Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
AGR089C8.259ON1370137068900.0
Ecym_43118.259ON1376137641910.0
SAKL0H17094g8.259ON1422138737700.0
Kwal_56.238258.259ON1396137035290.0
NCAS0B050008.259ON1409130435240.0
TDEL0F038608.259ON1399136835200.0
KAFR0B027108.259ON1416137534740.0
Smik_12.1458.259ON1418138434740.0
KLTH0G13750g8.259ON1399136534690.0
ZYRO0C01716g8.259ON1413136634640.0
Kpol_392.88.259ON1427138434480.0
Suva_10.1708.259ON1416137434360.0
YLR086W (SMC4)8.259ON1418136834340.0
Skud_12.1548.259ON1417138933880.0
KNAG0G020208.259ON1444130933190.0
NDAI0B019708.259ON1415138032780.0
KLLA0F19085g8.259ON1372138732440.0
TBLA0E044108.259ON1422137331940.0
TPHA0J007208.259ON1393136531150.0
CAGL0L12188g8.259ON1398140930430.0
Kpol_1011.58.68ON122113156323e-66
CAGL0F02079g8.68ON122313115879e-61
Ecym_73038.68ON122213085541e-56
NDAI0G033208.68ON12317554701e-46
TDEL0C009608.68ON12227704342e-42
NCAS0C040008.68ON12237664234e-41
AGL023W8.68ON12227143663e-34
ZYRO0F03828g8.68ON12177343582e-33
KAFR0C032008.68ON12231673483e-32
KNAG0G009108.68ON12262073484e-32
TPHA0P003408.68ON12191773484e-32
Kwal_23.50438.68ON12251633466e-32
KLLA0D07502g8.68ON12431693305e-30
Skud_6.648.68ON12307203191e-28
KAFR0G029307.186ON11707932974e-26
Suva_6.1047.186ON11709242948e-26
Ecym_43907.186ON11708232813e-24
Smik_10.1671.295ON12297332672e-22
Smik_7.3467.186ON11702742527e-21
YFR031C (SMC2)7.186ON11702732528e-21
ZYRO0D15642g7.186ON11702532482e-20
AGR236W7.186ON11701892482e-20
Skud_6.1197.186ON11701912464e-20
YFL008W (SMC1)8.68ON12251622464e-20
NDAI0G020707.186ON11711912421e-19
TDEL0D016201.295ON12237882412e-19
SAKL0F07282g7.186ON11701912393e-19
KLTH0E04774g7.186ON11701892375e-19
NCAS0E019207.186ON11701912365e-19
Kwal_55.204217.186ON11701892357e-19
TDEL0H026107.186ON11701912357e-19
Kpol_1063.207.186ON11711912358e-19
TBLA0G035308.68ON12321842359e-19
Suva_6.528.68ON12642022322e-18
TPHA0C044407.186ON11702712312e-18
TBLA0D046107.186ON11741912303e-18
Smik_6.718.68ON12282022285e-18
KNAG0L011607.186ON11701912277e-18
KLLA0D16005g7.186ON11701912214e-17
SAKL0B02288g8.68ON12282062161e-16
KLTH0A02706g8.68ON12281922106e-16
SAKL0D06116g1.295ON12291002062e-15
CAGL0D05258g7.186ON1170792026e-15
ZYRO0G21296g1.295ON12271062026e-15
Kpol_1018.21.295ON12112022018e-15
KAFR0A016101.295ON12271032001e-14
NCAS0A093301.295ON12271272001e-14
Kwal_14.24351.295ON12471251982e-14
KLTH0H09966g1.295ON12241241972e-14
KNAG0B052301.295ON12251051963e-14
NDAI0G056301.295ON12291221856e-13
YJL074C (SMC3)1.295ON12302591856e-13
TPHA0I010901.295ON1216951831e-12
Suva_6.1491.295ON12302591822e-12
Ecym_63221.295ON12321071793e-12
CAGL0H02805g1.295ON12191031784e-12
AAL182W1.295ON1231791776e-12
TBLA0C027401.295ON11191591767e-12
Skud_10.1701.295ON12302591741e-11
KLLA0A00286g1.295ON1224971713e-11
KLTH0D02816g7.101ON10941611462e-08
TDEL0E013404.237ON11063821212e-05
KNAG0L006307.101ON11081581176e-05
Kwal_26.72047.101ON11171231132e-04
SAKL0B09526g7.101ON10991561122e-04
ZYRO0G01584g7.101ON10884381103e-04
KLLA0F07997g7.101ON11191691060.001
ZYRO0B12122g4.237ON1109791050.001
AER045C4.238ON12921751050.001
Ecym_26257.101ON10971311050.002
AEL337C7.101ON10971731010.004
Kwal_26.93804.237ON11022221000.007
NCAS0J013904.237ON109679990.009
CAGL0H05071g4.237ON111076980.009
Kpol_1044.137.101ON1103125970.013
Skud_15.1217.101ON109383970.014
KAFR0D013307.101ON1080182960.015
KNAG0B060104.237ON1117101960.016
TPHA0B008404.237ON111968960.016
YLR383W (SMC6)4.237ON111468960.019
Skud_12.4684.237ON112068960.019
Suva_10.5004.237ON111568960.019
Smik_12.4704.237ON111468950.020
TDEL0H034907.101ON110385950.021
NCAS0I005707.101ON109562950.021
NDAI0J021804.237ON110868950.021
NDAI0A084507.101ON111962950.022
KLLA0E05303g4.237ON109895940.026
Suva_15.1337.101ON109262940.027
Smik_15.1317.101ON109362940.027
YOL034W (SMC5)7.101ON109362940.029
TPHA0L006007.101ON111762940.032
TBLA0E021907.101ON108942930.042
Kpol_483.104.237ON111866930.043
CAGL0F01155g7.101ON1105170920.050
TBLA0I028904.237ON109871890.10
NDAI0D044204.238ON1914254880.18
TBLA0A053001.67ON70776870.18
SAKL0H03322g4.237ON111147860.23
Ecym_83978.138ON355159840.27
Ecym_53444.237ON110258840.40
KAFR0A060404.237ON110268820.70
Ecym_83218.636ON444165810.79
KLTH0D14080g4.237ON1102110820.83
TDEL0F031203.430ON573287801.1
TDEL0G028102.351ON109471811.1
KLTH0D08558g2.590ON93097801.4
Ecym_10721.67ON68397791.5
AER044W4.237ON110352791.6
Skud_2.1103.211ON249578782.2
Kpol_2000.791.67ON70791782.3
KLTH0B01100g1.527ON129881782.5
TBLA0F027507.488ON1414133773.2
NCAS0B087001.67ON71575763.3
TPHA0D011208.650ON348144753.3
Smik_10.2985.133ON349121744.3
AFR683C1.67ON677110754.7
YDL058W (USO1)4.238ON1790233754.7
NCAS0A016304.113ON104376755.3
Kwal_33.155611.527ON129778755.6
ZYRO0F17050g1.67ON71491746.2
YHR023W (MYO1)5.267ON1928142746.3
YEL043W1.487ON956100747.0
KAFR0G032004.238ON1869187738.0
NCAS0A024504.238ON1928175738.3
Skud_4.5845.349ON368263728.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AGR089C
         (1370 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AGR089C Chr7 complement(901437..905549) [4113 bp, 1370 aa] {ON} ...  2658   0.0  
Ecym_4311 Chr4 complement(666871..671001) [4131 bp, 1376 aa] {ON...  1618   0.0  
SAKL0H17094g Chr8 complement(1508021..1512289) [4269 bp, 1422 aa...  1456   0.0  
Kwal_56.23825 s56 complement(721498..725688) [4191 bp, 1396 aa] ...  1363   0.0  
NCAS0B05000 Chr2 (917841..922070) [4230 bp, 1409 aa] {ON} Anc_8....  1362   0.0  
TDEL0F03860 Chr6 (709579..713778) [4200 bp, 1399 aa] {ON} Anc_8....  1360   0.0  
KAFR0B02710 Chr2 (545337..549587) [4251 bp, 1416 aa] {ON} Anc_8....  1342   0.0  
Smik_12.145 Chr12 (282081..286337) [4257 bp, 1418 aa] {ON} YLR08...  1342   0.0  
KLTH0G13750g Chr7 complement(1184169..1188368) [4200 bp, 1399 aa...  1340   0.0  
ZYRO0C01716g Chr3 complement(130331..134572) [4242 bp, 1413 aa] ...  1338   0.0  
Kpol_392.8 s392 complement(19392..23675) [4284 bp, 1427 aa] {ON}...  1332   0.0  
Suva_10.170 Chr10 (307316..311566) [4251 bp, 1416 aa] {ON} YLR08...  1328   0.0  
YLR086W Chr12 (302243..306499) [4257 bp, 1418 aa] {ON}  SMC4Subu...  1327   0.0  
Skud_12.154 Chr12 (285613..289866) [4254 bp, 1417 aa] {ON} YLR08...  1309   0.0  
KNAG0G02020 Chr7 (449115..453449) [4335 bp, 1444 aa] {ON} Anc_8....  1283   0.0  
NDAI0B01970 Chr2 (479208..483455) [4248 bp, 1415 aa] {ON} Anc_8....  1267   0.0  
KLLA0F19085g Chr6 (1758111..1762229) [4119 bp, 1372 aa] {ON} sim...  1254   0.0  
TBLA0E04410 Chr5 (1122005..1126273) [4269 bp, 1422 aa] {ON} Anc_...  1234   0.0  
TPHA0J00720 Chr10 (161017..165198) [4182 bp, 1393 aa] {ON} Anc_8...  1204   0.0  
CAGL0L12188g Chr12 (1310968..1315164) [4197 bp, 1398 aa] {ON} si...  1176   0.0  
Kpol_1011.5 s1011 complement(13399..17064) [3666 bp, 1221 aa] {O...   248   3e-66
CAGL0F02079g Chr6 (201002..204673) [3672 bp, 1223 aa] {ON} simil...   230   9e-61
Ecym_7303 Chr7 (638719..642387) [3669 bp, 1222 aa] {ON} similar ...   218   1e-56
NDAI0G03320 Chr7 (781468..785163) [3696 bp, 1231 aa] {ON}             185   1e-46
TDEL0C00960 Chr3 (153572..157240) [3669 bp, 1222 aa] {ON} Anc_8....   171   2e-42
NCAS0C04000 Chr3 (807106..810777) [3672 bp, 1223 aa] {ON} Anc_8....   167   4e-41
AGL023W Chr7 (670877..674545) [3669 bp, 1222 aa] {ON} Syntenic h...   145   3e-34
ZYRO0F03828g Chr6 (318190..321843) [3654 bp, 1217 aa] {ON} simil...   142   2e-33
KAFR0C03200 Chr3 (643231..646902) [3672 bp, 1223 aa] {ON} Anc_8....   138   3e-32
KNAG0G00910 Chr7 (172759..176439) [3681 bp, 1226 aa] {ON} Anc_8....   138   4e-32
TPHA0P00340 Chr16 (65711..69370) [3660 bp, 1219 aa] {ON} Anc_8.6...   138   4e-32
Kwal_23.5043 s23 (978758..982435) [3678 bp, 1225 aa] {ON} YFL008...   137   6e-32
KLLA0D07502g Chr4 complement(642751..646482) [3732 bp, 1243 aa] ...   131   5e-30
Skud_6.64 Chr6 (121616..125308) [3693 bp, 1230 aa] {ON} YFL008W ...   127   1e-28
KAFR0G02930 Chr7 complement(609210..612722) [3513 bp, 1170 aa] {...   119   4e-26
Suva_6.104 Chr6 complement(183396..186908) [3513 bp, 1170 aa] {O...   117   8e-26
Ecym_4390 Chr4 (816076..819588) [3513 bp, 1170 aa] {ON} similar ...   112   3e-24
Smik_10.167 Chr10 complement(290936..294625) [3690 bp, 1229 aa] ...   107   2e-22
Smik_7.346 Chr7 complement(577634..581146) [3513 bp, 1170 aa] {O...   101   7e-21
YFR031C Chr6 complement(216594..220106) [3513 bp, 1170 aa] {ON} ...   101   8e-21
ZYRO0D15642g Chr4 complement(1307703..1311215) [3513 bp, 1170 aa...   100   2e-20
AGR236W Chr7 (1189845..1193357) [3513 bp, 1170 aa] {ON} Syntenic...   100   2e-20
Skud_6.119 Chr6 complement(211918..215430) [3513 bp, 1170 aa] {O...    99   4e-20
YFL008W Chr6 (119429..123106) [3678 bp, 1225 aa] {ON}  SMC1Subun...    99   4e-20
NDAI0G02070 Chr7 (461697..465212) [3516 bp, 1171 aa] {ON} Anc_7....    98   1e-19
TDEL0D01620 Chr4 complement(321963..325634) [3672 bp, 1223 aa] {...    97   2e-19
SAKL0F07282g Chr6 complement(554459..557971) [3513 bp, 1170 aa] ...    97   3e-19
KLTH0E04774g Chr5 (426535..430047) [3513 bp, 1170 aa] {ON} simil...    96   5e-19
NCAS0E01920 Chr5 (368382..371894) [3513 bp, 1170 aa] {ON} Anc_7....    96   5e-19
Kwal_55.20421 s55 (391382..394894) [3513 bp, 1170 aa] {ON} YFR03...    95   7e-19
TDEL0H02610 Chr8 (434116..437628) [3513 bp, 1170 aa] {ON} Anc_7....    95   7e-19
Kpol_1063.20 s1063 (46233..49748) [3516 bp, 1171 aa] {ON} (46233...    95   8e-19
TBLA0G03530 Chr7 complement(941941..945639) [3699 bp, 1232 aa] {...    95   9e-19
Suva_6.52 Chr6 (91156..94950) [3795 bp, 1264 aa] {ON} YFL008W (R...    94   2e-18
TPHA0C04440 Chr3 complement(958279..961791) [3513 bp, 1170 aa] {...    94   2e-18
TBLA0D04610 Chr4 complement(1139885..1143409) [3525 bp, 1174 aa]...    93   3e-18
Smik_6.71 Chr6 (132627..136313) [3687 bp, 1228 aa] {ON} YFL008W ...    92   5e-18
KNAG0L01160 Chr12 complement(206434..209946) [3513 bp, 1170 aa] ...    92   7e-18
KLLA0D16005g Chr4 complement(1346492..1350004) [3513 bp, 1170 aa...    90   4e-17
SAKL0B02288g Chr2 (215750..219436) [3687 bp, 1228 aa] {ON} simil...    88   1e-16
KLTH0A02706g Chr1 complement(234723..238409) [3687 bp, 1228 aa] ...    86   6e-16
SAKL0D06116g Chr4 complement(503196..506885) [3690 bp, 1229 aa] ...    84   2e-15
CAGL0D05258g Chr4 (500858..504370) [3513 bp, 1170 aa] {ON} simil...    82   6e-15
ZYRO0G21296g Chr7 (1747217..1750900) [3684 bp, 1227 aa] {ON} sim...    82   6e-15
Kpol_1018.2 s1018 complement(5901..9536) [3636 bp, 1211 aa] {ON}...    82   8e-15
KAFR0A01610 Chr1 complement(326620..330303) [3684 bp, 1227 aa] {...    82   1e-14
NCAS0A09330 Chr1 (1844122..1847805) [3684 bp, 1227 aa] {ON} Anc_...    82   1e-14
Kwal_14.2435 s14 complement(756213..759956) [3744 bp, 1247 aa] {...    81   2e-14
KLTH0H09966g Chr8 complement(859362..863036) [3675 bp, 1224 aa] ...    80   2e-14
KNAG0B05230 Chr2 complement(1005244..1008921) [3678 bp, 1225 aa]...    80   3e-14
NDAI0G05630 Chr7 complement(1393671..1397360) [3690 bp, 1229 aa]...    76   6e-13
YJL074C Chr10 complement(299157..302849) [3693 bp, 1230 aa] {ON}...    76   6e-13
TPHA0I01090 Chr9 complement(252902..256552) [3651 bp, 1216 aa] {...    75   1e-12
Suva_6.149 Chr6 (248275..251967) [3693 bp, 1230 aa] {ON} YJL074C...    75   2e-12
Ecym_6322 Chr6 (611978..615676) [3699 bp, 1232 aa] {ON} similar ...    74   3e-12
CAGL0H02805g Chr8 complement(256682..260341) [3660 bp, 1219 aa] ...    73   4e-12
AAL182W Chr1 (16155..19850) [3696 bp, 1231 aa] {ON} Syntenic hom...    73   6e-12
TBLA0C02740 Chr3 (656941..660300) [3360 bp, 1119 aa] {ON} Anc_1....    72   7e-12
Skud_10.170 Chr10 (316063..319755) [3693 bp, 1230 aa] {ON} YJL07...    72   1e-11
KLLA0A00286g Chr1 complement(22024..25698) [3675 bp, 1224 aa] {O...    70   3e-11
KLTH0D02816g Chr4 complement(272310..275594) [3285 bp, 1094 aa] ...    61   2e-08
TDEL0E01340 Chr5 complement(265681..269001) [3321 bp, 1106 aa] {...    51   2e-05
KNAG0L00630 Chr12 complement(93928..97254) [3327 bp, 1108 aa] {O...    50   6e-05
Kwal_26.7204 s26 complement(263266..266619) [3354 bp, 1117 aa] {...    48   2e-04
SAKL0B09526g Chr2 (805816..809115) [3300 bp, 1099 aa] {ON} simil...    48   2e-04
ZYRO0G01584g Chr7 (120582..123848) [3267 bp, 1088 aa] {ON} simil...    47   3e-04
KLLA0F07997g Chr6 complement(748561..751920) [3360 bp, 1119 aa] ...    45   0.001
ZYRO0B12122g Chr2 (972611..975940) [3330 bp, 1109 aa] {ON} simil...    45   0.001
AER045C Chr5 complement(717771..721649) [3879 bp, 1292 aa] {ON} ...    45   0.001
Ecym_2625 Chr2 (1208550..1211843) [3294 bp, 1097 aa] {ON} simila...    45   0.002
AEL337C Chr5 complement(14613..17906) [3294 bp, 1097 aa] {ON} Sy...    44   0.004
Kwal_26.9380 s26 (1189521..1192829) [3309 bp, 1102 aa] {ON} YLR3...    43   0.007
NCAS0J01390 Chr10 (242118..245408) [3291 bp, 1096 aa] {ON} Anc_4...    43   0.009
CAGL0H05071g Chr8 (486899..490231) [3333 bp, 1110 aa] {ON} simil...    42   0.009
Kpol_1044.13 s1044 complement(23616..26927) [3312 bp, 1103 aa] {...    42   0.013
Skud_15.121 Chr15 (218825..222106) [3282 bp, 1093 aa] {ON} YOL03...    42   0.014
KAFR0D01330 Chr4 complement(263879..267121) [3243 bp, 1080 aa] {...    42   0.015
KNAG0B06010 Chr2 (1178430..1181783) [3354 bp, 1117 aa] {ON} Anc_...    42   0.016
TPHA0B00840 Chr2 complement(194812..198171) [3360 bp, 1119 aa] {...    42   0.016
YLR383W Chr12 (885288..888632) [3345 bp, 1114 aa] {ON}  SMC6Comp...    42   0.019
Skud_12.468 Chr12 (825378..828740) [3363 bp, 1120 aa] {ON} YLR38...    42   0.019
Suva_10.500 Chr10 (850833..854180) [3348 bp, 1115 aa] {ON} YLR38...    42   0.019
Smik_12.470 Chr12 (824001..827345) [3345 bp, 1114 aa] {ON} YLR38...    41   0.020
TDEL0H03490 Chr8 (578645..581956) [3312 bp, 1103 aa] {ON} Anc_7....    41   0.021
NCAS0I00570 Chr9 complement(90806..94093) [3288 bp, 1095 aa] {ON...    41   0.021
NDAI0J02180 Chr10 (529566..532892) [3327 bp, 1108 aa] {ON} Anc_4...    41   0.021
NDAI0A08450 Chr1 (1947452..1950811) [3360 bp, 1119 aa] {ON} Anc_...    41   0.022
KLLA0E05303g Chr5 complement(472583..475879) [3297 bp, 1098 aa] ...    41   0.026
Suva_15.133 Chr15 (232441..235719) [3279 bp, 1092 aa] {ON} YOL03...    41   0.027
Smik_15.131 Chr15 (226115..229396) [3282 bp, 1093 aa] {ON} YOL03...    41   0.027
YOL034W Chr15 (259923..263204) [3282 bp, 1093 aa] {ON}  SMC5Comp...    41   0.029
TPHA0L00600 Chr12 complement(102317..105670) [3354 bp, 1117 aa] ...    41   0.032
TBLA0E02190 Chr5 complement(534078..537347) [3270 bp, 1089 aa] {...    40   0.042
Kpol_483.10 s483 (21646..25002) [3357 bp, 1118 aa] {ON} (21646.....    40   0.043
CAGL0F01155g Chr6 complement(116762..120079) [3318 bp, 1105 aa] ...    40   0.050
TBLA0I02890 Chr9 (683688..686984) [3297 bp, 1098 aa] {ON} Anc_4....    39   0.10 
NDAI0D04420 Chr4 (1033897..1039641) [5745 bp, 1914 aa] {ON} Anc_...    39   0.18 
TBLA0A05300 Chr1 (1297764..1299887) [2124 bp, 707 aa] {ON} Anc_1...    38   0.18 
SAKL0H03322g Chr8 complement(314365..317700) [3336 bp, 1111 aa] ...    38   0.23 
Ecym_8397 Chr8 (818932..819999) [1068 bp, 355 aa] {ON} similar t...    37   0.27 
Ecym_5344 Chr5 (696147..699455) [3309 bp, 1102 aa] {ON} similar ...    37   0.40 
KAFR0A06040 Chr1 complement(1222239..1225547) [3309 bp, 1102 aa]...    36   0.70 
Ecym_8321 Chr8 complement(652652..653986) [1335 bp, 444 aa] {ON}...    36   0.79 
KLTH0D14080g Chr4 (1149555..1152863) [3309 bp, 1102 aa] {ON} sim...    36   0.83 
TDEL0F03120 Chr6 (570471..572192) [1722 bp, 573 aa] {ON} Anc_3.4...    35   1.1  
TDEL0G02810 Chr7 (540540..543824) [3285 bp, 1094 aa] {ON} Anc_2....    36   1.1  
KLTH0D08558g Chr4 complement(715949..718741) [2793 bp, 930 aa] {...    35   1.4  
Ecym_1072 Chr1 (137296..139347) [2052 bp, 683 aa] {ON} similar t...    35   1.5  
AER044W Chr5 (714355..717666) [3312 bp, 1103 aa] {ON} Syntenic h...    35   1.6  
Skud_2.110 Chr2 (207224..214711) [7488 bp, 2495 aa] {ON} YBL004W...    35   2.2  
Kpol_2000.79 s2000 complement(175048..177171) [2124 bp, 707 aa] ...    35   2.3  
KLTH0B01100g Chr2 complement(94260..98156) [3897 bp, 1298 aa] {O...    35   2.5  
TBLA0F02750 Chr6 (661437..665681) [4245 bp, 1414 aa] {ON} Anc_7....    34   3.2  
NCAS0B08700 Chr2 (1674262..1676409) [2148 bp, 715 aa] {ON} Anc_1...    34   3.3  
TPHA0D01120 Chr4 (234669..235715) [1047 bp, 348 aa] {ON} Anc_8.6...    33   3.3  
Smik_10.298 Chr10 complement(464213..465262) [1050 bp, 349 aa] {...    33   4.3  
AFR683C Chr6 complement(1697786..1699819) [2034 bp, 677 aa] {ON}...    33   4.7  
YDL058W Chr4 (345665..351037) [5373 bp, 1790 aa] {ON}  USO1Essen...    33   4.7  
NCAS0A01630 Chr1 complement(317259..320390) [3132 bp, 1043 aa] {...    33   5.3  
Kwal_33.15561 s33 (1157299..1161192) [3894 bp, 1297 aa] {ON} YKL...    33   5.6  
ZYRO0F17050g Chr6 complement(1417445..1419589) [2145 bp, 714 aa]...    33   6.2  
YHR023W Chr8 (151666..157452) [5787 bp, 1928 aa] {ON}  MYO1Type ...    33   6.3  
YEL043W Chr5 (70478..73348) [2871 bp, 956 aa] {ON} Predicted cyt...    33   7.0  
KAFR0G03200 Chr7 complement(663726..669335) [5610 bp, 1869 aa] {...    33   8.0  
NCAS0A02450 Chr1 complement(463760..469546) [5787 bp, 1928 aa] {...    33   8.3  
Skud_4.584 Chr4 (1040035..1040086,1040162..1040345,1040376..1041...    32   8.8  

