19/37 (51%)

Query: 70  GFGSHAGTQNVAKAHGIPPSALRRLFMHRRGAYHATE 106
           G  +  GT++V   HGIPP  + RL + R   Y   E
Sbjct: 340 GMTTVRGTEDVISPHGIPPDLIDRLLIVRTLPYTRDE 376

>KNAG0A06010 Chr1 complement(904060..905532) [1473 bp, 490 aa] {ON}
           Anc_2.408 YLR033W
          Length = 490

 Score = 31.6 bits (70), Expect = 0.85,   Method: Composition-based stats.
 Identities = 20/70 (28%), Positives = 29/70 (41%), Gaps = 2/70 (2%)

Query: 19  WTGYRDYGSYMPAHRPHSVRQGETGWHI--FRKSGACSWGPRMLSNTQEKRRSGFGSHAG 76
           W  Y DY S+ PA    S     T   I   ++ G  ++G + +   +E   S       
Sbjct: 270 WLKYGDYASWAPAFNEDSTVLDSTSSGIIWLKRIGYLTYGNKRVGQEKEAPESAVEDKII 329

Query: 77  TQNVAKAHGI 86
           T+NV K  GI
Sbjct: 330 TENVDKKEGI 339

>TDEL0F05190 Chr6 complement(971500..972897) [1398 bp, 465 aa] {ON}
           Anc_8.395 YDR190C
          Length = 465

 Score = 31.6 bits (70), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 13/37 (35%), Positives = 19/37 (51%)

Query: 70  GFGSHAGTQNVAKAHGIPPSALRRLFMHRRGAYHATE 106
           G  +  GT++V   HG+PP  + RL + R   Y   E
Sbjct: 345 GMTTVRGTEDVVSPHGVPPDLIDRLLIVRTMPYIKEE 381

>TPHA0L00920 Chr12 complement(186549..187943) [1395 bp, 464 aa] {ON}
           Anc_8.395 YDR190C
          Length = 464

 Score = 31.2 bits (69), Expect = 0.96,   Method: Compositional matrix adjust.
 Identities = 13/37 (35%), Positives = 19/37 (51%)

Query: 70  GFGSHAGTQNVAKAHGIPPSALRRLFMHRRGAYHATE 106
           G  +  GT ++   HGIPP  + RL + R   Y+  E
Sbjct: 344 GMTTVRGTDDIVSPHGIPPDLVDRLLIVRTLPYNREE 380

>NCAS0C02870 Chr3 (541600..543072) [1473 bp, 490 aa] {ON} Anc_8.395
          Length = 490

 Score = 31.2 bits (69), Expect = 1.0,   Method: Composition-based stats.
 Identities = 13/37 (35%), Positives = 20/37 (54%)

Query: 70  GFGSHAGTQNVAKAHGIPPSALRRLFMHRRGAYHATE 106
           G  +  GT++V   HG+PP  + RL + R   Y+  E
Sbjct: 370 GMTTVRGTEDVVSPHGVPPDLIDRLLIVRTLPYNKEE 406

>SAKL0D01716g Chr4 (135836..138664) [2829 bp, 942 aa] {ON} similar
           to uniprot|P54786 Saccharomyces cerevisiae YML109W ZDS2
           Protein that interacts with silencing proteins at the
           telomere involved in transcriptional silencing paralog
           of Zds1p
          Length = 942

 Score = 29.6 bits (65), Expect = 4.1,   Method: Composition-based stats.
 Identities = 21/69 (30%), Positives = 26/69 (37%)

Query: 2   YSSPRDCWLPARPKSLHWTGYRDYGSYMPAHRPHSVRQGETGWHIFRKSGACSWGPRMLS 61
           YS   D     + + LH     DYG Y   +R  SV   E  W    +    +   R LS
Sbjct: 109 YSYSEDSMDITKTEYLHDNSNDDYGEYNRGNRTGSVGVSEDAWKTTLEIADGTSPRRALS 168

Query: 62  NTQEKRRSG 70
            T   RR G
Sbjct: 169 GTGSVRRGG 177

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.135    0.474 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 14,962,076
Number of extensions: 549850
Number of successful extensions: 849
Number of sequences better than 10.0: 24
Number of HSP's gapped: 849
Number of HSP's successfully gapped: 24
Length of query: 157
Length of database: 53,481,399
Length adjustment: 100
Effective length of query: 57
Effective length of database: 42,014,799
Effective search space: 2394843543
Effective search space used: 2394843543
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 61 (28.1 bits)