>AGR089C Chr7 complement(901437..905549) [4113 bp, 1370 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YLR086W
            (SMC4)
          Length = 1370

 Score = 2658 bits (6890), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1311/1370 (95%), Positives = 1311/1370 (95%)

Query: 1    MDIPTPKKPRILDTPVKLLATSPDRKNVVSRGSSVSTTMGLRGPSLQPPVAHQIXXXXXX 60
            MDIPTPKKPRILDTPVKLLATSPDRKNVVSRGSSVSTTMGLRGPSLQPPVAHQI      
Sbjct: 1    MDIPTPKKPRILDTPVKLLATSPDRKNVVSRGSSVSTTMGLRGPSLQPPVAHQISRGRSQ 60

Query: 61   XXXXXXXXXXXXXXXAVELIQLSPIKNSRLELQRLYDTKQKKVERLCIRTLVLENFKSYA 120
                           AVELIQLSPIKNSRLELQRLYDTKQKKVERLCIRTLVLENFKSYA
Sbjct: 61   YSQSPPRSPNRSPGRAVELIQLSPIKNSRLELQRLYDTKQKKVERLCIRTLVLENFKSYA 120

Query: 121  GRQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFAFGFRANKMRQGKLSHLIHKSEKYPDLD 180
            GRQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFAFGFRANKMRQGKLSHLIHKSEKYPDLD
Sbjct: 121  GRQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFAFGFRANKMRQGKLSHLIHKSEKYPDLD 180

Query: 181  FCSVEIQFQYVVDEPDGTTRVLSGKPELSVMRKAFKNNTSKYYLNGKESTYTEVTRLLRD 240
            FCSVEIQFQYVVDEPDGTTRVLSGKPELSVMRKAFKNNTSKYYLNGKESTYTEVTRLLRD
Sbjct: 181  FCSVEIQFQYVVDEPDGTTRVLSGKPELSVMRKAFKNNTSKYYLNGKESTYTEVTRLLRD 240

Query: 241  EGIDLDHKRFLILQGEVESIAQMKPKAEHEGDDGLLEYLEDIIGTTKYKAQIEQALVEVD 300
            EGIDLDHKRFLILQGEVESIAQMKPKAEHEGDDGLLEYLEDIIGTTKYKAQIEQALVEVD
Sbjct: 241  EGIDLDHKRFLILQGEVESIAQMKPKAEHEGDDGLLEYLEDIIGTTKYKAQIEQALVEVD 300

Query: 301  SLNDICMEKENRFDLVEKEKLSLEPGKDEALAFLKKEKDLTLLMSKKYQYHLFHNGSKLA 360
            SLNDICMEKENRFDLVEKEKLSLEPGKDEALAFLKKEKDLTLLMSKKYQYHLFHNGSKLA
Sbjct: 301  SLNDICMEKENRFDLVEKEKLSLEPGKDEALAFLKKEKDLTLLMSKKYQYHLFHNGSKLA 360

Query: 361  KTLSNVSNTMNXXXXXXXXXXXXXXXXXXLTDASEQLANRLVSMNNTNKESLAKMRQLER 420
            KTLSNVSNTMN                  LTDASEQLANRLVSMNNTNKESLAKMRQLER
Sbjct: 361  KTLSNVSNTMNKLEQEKAKKVEAQKEIVELTDASEQLANRLVSMNNTNKESLAKMRQLER 420

Query: 421  ELVSNEEKQKSLLQKRSKAEKTLNTVEKSIKQCENKIEEYISQNQEYETSLTTLNHTIVD 480
            ELVSNEEKQKSLLQKRSKAEKTLNTVEKSIKQCENKIEEYISQNQEYETSLTTLNHTIVD
Sbjct: 421  ELVSNEEKQKSLLQKRSKAEKTLNTVEKSIKQCENKIEEYISQNQEYETSLTTLNHTIVD 480

Query: 481  AQAELEKMKLALSDKTGDITKEVAVLEKELEPWTNKVEEKKSEIKLVESEISIIKEADLK 540
            AQAELEKMKLALSDKTGDITKEVAVLEKELEPWTNKVEEKKSEIKLVESEISIIKEADLK
Sbjct: 481  AQAELEKMKLALSDKTGDITKEVAVLEKELEPWTNKVEEKKSEIKLVESEISIIKEADLK 540

Query: 541  LESEIANLSQEIEQLRGNISHREESIETLNVESSSIRDYILVGERECTSARSKLEEMKKV 600
            LESEIANLSQEIEQLRGNISHREESIETLNVESSSIRDYILVGERECTSARSKLEEMKKV
Sbjct: 541  LESEIANLSQEIEQLRGNISHREESIETLNVESSSIRDYILVGERECTSARSKLEEMKKV 600

Query: 601  LVTHRQRVNDARSAVSSAENKNKVLTALSRLQKSGRIDGYHGRLGDLGTIDDKYDIAIST 660
            LVTHRQRVNDARSAVSSAENKNKVLTALSRLQKSGRIDGYHGRLGDLGTIDDKYDIAIST
Sbjct: 601  LVTHRQRVNDARSAVSSAENKNKVLTALSRLQKSGRIDGYHGRLGDLGTIDDKYDIAIST 660

Query: 661  ACPRLDDIVVDTVECGQQCIEHLRKNKLGYARFILLDKLRKFNLQPAHTPENVPRLFDLV 720
            ACPRLDDIVVDTVECGQQCIEHLRKNKLGYARFILLDKLRKFNLQPAHTPENVPRLFDLV
Sbjct: 661  ACPRLDDIVVDTVECGQQCIEHLRKNKLGYARFILLDKLRKFNLQPAHTPENVPRLFDLV 720

Query: 721  KPKEPKFAPAFYSVLRDTLVTTDLSQANRVAYGKKRYRVVTLDGKLIDISGTMTGGGDRA 780
            KPKEPKFAPAFYSVLRDTLVTTDLSQANRVAYGKKRYRVVTLDGKLIDISGTMTGGGDRA
Sbjct: 721  KPKEPKFAPAFYSVLRDTLVTTDLSQANRVAYGKKRYRVVTLDGKLIDISGTMTGGGDRA 780

Query: 781  ASGLMKSTQQSSLYTPEEVQRMEEELNEREKNFKVAFETFQEMESALQNYLDRQPEIEVE 840
            ASGLMKSTQQSSLYTPEEVQRMEEELNEREKNFKVAFETFQEMESALQNYLDRQPEIEVE
Sbjct: 781  ASGLMKSTQQSSLYTPEEVQRMEEELNEREKNFKVAFETFQEMESALQNYLDRQPEIEVE 840

Query: 841  LSKQKMDIETISAELESKIERKLELERSNKTSIEDSSELRTAEEKLAALNADLNSFMSAS 900
            LSKQKMDIETISAELESKIERKLELERSNKTSIEDSSELRTAEEKLAALNADLNSFMSAS
Sbjct: 841  LSKQKMDIETISAELESKIERKLELERSNKTSIEDSSELRTAEEKLAALNADLNSFMSAS 900

Query: 901  ESKNQRIKELRAKIMEIGGLELQTLNSKVDSLNXXXXXXXXXXXXXXXXXXXXELELKRA 960
            ESKNQRIKELRAKIMEIGGLELQTLNSKVDSLN                    ELELKRA
Sbjct: 901  ESKNQRIKELRAKIMEIGGLELQTLNSKVDSLNQQIKIVAAKQKKDKTAQKKAELELKRA 960

Query: 961  RKQQITAKDDIEHCDIEIQKMKSSYDTISTGMQELQKQLSDLQEEIGTLTDEHAVTKHEL 1020
            RKQQITAKDDIEHCDIEIQKMKSSYDTISTGMQELQKQLSDLQEEIGTLTDEHAVTKHEL
Sbjct: 961  RKQQITAKDDIEHCDIEIQKMKSSYDTISTGMQELQKQLSDLQEEIGTLTDEHAVTKHEL 1020

Query: 1021 DQKNEKIDSYSSIEIELTEQLQKLQNLANYLKKEMNEYDSKLSHLKLRDLGQVMLDLEEN 1080
            DQKNEKIDSYSSIEIELTEQLQKLQNLANYLKKEMNEYDSKLSHLKLRDLGQVMLDLEEN
Sbjct: 1021 DQKNEKIDSYSSIEIELTEQLQKLQNLANYLKKEMNEYDSKLSHLKLRDLGQVMLDLEEN 1080

Query: 1081 KSLQSFSHSPTPDTKRENIQSSMLETHLASPSPNERKISIAENNLSMEVDEQASVLENGL 1140
            KSLQSFSHSPTPDTKRENIQSSMLETHLASPSPNERKISIAENNLSMEVDEQASVLENGL
Sbjct: 1081 KSLQSFSHSPTPDTKRENIQSSMLETHLASPSPNERKISIAENNLSMEVDEQASVLENGL 1140

Query: 1141 PKLPDSELARVDLEDLERDIVQLQDYIDNSTVDIEILDEYAKRLAEYRRRRIDLNEAIMK 1200
            PKLPDSELARVDLEDLERDIVQLQDYIDNSTVDIEILDEYAKRLAEYRRRRIDLNEAIMK
Sbjct: 1141 PKLPDSELARVDLEDLERDIVQLQDYIDNSTVDIEILDEYAKRLAEYRRRRIDLNEAIMK 1200

Query: 1201 RDETRMHCEVLKKRRLDEFMEGFGIISITLKEMYQMITMGGNAELELVDSLDPFSEGVLF 1260
            RDETRMHCEVLKKRRLDEFMEGFGIISITLKEMYQMITMGGNAELELVDSLDPFSEGVLF
Sbjct: 1201 RDETRMHCEVLKKRRLDEFMEGFGIISITLKEMYQMITMGGNAELELVDSLDPFSEGVLF 1260

Query: 1261 SVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANY 1320
            SVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANY
Sbjct: 1261 SVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANY 1320

Query: 1321 IKERTKNAQFIVISLRNNMFELAQRLVGIYKNSNMTRSTTLQNRDIINVL 1370
            IKERTKNAQFIVISLRNNMFELAQRLVGIYKNSNMTRSTTLQNRDIINVL
Sbjct: 1321 IKERTKNAQFIVISLRNNMFELAQRLVGIYKNSNMTRSTTLQNRDIINVL 1370

>Ecym_4311 Chr4 complement(666871..671001) [4131 bp, 1376 aa] {ON}
            similar to Ashbya gossypii AGR089C
          Length = 1376

 Score = 1618 bits (4191), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 834/1376 (60%), Positives = 1026/1376 (74%), Gaps = 11/1376 (0%)

Query: 2    DIPTPKKPRILDTPVKLLATSPDRKNVVSRGSSVSTTMGLRGPSLQPPVAHQIXXXXXXX 61
            D+ T KKP+ LDTP KL+  SP RK+V S+ SS STT  LRGPSLQPP   Q+       
Sbjct: 3    DLRTSKKPKHLDTPSKLMFGSPGRKHVASQASSNSTT-ALRGPSLQPPTYSQLSRGRSVY 61

Query: 62   XXXXXXXXXXXXXXAVELIQLSPIKNSRLELQRLYDTKQKKVERLCIRTLVLENFKSYAG 121
                           +ELIQLSPIKNSRLELQ++YD KQ   +RL I+ L+L NFKSYAG
Sbjct: 62   SQSPPRSPNRSPARRIELIQLSPIKNSRLELQKIYDGKQTTTKRLSIKNLILNNFKSYAG 121

Query: 122  RQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFAFGFRANKMRQGKLSHLIHKSEKYPDLDF 181
             QVVGPFHSSFSAVVGPNGSGKSNVIDSMLF FGFRANKMRQGKLS+LIHKSE + +L F
Sbjct: 122  VQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLSNLIHKSENHENLSF 181

Query: 182  CSVEIQFQYVVDEPDGTTRVLSGKPELSVMRKAFKNNTSKYYLNGKESTYTEVTRLLRDE 241
            CSVEI FQYV+D+ DG T+VL    ELSVMRK FKNNTSKYY+NGKES+YTEVT+ LR+E
Sbjct: 182  CSVEITFQYVMDDADGNTKVLPDVQELSVMRKVFKNNTSKYYINGKESSYTEVTQFLRNE 241

Query: 242  GIDLDHKRFLILQGEVESIAQMKPKAEHEGDDGLLEYLEDIIGTTKYKAQIEQALVEVDS 301
            GIDLDHKRFLILQGEVESIAQMKPKA+HEGDDGLLEYLEDIIGT KYK+QI  ALVE+D+
Sbjct: 242  GIDLDHKRFLILQGEVESIAQMKPKADHEGDDGLLEYLEDIIGTAKYKSQIRDALVEMDT 301

Query: 302  LNDICMEKENRFDLVEKEKLSLEPGKDEALAFLKKEKDLTLLMSKKYQYHLFHNGSKLAK 361
            LNDICMEKE RF+LVEKEK SLE GK++AL F+ KEK LTLL SK+ Q+ +     KLA 
Sbjct: 302  LNDICMEKEIRFELVEKEKRSLEAGKEQALEFIAKEKQLTLLKSKQLQWDINKETKKLAV 361

Query: 362  TLSNVSNTMNXXXXXXXXXXXXXXXXXXLTDASEQLANRLVSMNNTNKESLAKMRQLERE 421
            TL  +S                      L + S+ L  ++  +N    + +    QL+RE
Sbjct: 362  TLDKISAFTEKLENERNKYGELQKEITDLRELSDNLEEQITKINAEKSQLVKDKLQLQRE 421

Query: 422  LVSNEEKQKSLLQKRSKAEKTLNTVEKSIKQCENKIEEYISQNQEYETSLTTLNHTIVDA 481
            LVS+EEK KSL QKR+KAEKTL   EK+I+ CEN I        E+E SL  LN ++   
Sbjct: 422  LVSSEEKLKSLNQKRTKAEKTLQVAEKNIRHCENNIRRLNEAQTEFENSLLELNESLHSE 481

Query: 482  QAELEKMKLALSDKTGDITKEVAVLEKELEPWTNKVEEKKSEIKLVESEISIIKEADLKL 541
            ++EL+ +K++L DKT  I++EVA LEKELEPWT K+E K S+IKL ESEI IIKE+ LKL
Sbjct: 482  RSELDAIKMSLRDKTSSISEEVASLEKELEPWTTKLEAKNSQIKLAESEILIIKESKLKL 541

Query: 542  ESEIANLSQEIEQLRGNISHREESIETLNVESSSIRDYILVGERECTSARSKLEEMKKVL 601
            E EI+ L ++IE  +  I + ++ I  L  ES++I  +I   + EC SA+ KL +MK+VL
Sbjct: 542  EQEISQLRKDIESYKDRIENHKKKINKLEKESAAITSFISTAQGECDSAKKKLVDMKQVL 601

Query: 602  VTHRQRVNDARSAVSSAENKNKVLTALSRLQKSGRIDGYHGRLGDLGTIDDKYDIAISTA 661
              HRQR+ DAR A+S+ ENKNKVL AL RLQKSGRI G+HGRLGDLGTIDDKYDIAIS A
Sbjct: 602  TNHRQRMTDARVALSNVENKNKVLGALCRLQKSGRIHGFHGRLGDLGTIDDKYDIAISVA 661

Query: 662  CPRLDDIVVDTVECGQQCIEHLRKNKLGYARFILLDKLRKFNLQPAHTPENVPRLFDLVK 721
            CPRLDDIVV+TVEC QQCIEHLRKNKLGYARFILLDKL+KFN+    TPENVPRLFDL  
Sbjct: 662  CPRLDDIVVETVECAQQCIEHLRKNKLGYARFILLDKLKKFNMAKVTTPENVPRLFDLTT 721

Query: 722  PKEPKFAPAFYSVLRDTLVTTDLSQANRVAYGKKRYRVVTLDGKLIDISGTMTGGGDRAA 781
            PK   FAPA YSVLRDTLV  DL+QANRVAYG +R+RVVTLDGKLIDISGTM+GGGDR  
Sbjct: 722  PKNEIFAPALYSVLRDTLVAKDLAQANRVAYGTRRFRVVTLDGKLIDISGTMSGGGDRVV 781

Query: 782  SGLMKSTQQSS-LYTPEEVQRMEEELNEREKNFKVAFETFQEMESALQNYLDRQPEIEVE 840
             GLMKS Q+S+ +YT EEVQRME EL +RE NFK+A +TFQEME+ALQ Y DRQP I+VE
Sbjct: 782  KGLMKSKQRSNDMYTSEEVQRMEAELTDRETNFKIATDTFQEMEAALQKYKDRQPNIDVE 841

Query: 841  LSKQKMDIETISAELESKIERKLELERSNKTSIEDSSELRTAEEKLAALNADLNSFMSAS 900
            +SK K+DI+T+S+EL+SK +  +ELE + + +  D+  L   E +L ALN++L +    S
Sbjct: 842  ISKHKIDIDTLSSELQSKKDTLIELESTAENNQRDNGPLEDIENQLVALNSELVALKDES 901

Query: 901  ESKNQRIKELRAKIMEIGGLELQTLNSKVDSLNXXXXXXXXXXXXXXXXXXXXELELKRA 960
            + KN++I ELRA+IM+IGGL+LQ+ NSKVDSL                     ELE+ RA
Sbjct: 902  KVKNEQISELRAQIMKIGGLKLQSQNSKVDSLTQQLQIIVAKQKKNRTELKKNELEMNRA 961

Query: 961  RKQQITAKDDIEHCDIEIQKMKSSYDTISTGMQELQKQLSDLQEEIGTLTDEHAVTKHEL 1020
             KQ++ A++DI HC+IE+ K  +S++ +  G++E +  +  ++++   L  EH   K  L
Sbjct: 962  SKQKLGAENDINHCEIELSKTNNSHEALQEGLRETEHLIEVIEDKKEQLNQEHETAKKNL 1021

Query: 1021 DQKNEKIDSYSSIEIELTEQLQKLQNLANYLKKEMNEYDSKLSHLKLRDLGQVMLDLEE- 1079
            D K   ++ + S EIE+   L+KL+NL +++K E++  D +L+ LKLRD+ Q++  L+E 
Sbjct: 1022 DDKAAYVEKFKSEEIEMCTHLEKLKNLEHHIKAEISRTDEELNTLKLRDVEQLLQKLDEH 1081

Query: 1080 NKSLQSFS-HSPTPDTKRENIQSSMLETHLASPSPNERK-ISIAENNL----SMEVDEQA 1133
            N  L+S +  + TP    + I    +E H A  +  E K IS   N+     SM+VD+ A
Sbjct: 1082 NLPLESLTDRAVTPSN--QCIPEMTVEDHDADMNDGEAKLISEDPNSFNDQESMDVDQDA 1139

Query: 1134 SVLENGLPKLPDSELARVDLEDLERDIVQLQDYIDNSTVDIEILDEYAKRLAEYRRRRID 1193
            S +  GLPKL ++EL  +D+E+L  +I QL++Y+D +  DI+IL+EYA RLAEY+RR++D
Sbjct: 1140 SYIGPGLPKLTEAELDNIDIEELALEIAQLKEYMDTAYADIDILEEYALRLAEYKRRKLD 1199

Query: 1194 LNEAIMKRDETRMHCEVLKKRRLDEFMEGFGIISITLKEMYQMITMGGNAELELVDSLDP 1253
            LNE++ KR+E R   E+LKK RL+EFM+GFGIIS+T+KE+YQMITMGGNAELELVDSLDP
Sbjct: 1200 LNESVEKREEIRNRYEMLKKSRLEEFMDGFGIISMTVKEIYQMITMGGNAELELVDSLDP 1259

Query: 1254 FSEGVLFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRN 1313
            FSEGVLFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRN
Sbjct: 1260 FSEGVLFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRN 1319

Query: 1314 VSIVANYIKERTKNAQFIVISLRNNMFELAQRLVGIYKNSNMTRSTTLQNRDIINV 1369
            VSIVANYIKERTKNAQFIVISLRNNMFELAQ+L+GIYK+SNMT+STTLQN DI+N+
Sbjct: 1320 VSIVANYIKERTKNAQFIVISLRNNMFELAQQLIGIYKSSNMTKSTTLQNIDILNI 1375

>SAKL0H17094g Chr8 complement(1508021..1512289) [4269 bp, 1422 aa]
            {ON} similar to uniprot|Q12267 Saccharomyces cerevisiae
            YLR086W SMC4 Subunit of the condensin complex which
            reorganizes chromosomes during cell division forms a
            stable complex with Smc2p that has ATP-hydrolyzing and
            DNA- binding activity and promotes knotting of circular
            DNA potential Cdc28p substrate
          Length = 1422

 Score = 1456 bits (3770), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 775/1387 (55%), Positives = 983/1387 (70%), Gaps = 37/1387 (2%)

Query: 3    IPTPKKPRILDTPVKLLATSPDRKNVVSRGSSVSTTMGLRGPSLQPP---VAHQIXXXXX 59
            +P+P       TP KL+  SP++K   S+ S+ S+      P+LQPP    +        
Sbjct: 50   LPSP-------TPRKLVLGSPEKKYAYSQPSTSSSLS---VPNLQPPNVDGSRGRRFYSQ 99

Query: 60   XXXXXXXXXXXXXXXXAVELIQLSPIKNSRLELQRLYDTKQKK----VERLCIRTLVLEN 115
                             +ELIQLSP+KN+R ELQ++YD K K     V RLCI  L L N
Sbjct: 100  SPPRSPHRSPNRSPTRRLELIQLSPVKNNRAELQKIYDEKNKDGNQCVHRLCIDKLSLHN 159

Query: 116  FKSYAGRQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFAFGFRANKMRQGKLSHLIHKSEK 175
            FKSYAG Q++GPFH+SFSAVVGPNGSGKSNVIDSMLF FGFRANKMRQGKLS LIHKSE 
Sbjct: 160  FKSYAGTQIIGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLSDLIHKSEA 219

Query: 176  YPDLDFCSVEIQFQYVVDEPDGTTRVLSGKPELSVMRKAFKNNTSKYYLNGKESTYTEVT 235
            YP+L+ CSV+I F+YVVDE DGTTR    KP + + RKAF+NN+SKYY++GKES YTEVT
Sbjct: 220  YPNLESCSVDIHFRYVVDESDGTTRSDDEKPPMVITRKAFRNNSSKYYIDGKESNYTEVT 279

Query: 236  RLLRDEGIDLDHKRFLILQGEVESIAQMKPKAEHEGDDGLLEYLEDIIGTTKYKAQIEQA 295
            +LLRD+GIDLDHKRFLILQGEVESI+QMKPKAE E DDGLLEYLEDIIGT KYKA IE  
Sbjct: 280  QLLRDQGIDLDHKRFLILQGEVESISQMKPKAERESDDGLLEYLEDIIGTAKYKAGIEAG 339

Query: 296  LVEVDSLNDICMEKENRFDLVEKEKLSLEPGKDEALAFLKKEKDLTLLMSKKYQYHLFHN 355
            LVE+D+LND+C+EKENRF+LVEKEK SLE GKDEAL FL+KEK LTLL SK  QYH++ +
Sbjct: 340  LVEIDTLNDVCVEKENRFELVEKEKNSLESGKDEALEFLEKEKSLTLLKSKLAQYHIWQD 399

Query: 356  GSKLAKTLSNVSNTMNXXXXXXXXXXXXXXXXXXLTDASEQLANRLVSMNNTNKESLAKM 415
              KL++TL  +S                      L +       ++V ++  +K+  +K 
Sbjct: 400  QRKLSETLGKISELNEHLGQEKAKYDQFQREVAQLRERCNDFKKQMVKLDKEHKDLTSKR 459

Query: 416  RQLERELVSNEEKQKSLLQKRSKAEKTLNTVEKSIKQCENKIEEYISQNQEYETSLTTLN 475
            R ++RE  S EEKQ++L +KR KAEK L + E S+   ++K+EE  +  ++Y+  L  LN
Sbjct: 460  RLMDREKTSMEEKQRNLDKKRLKAEKLLKSTENSMADSKHKLEELNNSQKQYKEKLLQLN 519

Query: 476  HTIVDAQAELEKMKLALSDKTGDITKEVAVLEKELEPWTNKVEEKKSEIKLVESEISIIK 535
             ++++ +++L+++KL+L DKT +I+ E+A  E++LEPW  +++EKKS++KL ES+I+I+K
Sbjct: 520  ESLLEERSKLDEIKLSLRDKTSEISAEIANHERDLEPWNAQLQEKKSQMKLTESQIAILK 579

Query: 536  EADLKLESEIANLSQEIEQLRGNISHREESIETLNVESSSIRDYILVGERECTSARSKLE 595
            E+  K    I  L  EIE      + +E +I  L  E ++I   I +GE+EC SA SKL 
Sbjct: 580  ESKEKKVQNIIQLKTEIEAFAEKNNVQEIAIHKLQCEQANILKRIDIGEKECGSASSKLG 639

Query: 596  EMKKVLVTHRQRVNDARSAVSSAENKNKVLTALSRLQKSGRIDGYHGRLGDLGTIDDKYD 655
            EMK VL++HRQR  +ARS +S+ ENKNKVL+AL RLQ+SGRI G+HGRLGDLGTIDD YD
Sbjct: 640  EMKNVLISHRQRAMEARSTLSNVENKNKVLSALIRLQRSGRIAGFHGRLGDLGTIDDMYD 699

Query: 656  IAISTACPRLDDIVVDTVECGQQCIEHLRKNKLGYARFILLDKLRKFNLQPAHTPENVPR 715
            +AISTACPRLDDIVVD VECGQQCIEHLRKNKLGYARFI+LDKLRKFNL P  TPE VPR
Sbjct: 700  VAISTACPRLDDIVVDNVECGQQCIEHLRKNKLGYARFIILDKLRKFNLSPIQTPETVPR 759

Query: 716  LFDLVKPKEPKFAPAFYSVLRDTLVTTDLSQANRVAYGKKRYRVVTLDGKLIDISGTMTG 775
            LFDLV+ K  KF PAFYSVLRDTLV +DL QANRVAYGK+R+RVVTLDGKLID SGT++G
Sbjct: 760  LFDLVRSKNGKFLPAFYSVLRDTLVVSDLKQANRVAYGKRRFRVVTLDGKLIDTSGTLSG 819

Query: 776  GGDRAASGLMKSTQQ-SSLYTPEEVQRMEEELNEREKNFKVAFETFQEMESALQNYLDRQ 834
            GG     GLMKS QQ  + YTPEEVQ +E+ELNEREKNF +A ETF +ME AL+ + DR+
Sbjct: 820  GGTHVMKGLMKSKQQPGAGYTPEEVQNIEKELNEREKNFHIAIETFHDMEEALKKFKDRE 879

Query: 835  PEIEVELSKQKMDIETISAELESKIERKLELERS-NKTSIEDSSELRTAEEKLAALNADL 893
            PEIEVE++K+++DIE+ S EL+ K E+  ELE   +  S+ED  EL  AE KL  L+ + 
Sbjct: 880  PEIEVEIAKRRLDIESSSTELKLKQEQLKELETDRDGGSVED-RELADAESKLQVLSEEY 938

Query: 894  NSFMSASESKNQRIKELRAKIMEIGGLELQTLNSKVDSLNXXXXXXXXXXXXXXXXXXXX 953
            +   + +++K Q I  L+ KIM+IGG +LQ  NSKV+S+N                    
Sbjct: 939  DEIENETKNKQQLINSLKEKIMKIGGTKLQLQNSKVNSINEQINIISSKQKKDRTATKKA 998

Query: 954  ELELKRARKQQITAKDDIEHCDIEIQKMKSSYDTISTGMQELQKQLSDLQEEIGTLTDEH 1013
            E +LKR   Q   A +DIE C++EI K+      +   + +L   L++ +     + +E 
Sbjct: 999  ENDLKRLENQCREASNDIESCNLEISKISVLNTELEAKIYKLDTSLNETESLKEEVEEEF 1058

Query: 1014 AVTKHELDQKNEKIDSYSSIEIELTEQLQKLQNLANYLKKEMNEYDSKLSHLKLRDLGQV 1073
               K  L++K      + S+EIE+  +L+KL  L +++KKE+     +L+ LK+RD+ Q 
Sbjct: 1059 ERVKTNLEEKTNNTSDFKSVEIEINNRLEKLNGLTSHIKKEIKYNKDELNSLKIRDITQT 1118

Query: 1074 MLDLEENKSLQSFSHSPTPDTKRENIQSSMLETHLASPSPNERKI---SIAENNL----- 1125
            +  L E K  +   +    + + E +Q    E    S  PN   I     AE        
Sbjct: 1119 LQALNEGKLPE--ENEDDFEVQDEEVQREQREM---SSDPNAMDIDEEQAAEQFQVQQTD 1173

Query: 1126 ----SMEVDEQASVLENGLPKLPDSELARVDLEDLERDIVQLQDYIDNSTVDIEILDEYA 1181
                SM++DE  +   NGLPK  +++L  + +ED+E  I +L  Y+DN+ VDI++L+EYA
Sbjct: 1174 GEIDSMDIDEYENETSNGLPKFSEAQLQSIQIEDVELQIDELNHYVDNAHVDIDVLEEYA 1233

Query: 1182 KRLAEYRRRRIDLNEAIMKRDETRMHCEVLKKRRLDEFMEGFGIISITLKEMYQMITMGG 1241
            +RLAEY++R++DLN+A++KRDE R +CE LKK+RLD+FMEGF IIS+TLKEMYQMITMGG
Sbjct: 1234 RRLAEYKKRKLDLNQAVLKRDEVRKNCEELKKKRLDKFMEGFSIISMTLKEMYQMITMGG 1293

Query: 1242 NAELELVDSLDPFSEGVLFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYV 1301
            NAELELVDSLDPFSEGVLFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKY+PTPLYV
Sbjct: 1294 NAELELVDSLDPFSEGVLFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYRPTPLYV 1353

Query: 1302 MDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQRLVGIYKNSNMTRSTTL 1361
            MDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQ+LVGIYKN+NMTRSTTL
Sbjct: 1354 MDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKNNNMTRSTTL 1413

Query: 1362 QNRDIIN 1368
            QN DI+N
Sbjct: 1414 QNIDILN 1420

>Kwal_56.23825 s56 complement(721498..725688) [4191 bp, 1396 aa] {ON}
            YLR086W (SMC4) - SMC chromosomal ATPase family member
            [contig 172] FULL
          Length = 1396

 Score = 1363 bits (3529), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 734/1370 (53%), Positives = 953/1370 (69%), Gaps = 26/1370 (1%)

Query: 14   TPVKLLATSPDRKNVVSRGSSVSTTMGLRGPSLQPPVAHQIXXXXXXXXXXXXXXXXXXX 73
            TP KL+  SPD++   S+  S S++     P LQP                         
Sbjct: 36   TPRKLVLGSPDKRFAFSQPVSSSSS---NVPHLQPLKNELSSSRGRVYSQSPPRSPNRSP 92

Query: 74   XXAVELIQLSPIKNSRLELQRLYDTK--QKKVERLCIRTLVLENFKSYAGRQVVGPFHSS 131
               +ELIQLSP+K SRLE Q+  +++     ++RLCI  LVL NFKSYAG QVVGPFH+S
Sbjct: 93   TRKLELIQLSPMKKSRLESQKFQESRAMMGSIQRLCIDRLVLHNFKSYAGTQVVGPFHNS 152

Query: 132  FSAVVGPNGSGKSNVIDSMLFAFGFRANKMRQGKLSHLIHKSEKYPDLDFCSVEIQFQYV 191
            FSAVVGPNGSGKSNVIDS+LF FGFRANKMRQGKLS LIHKSE +PDLD C V+I FQYV
Sbjct: 153  FSAVVGPNGSGKSNVIDSLLFVFGFRANKMRQGKLSELIHKSELHPDLDSCHVDIFFQYV 212

Query: 192  VDEPDGTTRVLSGKPELSVMRKAFKNNTSKYYLNGKESTYTEVTRLLRDEGIDLDHKRFL 251
             DEPDGTT ++  KP + + RKAF+NNTSKYYLNGKES+YT +T+LLRDEGIDLDHKRFL
Sbjct: 213  QDEPDGTTSIIQQKPSMVIRRKAFRNNTSKYYLNGKESSYTIITQLLRDEGIDLDHKRFL 272

Query: 252  ILQGEVESIAQMKPKAEHEGDDGLLEYLEDIIGTTKYKAQIEQALVEVDSLNDICMEKEN 311
            ILQGEVESIAQMKPKAE E DDGLLEYLEDIIGT +YK  IE  L E+  LNDIC EKEN
Sbjct: 273  ILQGEVESIAQMKPKAEKESDDGLLEYLEDIIGTAQYKPLIENTLSEIAKLNDICEEKEN 332

Query: 312  RFDLVEKEKLSLEPGKDEALAFLKKEKDLTLLMSKKYQYHLFHNGSKLAKTLSNVSNTMN 371
            RF++VE+EK SLE GK+EAL +L+KEK LT+L SK  QYHL+ N  KL  T   ++    
Sbjct: 333  RFEIVEREKSSLEQGKNEALEYLEKEKTLTILRSKLLQYHLWKNEQKLNSTKEKIAKAQE 392

Query: 372  XXXXXXXXXXXXXXXXXXLTDASEQLANRLVSMNNTNKESLAKMRQLERELVSNEEKQKS 431
                              +    + L   L  +  + K+   + R  +R+ VS EEK K+
Sbjct: 393  KLSAEKAKRTKHSEEMAAMKADLQSLKLILGDLGESEKKLTLEKRACDRDRVSLEEKLKN 452

Query: 432  LLQKRSKAEKTLNTVEKSIKQCENKIEEYISQNQEYETSLTTLNHTIVDAQAELEKMKLA 491
            L QK  K+ ++L ++  SI   + K+EE  +  +++E  L  LN T+ + + +L+++K +
Sbjct: 453  LTQKEVKSSRSLQSITSSISTTQAKMEELANDQEQHEKDLLELNGTMKEEKEKLDEIKSS 512

Query: 492  LSDKTGDITKEVAVLEKELEPWTNKVEEKKSEIKLVESEISIIKEADLKLESEIANLSQE 551
            L DK   I++++  +EKELEPW  K++EKK+++KL E+ IS+ KE+  K+E +I  +++ 
Sbjct: 513  LKDKISLISEQIREIEKELEPWNVKLQEKKAQVKLEETTISVFKESHAKIEQDIILVNKG 572

Query: 552  IEQLRGNISHREESIETLNVESSSIRDYILVGERECTSARSKLEEMKKVLVTHRQRVNDA 611
            I++LR  ++ +  S+ +L  E   I   + VG+ EC +A  K++EMK +L  HRQR  DA
Sbjct: 573  IDELRNKMNEQRGSVFSLEKEQVDIGRQLTVGQSECDNAVKKIKEMKGILTAHRQRSIDA 632

Query: 612  RSAVSSAENKNKVLTALSRLQKSGRIDGYHGRLGDLGTIDDKYDIAISTACPRLDDIVVD 671
            RS++S+ ENKNKVL AL RLQ+SGRI G+HGRLGDLGTIDDKYD+AISTACPRLDDIVV+
Sbjct: 633  RSSLSTFENKNKVLAALLRLQRSGRISGFHGRLGDLGTIDDKYDVAISTACPRLDDIVVE 692

Query: 672  TVECGQQCIEHLRKNKLGYARFILLDKLRKFNLQPAHTPENVPRLFDLVKPKEPKFAPAF 731
            TVECGQQCIE+LRKNKLGYARFILLDKLR FNL P  TPENVPRL+DLV+P  PKF  AF
Sbjct: 693  TVECGQQCIEYLRKNKLGYARFILLDKLRNFNLSPIKTPENVPRLYDLVRPNNPKFRNAF 752

Query: 732  YSVLRDTLVTTDLSQANRVAYGKKRYRVVTLDGKLIDISGTMTGGGDRAASGLMKSTQQS 791
            YSVLRDTLV  DL +AN+VAYGK+RYRVVTLDGKLID+SGTM+GGG+  A G+MKS QQS
Sbjct: 753  YSVLRDTLVAKDLKEANKVAYGKQRYRVVTLDGKLIDLSGTMSGGGNFKARGMMKSEQQS 812

Query: 792  -SLYTPEEVQRMEEELNEREKNFKVAFETFQEMESALQNYLDRQPEIEVELSKQKMDIET 850
             S +T EEVQ++++EL+ERE NF++A +T  EME ALQ   DR+PEIE+++SK+K+DI++
Sbjct: 813  NSAFTAEEVQQIDKELSEREHNFQIAADTLHEMEEALQKLKDREPEIELDISKRKLDIDS 872

Query: 851  ISAELESKIERKLELERSNKTSIEDSS-ELRTAEEKLAALNADLNSFMSASESKNQRIKE 909
            +S+E+++  E +LE     K   E S+ EL TAE KL +L ++     +  +SK + +K 
Sbjct: 873  LSSEMKAS-EGRLEYLLQEKAQKESSNEELSTAEVKLKSLKSEYRELENEMQSKKKEMKV 931

Query: 910  LRAKIMEIGGLELQTLNSKVDSLNXXXXXXXXXXXXXXXXXXXXELELKRARKQQITAKD 969
            L+ +IM++GG +LQ  +S VDS+N                    + ++KR +KQ     +
Sbjct: 932  LQEQIMKVGGTKLQMQSSMVDSVNQRITIVLAKSKKTKTDLKKAQNDIKRYQKQAEQLAE 991

Query: 970  DIEHCDIEIQKMKSSYDTISTGMQELQKQLSDLQEEIGTLTDEHAVTKHE-LDQKNEKID 1028
            +++ C  E   ++++ D+ S  + EL + ++ L++E+  LT+E      E +D+K  +  
Sbjct: 992  ELKSCSQEKSLIENNLDSSSKKVDELSESINKLKDEL-ELTEERVRKAEESIDEKTVEGR 1050

Query: 1029 SYSSIEIELTEQLQKLQNLANYLKKEMNEYDSKLSHLKLRDLGQVMLDLEENKSLQSFSH 1088
             + ++EI+   QL KL+ L   L KE  E+   L+ LK+RD+   +  L+E  SL++ S 
Sbjct: 1051 DFEALEIQCVAQLDKLKELFAILNKEAAEFLHSLNSLKIRDVTATLQALDE--SLENESK 1108

Query: 1089 ----SPTPDTKRENIQSSML------ETHLASPSPNERKISIAENNLSMEVDEQASVLEN 1138
                + TP  +     SS+       E    S S  E ++   E     E       L N
Sbjct: 1109 NEVAAETPGEEDGEHSSSLHDPMDVDENQGESTSTTEAQLQAGE----AERRNTEESLPN 1164

Query: 1139 GLPKLPDSELARVDLEDLERDIVQLQDYIDNSTVDIEILDEYAKRLAEYRRRRIDLNEAI 1198
            GLPKL + EL   ++E +E +I QLQDY++N+  DIEIL+EYA+RL EY+ R++DLN A+
Sbjct: 1165 GLPKLLEDELENFEVETVELEIHQLQDYVENAYADIEILEEYARRLIEYKARKVDLNHAV 1224

Query: 1199 MKRDETRMHCEVLKKRRLDEFMEGFGIISITLKEMYQMITMGGNAELELVDSLDPFSEGV 1258
             +RD+ R   E LKK+RLDEFMEGF  I + LKEMYQMITMGGNAELELVDSLDPFSEGV
Sbjct: 1225 QERDKVRQSNENLKKKRLDEFMEGFNAICMILKEMYQMITMGGNAELELVDSLDPFSEGV 1284

Query: 1259 LFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVA 1318
            LFSVMPPKKSWRNI+NLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVA
Sbjct: 1285 LFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVA 1344

Query: 1319 NYIKERTKNAQFIVISLRNNMFELAQRLVGIYKNSNMTRSTTLQNRDIIN 1368
            NYIKERTKNAQFIVISLRNNMFELA++LVG+YKN NMT+S  LQN D+I+
Sbjct: 1345 NYIKERTKNAQFIVISLRNNMFELAKQLVGVYKNKNMTKSVALQNTDLID 1394

>NCAS0B05000 Chr2 (917841..922070) [4230 bp, 1409 aa] {ON} Anc_8.259
            YLR086W
          Length = 1409

 Score = 1362 bits (3524), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 717/1304 (54%), Positives = 936/1304 (71%), Gaps = 30/1304 (2%)

Query: 77   VELIQLSPIKNSRLELQRLYDT--KQKKVERLCIRTLVLENFKSYAGRQVVGPFHSSFSA 134
            +ELIQLSP+KN+R++L+ LYD    Q K ERL I  L L NFKSYAG+QVVGPFH+SFSA
Sbjct: 118  LELIQLSPVKNNRIKLRELYDAHNSQSKKERLFINKLTLNNFKSYAGQQVVGPFHTSFSA 177

Query: 135  VVGPNGSGKSNVIDSMLFAFGFRANKMRQGKLSHLIHKSEKYPDLDFCSVEIQFQYVVDE 194
            VVGPNGSGKSNVIDSMLF FGFRANKMRQ +LS LIHKSEK+PDL  CSV+++F Y +DE
Sbjct: 178  VVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEKFPDLTSCSVDVEFLYAIDE 237

Query: 195  PDGTTRVLSGKPELSVMRKAFKNNTSKYYLNGKESTYTEVTRLLRDEGIDLDHKRFLILQ 254
             DG T++   KP+L + RKAFKNN+SKYY+NGKES YT+VT+LL++EGIDLDHKRFLILQ
Sbjct: 238  HDGDTKISETKPKLVISRKAFKNNSSKYYINGKESNYTDVTKLLKEEGIDLDHKRFLILQ 297

Query: 255  GEVESIAQMKPKAEHEGDDGLLEYLEDIIGTTKYKAQIEQALVEVDSLNDICMEKENRFD 314
            GEVE+IAQMKPKAE E DDGLLEYLEDIIGT+KYK  IE+ L+E++SLN+IC+EKENRF+
Sbjct: 298  GEVENIAQMKPKAEKESDDGLLEYLEDIIGTSKYKQLIEKDLIEIESLNEICIEKENRFE 357

Query: 315  LVEKEKLSLEPGKDEALAFLKKEKDLTLLMSKKYQYHLFHNGSKLAKTLSNVSNTMNXXX 374
            +V++EK SLE GK+ AL FL+KEK LTL  SK  QY+L+ N SKL  TL  +S  +N   
Sbjct: 358  IVDREKNSLESGKNLALEFLEKEKQLTLSKSKLLQYNLWQNNSKLTNTLQKIS-ALNEEY 416

Query: 375  XXXXXXXXXXXXXXXLTDASEQLAN----RLVSMNNTNKESLAKMRQLERELVSNEEKQK 430
                             + ++QL N    ++  +    K+ L   R LE E VS +EK K
Sbjct: 417  NVEKSKNQTLQNE---INRTKQLLNESQSKIKVLEGEEKQQLKSKRILEGEHVSLDEKLK 473

Query: 431  SLLQKRSKAEKTLNTVEKSIKQCENKIEEYISQNQEYETSLTTLNHTIVDAQAELEKMKL 490
            +L QK++K EK + T EK+I    ++I+E     +EY   L TLN  +   +  LE MKL
Sbjct: 474  NLTQKKAKTEKIIATTEKTISSLTSEIQELEKSQKEYSDELETLNQQLQSERESLEAMKL 533

Query: 491  ALSDKTGDITKEVAVLEKELEPWTNKVEEKKSEIKLVESEISIIKEADLKLESEIANLSQ 550
             L +KT  I++E+ + E +LEPW  KV+EKK+EI+LVES+IS+++E  +KL+++I  LSQ
Sbjct: 534  KLKEKTSGISEEILIHEHDLEPWNIKVQEKKTEIQLVESQISLLQEGQVKLKNDIKVLSQ 593

Query: 551  EIEQLRGNISHREESIETLNVESSSIRDYILVGERECTSARSKLEEMKKVLVTHRQRVND 610
            E+         REE +  L  + SSI   I  GE EC   RSKL+EMK VL   RQR ++
Sbjct: 594  EVSNQTALKIKREEDLVNLKKQQSSITKEISNGETECNDGRSKLKEMKNVLNMQRQRASE 653

Query: 611  ARSAVSSAENKNKVLTALSRLQKSGRIDGYHGRLGDLGTIDDKYDIAISTACPRLDDIVV 670
            AR A+++ +N+ KVLTAL +LQKSGRI G+HGRLGDLGTID+ YD+A+STACPRLDDIVV
Sbjct: 654  ARLALANVQNRGKVLTALYKLQKSGRIVGFHGRLGDLGTIDNTYDVAVSTACPRLDDIVV 713

Query: 671  DTVECGQQCIEHLRKNKLGYARFILLDKLRKFNLQPAHTPENVPRLFDLVKPKEPKFAPA 730
            +TVECGQQCIE+LRKNKLGYARFILLDKLR FN     TP+NVPRLFDL+KPK+ KF PA
Sbjct: 714  ETVECGQQCIEYLRKNKLGYARFILLDKLRSFNTNTIQTPKNVPRLFDLIKPKDSKFVPA 773

Query: 731  FYSVLRDTLVTTDLSQANRVAYGKKRYRVVTLDGKLIDISGTMTGGGDRAASGLM----K 786
            FYSVLRDTLV  DL QANRVAYG++RYRVVTLDGKLID+SGTM+GGG+  + GLM    K
Sbjct: 774  FYSVLRDTLVAKDLKQANRVAYGQRRYRVVTLDGKLIDVSGTMSGGGNHVSKGLMMLQRK 833

Query: 787  STQQSSLYTPEEVQRMEEELNEREKNFKVAFETFQEMESALQNYLDRQPEIEVELSKQKM 846
                   Y PE+V+++E++L+++EKNF++A   F EME+ LQ   +R+PEIE+E+SK  M
Sbjct: 834  GQNYFDDYNPEDVEQIEKDLSDKEKNFELANNAFYEMENELQKLNNRKPEIELEISKIIM 893

Query: 847  DIETISAELESKIERKLELERSN--KTSIEDSSELRTAEEKLAALNADLNSFMSASESKN 904
            +I+T SAE++SK ER+L+ E++N   + ++D+ EL+ A E L  L  +  +    +++K 
Sbjct: 894  EIDTYSAEIKSK-ERQLQ-EKTNIDNSELQDNEELKVAIENLQKLKEEHLALQDKTKAKK 951

Query: 905  QRIKELRAKIMEIGGLELQTLNSKVDSLNXXXXXXXXXXXXXXXXXXXXELELKRARKQQ 964
            ++I  L+ KIM+IGG+ELQ  NSKV S+                     + EL++A+K  
Sbjct: 952  KKIASLKEKIMKIGGIELQVQNSKVTSIVQRIDILTAKQKKDRTSKKKSDTELEKAKKTL 1011

Query: 965  ITAKDDIEHCDIEIQKMKSSYDTISTGMQELQKQLSDLQEEIGTLTDEHAVTKHELDQKN 1024
            +T+K+DI     +I+++    D IS+ +  + K + + Q    TL DE    K ++    
Sbjct: 1012 LTSKNDITLITDDIKEISERIDKISSSLNNIDKSIEEFQAHKETLKDECDELKDKVVDLE 1071

Query: 1025 EKIDSYSSIEIELTEQLQKLQNLANYLKKEMNEYDSKLSHLKLRDLGQVMLDLEENKSLQ 1084
            E I+ + S EIE+  +L+KL  L N++K ++   +  LS L LR + QV++ L+E    +
Sbjct: 1072 ENINEFKSFEIEVNNKLEKLNGLLNHIKNQIKTLEDSLSKLTLRKMHQVLMALDE----E 1127

Query: 1085 SFSHSPTPDTKRENIQSSMLETHLASPSPNERKISIAENNLSMEVDEQASVLENGLPKLP 1144
            S + +P   T        + +  +   + +E   +  +++ SM++D  A V+ NGLP L 
Sbjct: 1128 SEAKAPNNGT--------LSDEQIHDQTGHELTNTAVQDDDSMDIDNGAEVISNGLPILS 1179

Query: 1145 DSELARVDLEDLERDIVQLQDYIDNSTVDIEILDEYAKRLAEYRRRRIDLNEAIMKRDET 1204
            D EL+ +D+  +E ++  L+ YI+++  +IE+L+EY KRL E++ R++DLN+A+ KR+  
Sbjct: 1180 DDELSALDITLVETEVSDLEKYIESTDANIEVLEEYVKRLTEFKTRKLDLNDAVDKRETV 1239

Query: 1205 RMHCEVLKKRRLDEFMEGFGIISITLKEMYQMITMGGNAELELVDSLDPFSEGVLFSVMP 1264
            R   E LKK R +EFM GFGIIS+TLKEMYQMITMGGNAELELVDSLDPFSEGV FSVMP
Sbjct: 1240 RKQLEELKKTRYEEFMHGFGIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMP 1299

Query: 1265 PKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKER 1324
            PKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKER
Sbjct: 1300 PKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKER 1359

Query: 1325 TKNAQFIVISLRNNMFELAQRLVGIYKNSNMTRSTTLQNRDIIN 1368
            TKNAQFIVISLRNNMFELAQ+LVGIYK  N T S T++NR+I+N
Sbjct: 1360 TKNAQFIVISLRNNMFELAQQLVGIYKCENRTHSATIKNREILN 1403

>TDEL0F03860 Chr6 (709579..713778) [4200 bp, 1399 aa] {ON} Anc_8.259
            YLR086W
          Length = 1399

 Score = 1360 bits (3520), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 724/1368 (52%), Positives = 947/1368 (69%), Gaps = 19/1368 (1%)

Query: 11   ILDTPVKLLATSPDRKNVVSRGSSVSTTMGLRGPSLQPPVAHQIXXXXXXXXXXXXXXXX 70
            I  TP KL+  + D  +  S+   + ++  L+ PSLQ P +                   
Sbjct: 39   ISHTPKKLVIGTND--DTTSQSQPIVSSSSLQAPSLQHPNSSSRGREQRTYSQSPPRSPG 96

Query: 71   XXXXXAVELIQLSPIKNSRLELQRLYDTKQ--KKVERLCIRTLVLENFKSYAGRQVVGPF 128
                  +ELI++SP+K +RLELQRLYD +Q  +   RLCI  LVL++FKSYAGRQVVGPF
Sbjct: 97   RSPTRKLELIKISPVKKNRLELQRLYDAEQSQRNAARLCINKLVLQDFKSYAGRQVVGPF 156

Query: 129  HSSFSAVVGPNGSGKSNVIDSMLFAFGFRANKMRQGKLSHLIHKSEKYPDLDFCSVEIQF 188
            HSSFSAVVGPNGSGKSNVIDSMLF FGFRANKMRQ +LS LIH SE +P+L  CSVE+ F
Sbjct: 157  HSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHNSEVHPNLKSCSVEVHF 216

Query: 189  QYVVDEPDGTTRVLSGKPELSVMRKAFKNNTSKYYLNGKESTYTEVTRLLRDEGIDLDHK 248
            QYVVDEPDGTTR+   KP L V RKAFKNN+SKYY+N KES YTEVT+LL+ EGIDLDHK
Sbjct: 217  QYVVDEPDGTTRIDEEKPTLVVTRKAFKNNSSKYYVNDKESNYTEVTQLLKKEGIDLDHK 276

Query: 249  RFLILQGEVESIAQMKPKAEHEGDDGLLEYLEDIIGTTKYKAQIEQALVEVDSLNDICME 308
            RFLILQGEVE+IAQM+PKAE EG+DGLLEYLEDI GT KYK QIE  L E++ LN+ C+E
Sbjct: 277  RFLILQGEVENIAQMRPKAEKEGEDGLLEYLEDITGTAKYKPQIETILQEIEVLNESCIE 336

Query: 309  KENRFDLVEKEKLSLEPGKDEALAFLKKEKDLTLLMSKKYQYHLFHNGSKLAKTLSNVSN 368
            KENRF +V++EK SLE GKDEAL FL+KEK LTLL SK  QY ++ N  KL  TL   S 
Sbjct: 337  KENRFHIVDQEKSSLETGKDEALEFLEKEKTLTLLRSKMIQYKIWQNDIKLTSTLDKSSK 396

Query: 369  TMNXXXXXXXXXXXXXXXXXXLTDASEQLANRLVSMNNTNKESLAKMRQLERELVSNEEK 428
                                 L D S+Q+A R+ ++    K  LA+ R L+++ V+ EEK
Sbjct: 397  LKGQLDQENEKYSETLKEVDSLKDESKQVAKRIETLAIEEKALLAQKRGLDQQRVAIEEK 456

Query: 429  QKSLLQKRSKAEKTLNTVEKSIKQCENKIEEYISQNQEYETSLTTLNHTIVDAQAELEKM 488
             KS+ QK +KAEK L + + S+   E  + E      +YE  L  LN  ++  +A+LE +
Sbjct: 457  IKSVNQKTNKAEKLLKSNQHSLNATEANLRELRQSQLDYEKELQDLNQELITERAKLEDV 516

Query: 489  KLALSDKTGDITKEVAVLEKELEPWTNKVEEKKSEIKLVESEISIIKEADLKLESEIANL 548
            K++L +KT +I+  +A  EK+LEPW  ++++K++EI+L ESE+S++K+ + ++  +I  L
Sbjct: 517  KISLKEKTVNISAGIAQYEKDLEPWDGQLQQKRAEIQLAESELSLLKDTNARINKDIEQL 576

Query: 549  SQEIEQLRGNISHREESIETLNVESSSIRDYILVGERECTSARSKLEEMKKVLVTHRQRV 608
              EI +       +E+ I  L  E S +   +     EC+SA ++L++M ++L+  RQR 
Sbjct: 577  KNEIARGGEEKLAKEKVIRELKQEESDVTAEVHTAGAECSSASARLKKMHEILIAQRQRT 636

Query: 609  NDARSAVSSAENKNKVLTALSRLQKSGRIDGYHGRLGDLGTIDDKYDIAISTACPRLDDI 668
             DAR+A SSA+NK+ VLTAL++LQKSGRI G+HGRLGDLG ID+KYD+AISTACPRL+DI
Sbjct: 637  LDARAAFSSAQNKSTVLTALTKLQKSGRISGFHGRLGDLGVIDEKYDVAISTACPRLEDI 696

Query: 669  VVDTVECGQQCIEHLRKNKLGYARFILLDKLRKFNLQPAHTPENVPRLFDLVKPKEPKFA 728
            VV++VECGQQCIE+LRKNKLGYARFILLDKLRKF+     TPENVPRLFDLVKPK+ KF 
Sbjct: 697  VVESVECGQQCIEYLRKNKLGYARFILLDKLRKFHTGKIQTPENVPRLFDLVKPKDDKFI 756

Query: 729  PAFYSVLRDTLVTTDLSQANRVAYGKKRYRVVTLDGKLIDISGTMTGGGDRAASGLMKST 788
            PAFYSVLRDTL    L+QANRVAYGKKR+RVV+LDGKLIDISGTM+GGG     GLM+ +
Sbjct: 757  PAFYSVLRDTLAAQSLAQANRVAYGKKRFRVVSLDGKLIDISGTMSGGGSHVVRGLMRLS 816

Query: 789  QQSS----LYTPEEVQRMEEELNEREKNFKVAFETFQEMESALQNYLDRQPEIEVELSKQ 844
            Q +S    +++PEEV ++E EL E+EK+F++A +TF+EME  L+   DR PEI++++SK 
Sbjct: 817  QNNSYSPDIFSPEEVAQLENELTEKEKSFQIASDTFREMEDQLKKLKDRVPEIQLKVSKL 876

Query: 845  KMDIETISAELESKIERKLELERSNKTSIEDSSELRTAEEKLAALNADLNSFMSASESKN 904
             M+ E+  +EL+ K +  LE   + K +   + E + AE ++  L  +  +    + +  
Sbjct: 877  VMETESWMSELKLKEKLLLERLEAQKKATGKNEEYQLAEARVKTLKDEQRALSDQTTTTR 936

Query: 905  QRIKELRAKIMEIGGLELQTLNSKVDSLNXXXXXXXXXXXXXXXXXXXXELELKRARKQQ 964
            Q+I  L+ KIMEIGG ELQ  NSKV S                      E ELK++ K  
Sbjct: 937  QKIAVLKDKIMEIGGSELQIQNSKVTSTIQRMEILTSKQKKGKASIKKAENELKKSAKIV 996

Query: 965  ITAKDDIEHCDIEIQKMKSSYDTISTGMQELQKQLSDLQEEIGTLTDEHAVTKHELDQKN 1024
               + D++    EI  +K + D +   ++ ++K + + Q+    + ++    K  L Q  
Sbjct: 997  GNTQKDLDLYSQEIASLKENADNVQQTLESVEKSVDEQQDLSHEMNEKLDQLKQRLAQME 1056

Query: 1025 EKIDSYSSIEIELTEQLQKLQNLANYLKKEMNEYDSKLSHLKLRDLGQVMLDLEENKSLQ 1084
                 + S++IE+ ++L+KL  L  ++ KE+ + +S L++LK+RD+ + +  L+E    +
Sbjct: 1057 AGFTEFKSLKIEINDKLEKLNALLGHITKEVRQLESDLNNLKIRDVTRTLQLLDEG---E 1113

Query: 1085 SFSHSPTPDTKRENIQSSMLETHLASPSPNERK-ISIAE---NNLSMEVDEQASVLENGL 1140
            S ++S  P+     +Q    E   A+    E   +S+ E   N+  MEVDE+   LENGL
Sbjct: 1114 STNNSKMPN----ELQEKRTEGADATRQEGEESDVSMEEEKSNDEVMEVDEKPHELENGL 1169

Query: 1141 PKLPDSELARVDLEDLERDIVQLQDYIDNSTVDIEILDEYAKRLAEYRRRRIDLNEAIMK 1200
            P++ ++EL  +D+EDL   I  LQ+Y+D+  VD+EIL+EYAKRLAE++RR++DLNEA+ +
Sbjct: 1170 PRVSEAELKSLDVEDLGAQIEDLQNYVDSVNVDVEILEEYAKRLAEHKRRKVDLNEAVGE 1229

Query: 1201 RDETRMHCEVLKKRRLDEFMEGFGIISITLKEMYQMITMGGNAELELVDSLDPFSEGVLF 1260
            RD  R     LKKRR DEFM+GFGIIS+TLKEMYQMITMGGNAELELVDSLDPFSEGV F
Sbjct: 1230 RDAMREKLGELKKRRFDEFMQGFGIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTF 1289

Query: 1261 SVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANY 1320
            SVMPPKKSWRNI+NLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANY
Sbjct: 1290 SVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANY 1349

Query: 1321 IKERTKNAQFIVISLRNNMFELAQRLVGIYKNSNMTRSTTLQNRDIIN 1368
            IKERTKNAQFIVISLRNNMFELAQ+LVGIYK  NMT+S +L+N DI+N
Sbjct: 1350 IKERTKNAQFIVISLRNNMFELAQQLVGIYKTQNMTKSASLKNNDILN 1397

>KAFR0B02710 Chr2 (545337..549587) [4251 bp, 1416 aa] {ON} Anc_8.259
            YLR086W
          Length = 1416

 Score = 1342 bits (3474), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 715/1375 (52%), Positives = 946/1375 (68%), Gaps = 22/1375 (1%)

Query: 14   TPVKLLATSPDRKNVVSR---GSSVSTTMGLRGPSLQPPVAHQIXXXXXXXXXXXXXXXX 70
            TP KLL  S D K V+S+    SS   +  L+ P+LQPP++                   
Sbjct: 45   TPRKLLLGSADNKYVLSQPIISSSSHGSSSLQVPNLQPPLSQPSRGRDKKAYSQSPPRSP 104

Query: 71   XXX-XXAVELIQLSPIKNSRLELQRLYDTKQKKVERLCIRTLVLENFKSYAGRQVVGPFH 129
                   +ELIQLSPIKN+R+ELQ+LY++K +   RL I  LVL++FKSYAG Q+VGPF+
Sbjct: 105  GRSPVRKLELIQLSPIKNNRIELQKLYNSKNQNKVRLYIDKLVLQDFKSYAGTQIVGPFN 164

Query: 130  SSFSAVVGPNGSGKSNVIDSMLFAFGFRANKMRQGKLSHLIHKSEKYPDLDFCSVEIQFQ 189
            +SFSA+VGPNGSGKSNVIDSMLF FGFRANKMRQ +L  LIHKSE +P++  CSVE+ FQ
Sbjct: 165  TSFSAIVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLGDLIHKSEAFPNIQSCSVEVHFQ 224

Query: 190  YVVDEPDGTTRVLSGKPELSVMRKAFKNNTSKYYLNGKESTYTEVTRLLRDEGIDLDHKR 249
            YV+DE DGT++++  +  L VMRKAFKNN+SKYY+NGKES YTEVTRLL++EGIDLDHKR
Sbjct: 225  YVIDENDGTSKIIEDRKPLVVMRKAFKNNSSKYYINGKESNYTEVTRLLKEEGIDLDHKR 284

Query: 250  FLILQGEVESIAQMKPKAEHEGDDGLLEYLEDIIGTTKYKAQIEQALVEVDSLNDICMEK 309
            FLILQGEVE+IAQMK KAE EGDDGLLEYLEDIIGT+KYK  IE  +VE+++LN+IC+EK
Sbjct: 285  FLILQGEVENIAQMKAKAEKEGDDGLLEYLEDIIGTSKYKTLIEDKMVEIEALNEICVEK 344

Query: 310  ENRFDLVEKEKLSLEPGKDEALAFLKKEKDLTLLMSKKYQYHLFHNGSKLAKTLSNVSNT 369
            E RF++VE EK SLE  KD AL F+ KEK LTLL SK  QY L+   +KLA TL  +SN 
Sbjct: 345  EKRFEIVETEKNSLESDKDAALEFIAKEKQLTLLRSKLTQYKLYQTNTKLATTLDKISNF 404

Query: 370  MNXXXXXXXXXXXXXXXXXXLTDASEQLANRLVSMNNTNKESLAKMRQLERELVSNEEKQ 429
             N                   T    +   ++ +     +E + K R+ + + VS EE+ 
Sbjct: 405  KNALQEERSKYEKIQSEIDQSTRELREANEKINASVAQERELVQKKREYDGQCVSMEERI 464

Query: 430  KSLLQKRSKAEKTLNTVEKSIKQCENKIEEYISQNQEYETSLTTLNHTIVDAQAELEKMK 489
            K+L QK++KAEKTL+     I++ E+ +++       Y++  + L   +   +++L+ +K
Sbjct: 465  KNLTQKKTKAEKTLHDKRIEIQKNESILKDLQDYQMNYDSEFSNLQKELDKERSKLDDIK 524

Query: 490  LALSDKTGDITKEVAVLEKELEPWTNKVEEKKSEIKLVESEISIIKEADLKLESEIANLS 549
            L+L DKT DI+ ++++ EK++EPW +K++EK+ +I+L ESEIS++KE+  KL+  + +L 
Sbjct: 525  LSLKDKTKDISSQISLYEKDIEPWVSKIQEKQVQIQLAESEISLLKESQAKLKEGLGSLK 584

Query: 550  QEIEQLRGNISHREESIETLNVESSSIRDYILVGERECTSARSKLEEMKKVLVTHRQRVN 609
             EI+ +R  I ++   IE L  E  S++  + +GE EC+ A+ K +EM+ +L +HRQR  
Sbjct: 585  VEIDDVRKEIDNKNSIIENLKKEQVSLKKEVSLGESECSRAKEKEKEMRVILNSHRQRAI 644

Query: 610  DARSAVSSAENKNKVLTALSRLQKSGRIDGYHGRLGDLGTIDDKYDIAISTACPRLDDIV 669
            DARSA+  AENK+ VL+AL+RLQKSGRI+G+HGRLGDLG I DKYDIAISTAC RLDDIV
Sbjct: 645  DARSALHMAENKSTVLSALTRLQKSGRINGFHGRLGDLGVIADKYDIAISTACSRLDDIV 704

Query: 670  VDTVECGQQCIEHLRKNKLGYARFILLDKLRKFNLQPAHTPENVPRLFDLVKPKEPKFAP 729
            VD+VECGQQCIE+LRKNKLGYARFILLDKLR F L    TPENV RLFDLV+P + KF+ 
Sbjct: 705  VDSVECGQQCIEYLRKNKLGYARFILLDKLRNFQLGQLQTPENVLRLFDLVQPIDLKFSN 764

Query: 730  AFYSVLRDTLVTTDLSQANRVAYGKKRYRVVTLDGKLIDISGTMTGGGDRAASGLMK--- 786
            AFYSVLRDTLV TD+ QANRVAYGK+RYRVVTLDGKLIDISGTMTGGG   + GLMK   
Sbjct: 765  AFYSVLRDTLVATDIRQANRVAYGKRRYRVVTLDGKLIDISGTMTGGGSHVSKGLMKLKN 824

Query: 787  -STQQSSLYTPEEVQRMEEELNEREKNFKVAFETFQEMESALQNYLDRQPEIEVELSKQK 845
             + +   +Y   +V+++E +L ERE NFK+A +T QEM + L+   D++PEIE+E++K  
Sbjct: 825  SNMEHLEVYEAGDVEKIERDLAERENNFKIAHDTLQEMNNELKRLQDKEPEIELEIAKLL 884

Query: 846  MDIETISAELESKIERKLELERSNKTSIEDSSELRTAEEKLAALNADLNSFMSASESKNQ 905
            MD+++++ +L  K ++  ELE++    I     L  AE  L  L  +  +    S+SK +
Sbjct: 885  MDVDSLNDQLNLKEQQLKELEKNYTDVINKKDPLDRAEAFLQTLRNEHRALEDQSQSKKE 944

Query: 906  RIKELRAKIMEIGGLELQTLNSKVDSLNXXXXXXXXXXXXXXXXXXXXELELKRARKQQI 965
            +I  L+ +IM+IGG ELQ  NSKV SL                     E EL++ ++   
Sbjct: 945  KINTLKEEIMKIGGKELQIQNSKVSSLTERIGIVNAKHKKDKATIKRTEKELQKVQRLFK 1004

Query: 966  TAKDDIEHCDIEIQKMKSSYDTISTGMQELQKQLSDLQEEIGTLTDEHAVTKHELDQKNE 1025
             A+ D   C  +++ ++++   I T +QE + +   +  E   LT +    K ++    E
Sbjct: 1005 QAELDNTACVNDLETLQTNVIAIRTRLQETEAEFDIILNEKDDLTGQCESLKEKIKDMEE 1064

Query: 1026 KIDSYSSIEIELTEQLQKLQNLANYLKKEMNEYDSKLSHLKLRDLGQVMLDLEENKSLQS 1085
             ++ Y S EIE+  +L+KL +L +Y KK++   + +L    +RD+ Q +  ++   +  S
Sbjct: 1065 SMNEYKSFEIEIKNKLEKLNSLLDYCKKDIRSLNQELQSYHVRDVTQSLEKIQNENANNS 1124

Query: 1086 -----------FSHSPTPDTKRENIQSSMLETHLASPSPNERKISIAENNLSMEVDEQAS 1134
                        S S TP+  + + + SM +    S +  E K   A+    M++D    
Sbjct: 1125 VGVKQSSNNLDVSSSHTPNVDKHDDEISMEDADNDSQNEIEEKEQDAD---IMDLDNVTE 1181

Query: 1135 VLENGLPKLPDSELARVDLEDLERDIVQLQDYIDNSTVDIEILDEYAKRLAEYRRRRIDL 1194
             +  G+PKL D +L  +DL+ LE +I QLQDY++NS  DIE+L+EY +RL E+++R++DL
Sbjct: 1182 EVSKGIPKLTDDDLKSIDLDSLESEINQLQDYVENSNADIELLEEYIRRLEEFKKRKLDL 1241

Query: 1195 NEAIMKRDETRMHCEVLKKRRLDEFMEGFGIISITLKEMYQMITMGGNAELELVDSLDPF 1254
            N  + +RDE R   E LKK R DEFMEGF IIS+TLKEMYQMITMGGNAELELVDSLDPF
Sbjct: 1242 NTTVARRDEVRDELEKLKKTRHDEFMEGFSIISLTLKEMYQMITMGGNAELELVDSLDPF 1301

Query: 1255 SEGVLFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNV 1314
            SEGV FSVMPPKKSWRNI+NLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNV
Sbjct: 1302 SEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNV 1361

Query: 1315 SIVANYIKERTKNAQFIVISLRNNMFELAQRLVGIYKNSNMTRSTTLQNRDIINV 1369
            SIVANYIKERTKNAQFIVISLRNNMFELAQ+LVGIYK SNMT+S TL+N+DI+N 
Sbjct: 1362 SIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKRSNMTQSATLKNKDILNC 1416

>Smik_12.145 Chr12 (282081..286337) [4257 bp, 1418 aa] {ON} YLR086W
            (REAL)
          Length = 1418

 Score = 1342 bits (3474), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 713/1384 (51%), Positives = 969/1384 (70%), Gaps = 30/1384 (2%)

Query: 4    PTPKKPRI------LDTPVKLLATSPDRKNVVSRGSSVSTTMGLRGPSLQPPVAHQIXXX 57
            P P  P +        TP KL+ +S + +   S+ ++ +TT  L  P+LQPP        
Sbjct: 44   PDPNSPALETSYAKSHTPRKLVLSSGENRYAFSQPTNSATT-SLHVPNLQPPGTSSRGRD 102

Query: 58   XXXXXXXXXXXXXXXXXXAVELIQLSPIKNSRLELQRLYDTKQ---KKVERLCIRTLVLE 114
                               +EL+QLSP+KNSR+ELQ+LY++ Q   K+  RL I  LVLE
Sbjct: 103  YKAYSQSPPRSPGRSPTRRLELLQLSPVKNSRVELQKLYNSHQSSTKQQGRLFINELVLE 162

Query: 115  NFKSYAGRQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFAFGFRANKMRQGKLSHLIHKSE 174
            NFKSYAGRQVVGPFH+SFSAVVGPNGSGKSNVIDSMLF FGFRANKMRQ +LS LIHKSE
Sbjct: 163  NFKSYAGRQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSE 222

Query: 175  KYPDLDFCSVEIQFQYVVDEPDGTTRVLSGKPELSVMRKAFKNNTSKYYLNGKESTYTEV 234
             +P+L  CSV + F+YV+DE  GT+R+   KP L + RKAFKNN+SKYY+NGKES+YTEV
Sbjct: 223  AFPNLQSCSVAVHFEYVIDESSGTSRIDEEKPGLVITRKAFKNNSSKYYINGKESSYTEV 282

Query: 235  TRLLRDEGIDLDHKRFLILQGEVESIAQMKPKAEHEGDDGLLEYLEDIIGTTKYKAQIEQ 294
            T+LL++EGIDLDHKRFLILQGEVE+IAQMKPKAE E DDGLLEYLEDIIGT  YK  IE+
Sbjct: 283  TKLLKNEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTANYKPLIEE 342

Query: 295  ALVEVDSLNDICMEKENRFDLVEKEKLSLEPGKDEALAFLKKEKDLTLLMSKKYQYHLFH 354
             + ++++LN++C+EKENRF++V++EK SLE GK+ AL FL KEK LTLL SK +Q+ +  
Sbjct: 343  QMNQIEALNEVCLEKENRFEIVDREKNSLESGKETALEFLAKEKQLTLLKSKLFQFKVLQ 402

Query: 355  NGSKLAKTLSNVSNTMNXXXXXXXXXXXXXXXXXXLTDASEQLANRLVSMNNTNKESLAK 414
            + SKLA TL  +S+                     +    +++ +R+ S ++  K+ + +
Sbjct: 403  SNSKLASTLEKISSLNKDFETEKVKFQESLKKVEEVKTQRKEIKDRISSNDSREKDLVLE 462

Query: 415  MRQLERELVSNEEKQKSLLQKRSKAEKTLNTVEKSIKQCENKIEEYISQNQEYETSLTTL 474
             R+LE   VS EE+ K+L  K  K+E+T    ++SI + E+ ++E  +Q  E+E+ +  L
Sbjct: 463  RRELEGTRVSLEERTKNLANKIEKSERTSKCTKRSISEAEHTLKELHTQQTEHESEIKDL 522

Query: 475  NHTIVDAQAELEKMKLALSDKTGDITKEVAVLEKELEPWTNKVEEKKSEIKLVESEISII 534
            N  + + ++ L+++KL+L DKT DI+ E+   EKELEPW  +++EK+S+I+L ESE+S++
Sbjct: 523  NQLLEEERSVLDEIKLSLKDKTKDISTEIIQHEKELEPWDLQLQEKESQIQLAESELSLL 582

Query: 535  KEADLKLESEIANLSQEIEQLRGNISHREESIETLNVESSSIRDYILVGERECTSARSKL 594
            +E   KL+  +  + ++I   + +    ++ I  L  + SS+RD    GE   +SA  KL
Sbjct: 583  EETQSKLKKNVETMEEKILARKAHKQELQDLILNLKKKLSSLRDERSQGEENFSSAHLKL 642

Query: 595  EEMKKVLVTHRQRVNDARSAVSSAENKNKVLTALSRLQKSGRIDGYHGRLGDLGTIDDKY 654
            EEM+KVL THRQR  +ARS++S A+NK+KVLTALS+LQKSGRI+G+HGRLGDLG ID+ +
Sbjct: 643  EEMQKVLNTHRQRAMEARSSLSEAQNKSKVLTALSKLQKSGRINGFHGRLGDLGIIDNSF 702

Query: 655  DIAISTACPRLDDIVVDTVECGQQCIEHLRKNKLGYARFILLDKLRKFNLQPAHTPENVP 714
            D+AISTACPRLDD+VVDTVEC QQCI++LRKNKLGYARFILLD+LR+FNLQP  TPENVP
Sbjct: 703  DVAISTACPRLDDVVVDTVECAQQCIDYLRKNKLGYARFILLDRLRQFNLQPISTPENVP 762

Query: 715  RLFDLVKPKEPKFAPAFYSVLRDTLVTTDLSQANRVAYGKKRYRVVTLDGKLIDISGTMT 774
            RLFDLVKPK+PKF+ AFYSVLRDTLV   L QAN VAYG+KR+RVVT+DGKLIDISGT++
Sbjct: 763  RLFDLVKPKDPKFSNAFYSVLRDTLVARSLKQANNVAYGRKRFRVVTIDGKLIDISGTIS 822

Query: 775  GGGDRAASGLMK-STQQSSL---YTPEEVQRMEEELNEREKNFKVAFETFQEMESALQNY 830
            GGG+  + GLM+  T QS+    YTPEEV ++E EL+ERE NF+VA +T  EME+ L+N 
Sbjct: 823  GGGNHVSKGLMRLGTNQSNKIDDYTPEEVNKIEHELSERENNFRVANDTVHEMEAELKNL 882

Query: 831  LDRQPEIEVELSKQKMDIETISAELESKIERKLELERSNKTSIEDSSELRTAEEKLAALN 890
             D++P IE ++SK +M+ ++I++EL    ++  E   +   ++ D +++    + L  L 
Sbjct: 883  RDQEPAIESKISKTEMEADSITSELTLAEQQVKEARIAYHNALSDKAQVNMIMKNLERLK 942

Query: 891  ADLNSFMSASESKNQRIKELRAKIMEIGGLELQTLNSKVDSLNXXXXXXXXXXXXXXXXX 950
             + +   S +++K ++IK L+ +IM+IGG +LQ  NSKV SL                  
Sbjct: 943  GEHDDLQSETKTKKEKIKVLQGEIMKIGGTKLQMQNSKVGSLCQRLDILVAKLKKVKSGI 1002

Query: 951  XXXELELKRARKQQITAKDDIEHCDIEIQKMKSSYDTISTGMQELQKQLSDLQEEIGTLT 1010
               E ++ + +KQ   ++ D+E    E++ ++         + E   ++++       L 
Sbjct: 1003 KKSEGDVLKFQKQLKNSERDVELSSNELKAIEEKLKHTKLDLSENDIKMTETFNLRSELK 1062

Query: 1011 DEHAVTKHELDQKNEKIDSYSSIEIELTEQLQKLQNLANYLKKEMNEYDSKLSHLKLRDL 1070
            +E    K  + +  E ID + S+EIE+  +L+KL +L  ++KKE+N+ +  LS L +RD+
Sbjct: 1063 EESEQLKEMVAETEENIDEFKSLEIEMKNKLEKLNSLLMHIKKEINQQEKGLSELSIRDV 1122

Query: 1071 GQVMLDLEENKSLQSFSHSPTPD-TKREN-IQSSMLETHLASPSPNERKIS----IAENN 1124
               +  L+ N          T D  K +N I+ ++++   +S + +E+ I       +++
Sbjct: 1123 THTLEILDNN----------TMDIVKTDNKIEQAVVKEKRSSETQDEKNIQEEERTCDDH 1172

Query: 1125 LSMEVDEQASVLENGLPKLPDSELARVDLEDLERDIVQLQDYIDNSTVDIEILDEYAKRL 1184
             SM++DE ++ +  G+P+  + EL  +D+E LE++I +L  YID + VDI +L+EYA+RL
Sbjct: 1173 HSMDIDETSNEVIRGIPRFSEEELKELDIELLEKEISELSYYIDETNVDIGVLEEYARRL 1232

Query: 1185 AEYRRRRIDLNEAIMKRDETRMHCEVLKKRRLDEFMEGFGIISITLKEMYQMITMGGNAE 1244
            AE++RR++DLN+A+ KRDE +   EVLKK+R DEFM GF IIS+TLKEMYQMITMGGNAE
Sbjct: 1233 AEFKRRKLDLNQAVQKRDEVKGQVEVLKKKRFDEFMTGFNIISMTLKEMYQMITMGGNAE 1292

Query: 1245 LELVDSLDPFSEGVLFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDE 1304
            LELVDSLDPFSEGV FSVMPPKKSWRNI+NLSGGEKTLSSLALVFALHKYKPTPLYVMDE
Sbjct: 1293 LELVDSLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDE 1352

Query: 1305 IDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQRLVGIYKNSNMTRSTTLQNR 1364
            IDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQ+LVGIYK  N TRSTT++N 
Sbjct: 1353 IDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKRDNRTRSTTVKNI 1412

Query: 1365 DIIN 1368
            DI+N
Sbjct: 1413 DILN 1416

>KLTH0G13750g Chr7 complement(1184169..1188368) [4200 bp, 1399 aa]
            {ON} similar to uniprot|Q12267 Saccharomyces cerevisiae
            YLR086W SMC4 Subunit of the condensin complex which
            reorganizes chromosomes during cell division forms a
            stable complex with Smc2p that has ATP-hydrolyzing and
            DNA- binding activity and promotes knotting of circular
            DNA potential Cdc28p substrate
          Length = 1399

 Score = 1340 bits (3469), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 710/1365 (52%), Positives = 937/1365 (68%), Gaps = 13/1365 (0%)

Query: 14   TPVKLLATSPDRKNVVSRGSSVSTTMGLRGPSLQPPVAHQIXXXXXXXXXXXXXXXXXXX 73
            TP KL+  SPD++   S+  + S++     P LQP  +                      
Sbjct: 36   TPRKLVLGSPDKRFAFSQPVTSSSS---NVPYLQPLKSELSSSRGRVYSQSPPRSPTRSP 92

Query: 74   XXAVELIQLSPIKNSRLELQRLYDTK--QKKVERLCIRTLVLENFKSYAGRQVVGPFHSS 131
               +ELIQLSP K +RLE Q+    +   + +ERLCI  L L NFKSYAG QVVGPFHSS
Sbjct: 93   TRKLELIQLSPTKKTRLESQKTEQVRGLAQPIERLCINRLSLHNFKSYAGTQVVGPFHSS 152

Query: 132  FSAVVGPNGSGKSNVIDSMLFAFGFRANKMRQGKLSHLIHKSEKYPDLDFCSVEIQFQYV 191
            FSAVVGPNGSGKSNVIDS+LF FGFRANKMRQGKLS LIHKSE +P+LD C VE+ FQYV
Sbjct: 153  FSAVVGPNGSGKSNVIDSLLFVFGFRANKMRQGKLSDLIHKSEAHPNLDSCHVEVFFQYV 212

Query: 192  VDEPDGTTRVLSGKPELSVMRKAFKNNTSKYYLNGKESTYTEVTRLLRDEGIDLDHKRFL 251
             DE DG T V   +P L V RKAFKNNTSKYY+NGKES+YT+VT LLR EGIDLDHKRFL
Sbjct: 213  QDELDGRTTVRQDRPGLVVTRKAFKNNTSKYYVNGKESSYTQVTELLRKEGIDLDHKRFL 272

Query: 252  ILQGEVESIAQMKPKAEHEGDDGLLEYLEDIIGTTKYKAQIEQALVEVDSLNDICMEKEN 311
            ILQGEVESIAQMKPKAE EGDDGLLEYLEDIIGT KYK  IEQ LV++D LND+C EKEN
Sbjct: 273  ILQGEVESIAQMKPKAEKEGDDGLLEYLEDIIGTAKYKPLIEQTLVQIDQLNDVCQEKEN 332

Query: 312  RFDLVEKEKLSLEPGKDEALAFLKKEKDLTLLMSKKYQYHLFHNGSKLAKTLSNVSNTMN 371
            R+++VE+EK SLE GKDEAL FL+KEK LT L SK  Q+ L+ N  K   T   +     
Sbjct: 333  RYEIVEREKSSLESGKDEALEFLEKEKKLTFLRSKLLQHKLWKNSFKSTNTQEKIKTLEE 392

Query: 372  XXXXXXXXXXXXXXXXXXLTDASEQLANRLVSMNNTNKESLAKMRQLERELVSNEEKQKS 431
                              L   S+ L   +  + ++     ++ R  +R+ VS EEK K+
Sbjct: 393  KLSAERAKYTEHKREIKQLESESKSLNVTIRGIKDSESSLTSEKRTCDRDRVSLEEKLKN 452

Query: 432  LLQKRSKAEKTLNTVEKSIKQCENKIEEYISQNQEYETSLTTLNHTIVDAQAELEKMKLA 491
            + QK+ KAEKT +    SI   + K+EE      +YE  L  LN +++  + +L+++K++
Sbjct: 453  ISQKKVKAEKTHHATVNSINATQAKLEELFKDQVQYEKELDELNKSLLVEKTKLDEIKIS 512

Query: 492  LSDKTGDITKEVAVLEKELEPWTNKVEEKKSEIKLVESEISIIKEADLKLESEIANLSQE 551
            L  KTG I+ ++  +E+ELEPW  K++EK+S+IKL E++IS++KE+  K+  EI+    +
Sbjct: 513  LKGKTGAISVQIGEIEQELEPWNVKLQEKRSQIKLEETKISVLKESLAKIAEEISKSEND 572

Query: 552  IEQLRGNISHREESIETLNVESSSIRDYILVGERECTSARSKLEEMKKVLVTHRQRVNDA 611
            I   R  ++ + ++IE L  E + I+  I++G+ EC +A +K++EMK VL THRQR  DA
Sbjct: 573  ISNNRKKVAEQHQAIEGLEKEHTDIQRQIIIGQTECDNASNKMKEMKAVLTTHRQRSLDA 632

Query: 612  RSAVSSAENKNKVLTALSRLQKSGRIDGYHGRLGDLGTIDDKYDIAISTACPRLDDIVVD 671
            +S++S+ ENKNKVL+AL RLQ+SGRI G+HGRLGDLGTIDDKYD+AISTACPRLDD+VV+
Sbjct: 633  KSSLSTFENKNKVLSALQRLQRSGRISGFHGRLGDLGTIDDKYDVAISTACPRLDDVVVE 692

Query: 672  TVECGQQCIEHLRKNKLGYARFILLDKLRKFNLQPAHTPENVPRLFDLVKPKEPKFAPAF 731
            TVECGQQCIEHLRKNKLGYARFILLDKLR FN+    TP NV RLFDLV P + KF  AF
Sbjct: 693  TVECGQQCIEHLRKNKLGYARFILLDKLRSFNMNTIQTPNNVSRLFDLVHPIDNKFRNAF 752

Query: 732  YSVLRDTLVTTDLSQANRVAYGKKRYRVVTLDGKLIDISGTMTGGGDRAASGLMKSTQ-- 789
            YSVLRDTLV  DL +ANRVAYGK+R+RVVTLDGKLID+SGTM+GGG+  ASG+MKS +  
Sbjct: 753  YSVLRDTLVAKDLKEANRVAYGKQRFRVVTLDGKLIDLSGTMSGGGNHRASGMMKSERLN 812

Query: 790  QSSLYTPEEVQRMEEELNEREKNFKVAFETFQEMESALQNYLDRQPEIEVELSKQKMDIE 849
              + +T EEV++++EEL ERE+NFK+A +T  EME ALQ+  DR+PEIE ++SK++M+I+
Sbjct: 813  TGASFTAEEVRQIDEELTERERNFKIATDTLHEMEDALQSLKDREPEIETDISKRRMEID 872

Query: 850  TISAELESKIERKLELERSNKTSIEDSSELRTAEEKLAALNADLNSFMSASESKNQRIKE 909
            ++ +E++   +R   L++  K +      L  A  +L +L A+        +SK  +IKE
Sbjct: 873  SLLSEIKLCEDRAASLKKEQKLNESSDDTLIEANSRLDSLKAECKLLEGEMKSKKNKIKE 932

Query: 910  LRAKIMEIGGLELQTLNSKVDSLNXXXXXXXXXXXXXXXXXXXXELELKRARKQQITAKD 969
            L+ +IM+IGG +LQ   S VDS+                     E +LKR  KQ      
Sbjct: 933  LQEQIMKIGGTKLQLQGSLVDSIGQRISITLGKQKRDKTAVKKAENDLKRYEKQAGQLSV 992

Query: 970  DIEHCDIEIQKMKSSYDTISTGMQELQKQLSDLQEEIGTLTDEHAVTKHELDQKNEKIDS 1029
            DI+ C  E++ +K    +    + EL+  +  LQ+E   + ++    +  +++K+ +   
Sbjct: 993  DIDQCTNELESIKELISSSDNKILELEASIDKLQKEGEEIEEKVREIERLIEEKSSEGQD 1052

Query: 1030 YSSIEIELTEQLQKLQNLANYLKKEMNEYDSKLSHLKLRDLGQVM-----LDLEENKSLQ 1084
            ++  E+++  QL+KL +L N++ K+ ++   +L  LK+RD+   +     L L E++S  
Sbjct: 1053 FAVFEVDINNQLEKLNDLLNHIGKDGHDLLKQLESLKIRDVTATLQTLNKLLLSESRSGD 1112

Query: 1085 SFSHSPTPDTKRENIQSSMLETHLASPS-PNERKISIAENNLSMEVDEQASVLENGLPKL 1143
                  +    +E     ++E         NE   S  E+ + ++  E+     + LPKL
Sbjct: 1113 ELHGQSSEARSQEPSNGDLMEVDTVEGCMGNEPTASQPEDQMDVDEPEEMETSPSDLPKL 1172

Query: 1144 PDSELARVDLEDLERDIVQLQDYIDNSTVDIEILDEYAKRLAEYRRRRIDLNEAIMKRDE 1203
             +++L  +++E++E +I QL D+++N+  DIE+L+EY KRL +++ R+++LN+A+ +RD 
Sbjct: 1173 TEAQLKELNVEEVELEIGQLNDFVENAYADIEVLEEYTKRLVDFQARKLELNKAVEQRDS 1232

Query: 1204 TRMHCEVLKKRRLDEFMEGFGIISITLKEMYQMITMGGNAELELVDSLDPFSEGVLFSVM 1263
             R +C+ L+K+RLDEFM GF  IS+TLKEMYQMITMGGNAELELVDSLDPFSEGVLFSVM
Sbjct: 1233 VRQNCDNLRKKRLDEFMNGFNTISMTLKEMYQMITMGGNAELELVDSLDPFSEGVLFSVM 1292

Query: 1264 PPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKE 1323
            PPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKE
Sbjct: 1293 PPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKE 1352

Query: 1324 RTKNAQFIVISLRNNMFELAQRLVGIYKNSNMTRSTTLQNRDIIN 1368
            RTKNAQFIVISLRNNMFELAQ+LVGIYKN NMT+S  L+N+D+IN
Sbjct: 1353 RTKNAQFIVISLRNNMFELAQQLVGIYKNRNMTKSVALENKDLIN 1397

>ZYRO0C01716g Chr3 complement(130331..134572) [4242 bp, 1413 aa] {ON}
            similar to uniprot|Q12267 Saccharomyces cerevisiae
            YLR086W SMC4 Subunit of the condensin complex which
            reorganizes chromosomes during cell division forms a
            stable complex with Smc2p that has ATP-hydrolyzing and
            DNA- binding activity and promotes knotting of circular
            DNA potential Cdc28p substrate
          Length = 1413

 Score = 1338 bits (3464), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 718/1366 (52%), Positives = 969/1366 (70%), Gaps = 14/1366 (1%)

Query: 14   TPVKLLATSPDRKNVVSRGSSVSTTMGLRGPSLQPPVAHQIXXXXXXXXXXXXXXXXXXX 73
            TP KL+  + D  N  +  S   ++  L+ P LQPP                        
Sbjct: 51   TPRKLVVGNGD--NRYAHSSQSISSSSLQVPPLQPPATSSRGRGSKTYSQSPPRSPGRSP 108

Query: 74   XXAVELIQLSPIKNSRLELQRLYDTKQKKVE--RLCIRTLVLENFKSYAGRQVVGPFHSS 131
               +ELIQ+SP+KNSRLELQ++YD +Q +    RLCI  L+L++FKSYAGRQVVGPF++S
Sbjct: 109  TRKLELIQISPLKNSRLELQKIYDAQQNQARHTRLCIDQLILQDFKSYAGRQVVGPFNTS 168

Query: 132  FSAVVGPNGSGKSNVIDSMLFAFGFRANKMRQGKLSHLIHKSEKYPDLDFCSVEIQFQYV 191
            FSAVVGPNGSGKSNVIDSMLF FGFRANKMRQ +LS LIHKSE+YP L  CSVE+ F+YV
Sbjct: 169  FSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEEYPSLPSCSVEVHFKYV 228

Query: 192  VDEPDGTTRVLSGKPELSVMRKAFKNNTSKYYLNGKESTYTEVTRLLRDEGIDLDHKRFL 251
            +DEP G TR+   KP L V RKAF+NNTSKYY+N +E+ Y EVT+LL+ EG+DLDHKRFL
Sbjct: 229  IDEPSGETRIDEEKPNLVVTRKAFRNNTSKYYVNDQETNYGEVTKLLKKEGVDLDHKRFL 288

Query: 252  ILQGEVESIAQMKPKAEHEGDDGLLEYLEDIIGTTKYKAQIEQALVEVDSLNDICMEKEN 311
            ILQGEVE+IAQMK KAE EG+DGLLEYLEDIIGT KYK  IE+ L +++SLNDIC+EKEN
Sbjct: 289  ILQGEVENIAQMKSKAEREGEDGLLEYLEDIIGTAKYKPLIEKNLADMESLNDICIEKEN 348

Query: 312  RFDLVEKEKLSLEPGKDEALAFLKKEKDLTLLMSKKYQYHLFHNGSKLAKTLSNVSNTMN 371
            RF +V++EK SLE GK+EAL FL+ E+ LT+  SK YQYH+ ++  KL  TL  ++N   
Sbjct: 349  RFQIVDREKNSLENGKEEALLFLENERKLTVSKSKLYQYHILNSNMKLKNTLDKITNLNQ 408

Query: 372  XXXXXXXXXXXXXXXXXXLTDASEQLANRLVSMNNTNKESLAKMRQLERELVSNEEKQKS 431
                              L    ++L ++L + NN  K+ L K R+L+ + V NEEK K+
Sbjct: 409  KLEKESDKNASVKKELDKLRAFGDELESKLKNCNNEEKQLLGKKRELDGKNVLNEEKIKN 468

Query: 432  LLQKRSKAEKTLNTVEKSIKQCENKIEEYISQNQEYETSLTTLNHTIVDAQAELEKMKLA 491
              +KR KAEKTL+++++SI   E ++ E      +YE SL  LN      + +LEK+K +
Sbjct: 469  FEKKRDKAEKTLSSMDRSISSSEARLSELKQLQVDYENSLKELNEQTEVEKMKLEKIKFS 528

Query: 492  LSDKTGDITKEVAVLEKELEPWTNKVEEKKSEIKLVESEISIIKEADLKLESEIANLSQE 551
            L DKT  I+ E+A LEKELEPW  +++EKK++I+L ES+IS+IKEA+ KL  EI    QE
Sbjct: 529  LKDKTNGISLEIAQLEKELEPWNAQLQEKKTQIQLAESQISLIKEAEAKLAQEIDQFKQE 588

Query: 552  IEQLRGNISHREESIETLNVESSSIRDYILVGERECTSARSKLEEMKKVLVTHRQRVNDA 611
            IE  +  I    + +++L+ +  S+++ I  GE+EC +AR +L+EM+ +L T RQ+  DA
Sbjct: 589  IETRKQQILQGSKELDSLHSQHKSVKEEISTGEKECLNARIRLKEMQNILNTQRQKALDA 648

Query: 612  RSAVSSAENKNKVLTALSRLQKSGRIDGYHGRLGDLGTIDDKYDIAISTACPRLDDIVVD 671
            RSA+S+AENK+KVLTALSRLQKSGRI G+HGRLGDLG ID+KYD+AISTACPRL+DIVV+
Sbjct: 649  RSALSNAENKSKVLTALSRLQKSGRISGFHGRLGDLGVIDEKYDVAISTACPRLEDIVVE 708

Query: 672  TVECGQQCIEHLRKNKLGYARFILLDKLRKFNLQPAHTPENVPRLFDLVKPKEPKFAPAF 731
            TVECGQQCIE+LRKNKLGYARFILLDKLRKFNL   +TPE+VPRLFDL+ PK+PKF+ AF
Sbjct: 709  TVECGQQCIEYLRKNKLGYARFILLDKLRKFNLDSINTPESVPRLFDLIHPKDPKFSSAF 768

Query: 732  YSVLRDTLVTTDLSQANRVAYGKKRYRVVTLDGKLIDISGTMTGGGDRAASGLMK----S 787
            +SVL +TLV  DL QANRVAYGKKR+RVVTLDG LIDISGTM+GGG R + GLM+     
Sbjct: 769  FSVLGNTLVANDLKQANRVAYGKKRFRVVTLDGNLIDISGTMSGGGSRVSRGLMQINRNK 828

Query: 788  TQQSSLYTPEEVQRMEEELNEREKNFKVAFETFQEMESALQNYLDRQPEIEVELSKQKMD 847
            T+   +Y+ EEV ++E  L EREKNF+VA +T  +ME  L++  +++P IE  +S+  M+
Sbjct: 829  TEDIEIYSSEEVAQLEVNLVEREKNFQVASDTIYQMEEQLKDLKEKEPAIENNISQLTME 888

Query: 848  IETISAELESKIERKLELERSNKTSIEDSSELRTAEEKLAALNADLNSFMSASESKNQRI 907
            IE+ ++E++ K  + LE ER+   + +++ ELR   + + +L  +  S  + ++SK  RI
Sbjct: 889  IESWNSEIKIKEIQMLESERAYSATQDNNVELRETIQHVQSLKDEFKSIQNQTKSKKHRI 948

Query: 908  KELRAKIMEIGGLELQTLNSKVDSLNXXXXXXXXXXXXXXXXXXXXELELKRARKQQITA 967
            + L+ +IMEIGG EL+  +SKVDS+                     E E+ ++ K ++  
Sbjct: 949  ETLKNEIMEIGGAELKIQSSKVDSVIQRIDIVVSKQKKERSVIKKTENEINKSHKMKLET 1008

Query: 968  KDDIEHCDIEIQKMKSSYDTISTGMQELQKQLSDLQEEIGTLTDEHAVTKHELDQKNEKI 1027
              D+E+ + EIQ +K++ + +   + ++ + ++ +Q     L +E    + +L+  NE I
Sbjct: 1009 SRDLENFNQEIQTLKTTIEGLQDSLNKVHESVTSVQHTKEGLIEESRTLEDKLNDINEDI 1068

Query: 1028 DSYSSIEIELTEQLQKLQNLANYLKKEMNEYDSKLSHLKLRDLGQVMLDL-EENKSLQSF 1086
              + S E+E+  +L+KL +L+ +LKKE+  Y+ KL  LK+RD+ Q++ DL +E+ +    
Sbjct: 1069 AIFKSFEMEMKNELEKLNSLSFHLKKEIKHYEEKLGDLKIRDVTQILHDLKDESNNASDP 1128

Query: 1087 SHSPTPDTKRENIQSSMLETHLASPSPNER-KISIAE--NNLSMEVDEQASVLENGLPKL 1143
            S +P  D   E  +SS+ E    +   + + ++  AE   +  M+V++     + GL + 
Sbjct: 1129 SENPVSDV--EESESSVGEGKDENKDLDAQDQVQDAEKQGDNQMDVEDGGEYSDRGLTQF 1186

Query: 1144 PDSELARVDLEDLERDIVQLQDYIDNSTVDIEILDEYAKRLAEYRRRRIDLNEAIMKRDE 1203
             + EL  +++E+LE++I  LQ+++D S  DI++L+EYA+RL E++ RR+DLN+A+ +R++
Sbjct: 1187 SEDELHEIEIEELEKEIEDLQNFLDASNADIDVLEEYARRLIEFKSRRLDLNQAVEERNK 1246

Query: 1204 TRMHCEVLKKRRLDEFMEGFGIISITLKEMYQMITMGGNAELELVDSLDPFSEGVLFSVM 1263
             +   + LKK+R DEFM+GFGIIS+TLKEMYQMITMGGNAELELVD+LDPFSEGV FSVM
Sbjct: 1247 VKEKLDELKKKRFDEFMQGFGIISMTLKEMYQMITMGGNAELELVDTLDPFSEGVTFSVM 1306

Query: 1264 PPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKE 1323
            PPKKSWRNI+NLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKE
Sbjct: 1307 PPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKE 1366

Query: 1324 RTKNAQFIVISLRNNMFELAQRLVGIYKNSNMTRSTTLQNRDIINV 1369
            RTKNAQFIVISLRNNMFELAQ+LVGIYK  N T+S T++N D ++V
Sbjct: 1367 RTKNAQFIVISLRNNMFELAQQLVGIYKRDNKTKSATIKNIDFVSV 1412

>Kpol_392.8 s392 complement(19392..23675) [4284 bp, 1427 aa] {ON}
            complement(19392..23675) [4284 nt, 1428 aa]
          Length = 1427

 Score = 1332 bits (3448), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 716/1384 (51%), Positives = 960/1384 (69%), Gaps = 44/1384 (3%)

Query: 14   TPVKLLATSPDRKNVVSRGSSVSTTMGLRGPSLQPPV-----AHQIXXXXXXXXXXXXXX 68
            TP KL+    D    ++  +++  +  L+ PSL PP                        
Sbjct: 57   TPKKLILRDYDSI-AITPTAAMPPSSSLQAPSLHPPTESSSRGRTARTYSQSPPRSPARS 115

Query: 69   XXXXXXXAVELIQLSPIKNSRLELQRLYDTK-QKKVERLCIRTLVLENFKSYAGRQVVGP 127
                    +ELIQLSP+KNSR+ LQ++Y++K +K++ERLCI  LVL +FKSYAG QVVGP
Sbjct: 116  PARSPTRKLELIQLSPVKNSRIALQKIYESKNEKQIERLCIDKLVLHDFKSYAGTQVVGP 175

Query: 128  FHSSFSAVVGPNGSGKSNVIDSMLFAFGFRANKMRQGKLSHLIHKSEKYPDLDFCSVEIQ 187
            FHSSFSAVVGPNGSGKSNVIDSMLF FGFRA+KMRQ +LS LIHKSE +PDL  CSVE+ 
Sbjct: 176  FHSSFSAVVGPNGSGKSNVIDSMLFVFGFRASKMRQDRLSDLIHKSENFPDLKSCSVEVH 235

Query: 188  FQYVVDEPDGTTRVLSGKPELSVMRKAFKNNTSKYYLNGKESTYTEVTRLLRDEGIDLDH 247
            F+YV+D+PDGTT + + K +L + RKAFKNNTSKYY+NGKES YT VT+LL+DEGIDLDH
Sbjct: 236  FEYVIDKPDGTTIINTVKEKLVITRKAFKNNTSKYYINGKESNYTSVTKLLKDEGIDLDH 295

Query: 248  KRFLILQGEVESIAQMKPKAEHEGDDGLLEYLEDIIGTTKYKAQIEQALVEVDSLNDICM 307
             RFLILQGEVE+IAQMKPKAE++GDDGLLEYLEDIIGT KYK  IE+   E+++LN+IC+
Sbjct: 296  NRFLILQGEVENIAQMKPKAENDGDDGLLEYLEDIIGTAKYKPLIEKKFEEIEALNEICI 355

Query: 308  EKENRFDLVEKEKLSLEPGKDEALAFLKKEKDLTLLMSKKYQYHLFHNGSKLAKTLSNVS 367
            EKENRF++V++EK SLE GKDEAL FL+KEK+LTL+ SK YQY L+ +  KL+ TL  +S
Sbjct: 356  EKENRFEIVDREKASLESGKDEALEFLEKEKELTLVKSKLYQYKLWQDNKKLSTTLEKLS 415

Query: 368  NTMNXXXXXXXXXXXXXXXXXXLTDASEQLANRLVSMNNTNKESLAKMRQLERELVSNEE 427
            N                     ++ +  ++   + +     K+   + R  + E VS EE
Sbjct: 416  NIKEEFEETKKKHSTTEIQMNEISKSYHEMLKNIKASQEQEKKLNIQKRNYDTERVSLEE 475

Query: 428  KQKSLLQKRSKAEKTLNTVEKSIKQCENKIEEYISQNQEYETSLTTLNHTIVDAQAELEK 487
            ++K++++K+ K EK L    K+I   + KIE+      EYE+ L  LN  +   +  LE+
Sbjct: 476  QRKNIMKKKKKMEKELEDCNKTISNTKIKIEDLGKNESEYESQLDELNAQLQIERGLLEE 535

Query: 488  MKLALSDKTGDITKEVAVLEKELEPWTNKVEEKKSEIKLVESEISIIKEADLKLESEIAN 547
            +K++L DKT + + E++  EKELEPW  +++ KKS+I++ ESEIS+IKE  +KLE++I N
Sbjct: 536  IKISLKDKTIEFSDEISQHEKELEPWNLQLQGKKSQIQVKESEISLIKEGRVKLENDIEN 595

Query: 548  LSQEIE-QLRGNISHREESIETLNVESSSIRDYILVGERECTSARSKLEEMKKVLVTHRQ 606
            L+  I  ++   IS RE+ I +L  E + I   + +G+ E T+A+ KL EMK VL  HRQ
Sbjct: 596  LNSLISVKIEEKIS-REKEIGSLRNELNRITKEVSIGDTEYTNAKEKLREMKAVLNQHRQ 654

Query: 607  RVNDARSAVSSAENKNKVLTALSRLQKSGRIDGYHGRLGDLGTIDDKYDIAISTACPRLD 666
            +  DAR+++S+ ENKN+VL +L RLQKSGRI G++GRLGDLG IDD+YDIAISTACPRL+
Sbjct: 655  KAIDARTSLSAEENKNQVLASLFRLQKSGRISGFYGRLGDLGAIDDRYDIAISTACPRLN 714

Query: 667  DIVVDTVECGQQCIEHLRKNKLGYARFILLDKLRKFNLQPAHTPENVPRLFDLVKPKEPK 726
            D+VV+TVECGQQCIE+LRKNKLGYARFILL+KLR F++    TP NVPRLFDLV   +PK
Sbjct: 715  DLVVETVECGQQCIEYLRKNKLGYARFILLEKLRNFDMNKISTPNNVPRLFDLVISSDPK 774

Query: 727  FAPAFYSVLRDTLVTTDLSQANRVAYGKKRYRVVTLDGKLIDISGTMTGGGDRAASGLMK 786
            F PAFYSVLRDTLV  +L  ANRVAYG KR+RVVTL G+LID+SGTM+GGG + + GLMK
Sbjct: 775  FLPAFYSVLRDTLVVNNLKDANRVAYGNKRFRVVTLSGELIDVSGTMSGGGTQTSRGLMK 834

Query: 787  STQQSS----LYTPEEVQRMEEELNEREKNFKVAFETFQEMESALQNYLDRQPEIEVELS 842
             T+  +     YT E+V+++E+EL  REKNF++A ETF EME+ L+   DR+P++E+E+S
Sbjct: 835  LTKSGNSGFKSYTIEDVEKIEKELAAREKNFEIANETFTEMETELRRLKDRKPDVELEIS 894

Query: 843  KQKMDIETISAELESKIERKLELERSNKTSIEDSSELRTAEEKLAALNADLNSFMSASES 902
            K +++I +   E E   ++  E ++S    + ++ EL T E +L  L  D  S    ++S
Sbjct: 895  KFELEITSWVTEHELMQQQLNEKQQSLDECMSNNEELSTMEHELGTLQNDYKSLQLETKS 954

Query: 903  KNQRIKELRAKIMEIGGLELQTLNSKVDSLNXXXXXXXXXXXXXXXXXXXXELELKRARK 962
            K  RIK L+ +IM++GG++LQ  +SKVDS+                     E ELKR  K
Sbjct: 955  KKDRIKFLKDEIMKVGGIKLQVQSSKVDSIIQKKDILNGKHKKDKNDLKKAETELKRLSK 1014

Query: 963  QQ-------ITAKDDIEHCDIEIQKMKSSYDTISTGMQELQKQLSDLQEEIGTLTDEHAV 1015
            +Q       +T+ D +E+ D ++ K+  S     T + EL+    +  +    L D    
Sbjct: 1015 KQSECSTDLLTSTDKLENTDGQLSKISKSLSETETLLHELEFSREESLQNSENLKD---- 1070

Query: 1016 TKHELDQKNEKIDSYSSIEIELTEQLQKLQNLANYLKKEMNEYDSKLSHLKLRDLGQVML 1075
               +L +  E ++S+   ++E   + +KL NL N++KK++   DS+L  LK+RD+   + 
Sbjct: 1071 ---QLKEFEENLNSFKVFQLEHQNKEEKLNNLLNFIKKDIRSTDSELQSLKIRDITHTLQ 1127

Query: 1076 DL--------EENKSLQSFSHSPTPDT---KRENIQSSMLETHLASPSPNERKISIAENN 1124
            +L        EE+ S++  + S + +      EN++   +ET+ +  SP+      A N+
Sbjct: 1128 ELDNGNIDQDEEDVSMKDNAVSVSANNSLGNSENMEGVEIETNESDVSPD------ANND 1181

Query: 1125 LSMEVDEQASVLENGLPKLPDSELARVDLEDLERDIVQLQDYIDNSTVDIEILDEYAKRL 1184
            L ME+DE  + +  G+P++ + E   VD+E+LE   +QLQDYID   V+I++L+EYA+R+
Sbjct: 1182 LEMEIDEDNNEISKGIPRISEDEFKNVDVEELEAQKLQLQDYIDTVNVNIDVLEEYARRV 1241

Query: 1185 AEYRRRRIDLNEAIMKRDETRMHCEVLKKRRLDEFMEGFGIISITLKEMYQMITMGGNAE 1244
            AEY+RR++DLN A+ +R++ R   + LKK R +EFM+GFG+ISITLKEMYQMITMGGNAE
Sbjct: 1242 AEYKRRKLDLNNAVDEREKVRELLDKLKKTRFEEFMQGFGVISITLKEMYQMITMGGNAE 1301

Query: 1245 LELVDSLDPFSEGVLFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDE 1304
            LELVDSLDPFSEGV FSVMPPKKSWRNI+NLSGGEKTLSSLALVFALHKYKPTPLYVMDE
Sbjct: 1302 LELVDSLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDE 1361

Query: 1305 IDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQRLVGIYKNSNMTRSTTLQNR 1364
            IDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELA++LVGIYK++N T+S TLQN 
Sbjct: 1362 IDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAEQLVGIYKSNNQTKSATLQNN 1421

Query: 1365 DIIN 1368
            DIIN
Sbjct: 1422 DIIN 1425

>Suva_10.170 Chr10 (307316..311566) [4251 bp, 1416 aa] {ON} YLR086W
            (REAL)
          Length = 1416

 Score = 1328 bits (3436), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 710/1374 (51%), Positives = 944/1374 (68%), Gaps = 38/1374 (2%)

Query: 14   TPVKLLATSPDRKNVVSRGSSVSTTMGLRGPSLQPPVAHQIXXXXXXXXXXXXXXXXXXX 73
            TP KL+ +S + +   S+ ++ S T  L  P+LQPP A                      
Sbjct: 60   TPRKLVLSSGENRYAFSQPTN-SATSSLHVPNLQPPEAPSRGRDYKAYSQSPPRSPGRSP 118

Query: 74   XXAVELIQLSPIKNSRLELQRLYDTKQKKVE---RLCIRTLVLENFKSYAGRQVVGPFHS 130
               +EL+QLSP+KNSR+ELQ+LYD+ Q   E   RL I  LVLENFKSYAG+QVVGPFH+
Sbjct: 119  TRRLELLQLSPVKNSRIELQKLYDSHQPSGEQQGRLFIDKLVLENFKSYAGKQVVGPFHT 178

Query: 131  SFSAVVGPNGSGKSNVIDSMLFAFGFRANKMRQGKLSHLIHKSEKYPDLDFCSVEIQFQY 190
            SFSAVVGPNGSGKSNVIDSMLF FGFRANKMRQ +LS LIHKSE++P+L  CSV + F+Y
Sbjct: 179  SFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEEFPNLQSCSVAVHFEY 238

Query: 191  VVDEPDGTTRVLSGKPELSVMRKAFKNNTSKYYLNGKESTYTEVTRLLRDEGIDLDHKRF 250
            VVDEP GT+R+   KP L + RKAF+NN+SKYY+NGKES YT+VT+LL++EGIDLDHKRF
Sbjct: 239  VVDEPSGTSRIDEEKPGLVITRKAFRNNSSKYYINGKESNYTQVTKLLKNEGIDLDHKRF 298

Query: 251  LILQGEVESIAQMKPKAEHEGDDGLLEYLEDIIGTTKYKAQIEQALVEVDSLNDICMEKE 310
            LILQGEVE+IAQMK KAE E DDGLLEYLEDIIGT  YK  IE  L ++++LN+IC+EKE
Sbjct: 299  LILQGEVENIAQMKSKAEKESDDGLLEYLEDIIGTANYKPLIEDRLSQIETLNEICLEKE 358

Query: 311  NRFDLVEKEKLSLEPGKDEALAFLKKEKDLTLLMSKKYQYHLFHNGSKLAKTLSNVSNTM 370
            NRF++V +EK SLE GK+ AL FL+KEK LTLL SK +Q+ L  + SKLA TL   S+  
Sbjct: 359  NRFEIVNREKNSLESGKETALEFLEKEKQLTLLKSKLFQFKLLQSNSKLASTLEKTSSLN 418

Query: 371  NXXXXXXXXXXXXXXXXXXLTDASEQLANRLVSMNNTNKESLAKMRQLERELVSNEEKQK 430
                               +    +++ +R+ S  +  K    + R+LE   VS EE+ K
Sbjct: 419  KDFESEKKKFQESLKEVDEVESQRKEIKDRMSSCASQEKTLALEKRELESTRVSLEERTK 478

Query: 431  SLLQKRSKAEKTLNTVEKSIKQCENKIEEYISQNQEYETSLTTLNHTIVDAQAELEKMKL 490
            +L+ K  KAEK L +   SI + E+ +EE   +  E+ET +  LN ++ + +  L+ +KL
Sbjct: 479  NLVNKMGKAEKILKSTNHSISEAEHLLEELHGEQTEHETEVKDLNQSLEEERRILDDIKL 538

Query: 491  ALSDKTGDITKEVAVLEKELEPWTNKVEEKKSEIKLVESEISIIKEADLKLESEIANLSQ 550
            +L DKT DI+ E+   EK+LEPW  +++EKKS+I+L ESE+S+++E  +KL+     L +
Sbjct: 539  SLKDKTKDISAEIIQHEKDLEPWDLQLQEKKSQIQLAESELSLLEETQVKLKKNAEALEE 598

Query: 551  EIEQLRGNISHREESIETLNVESSSIRDYILVGERECTSARSKLEEMKKVLVTHRQRVND 610
             I   +      +  I  L     S+ D    GE++ ++A  KL+EM+ +L  HRQR  +
Sbjct: 599  NIAAKKARKQELQGFILDLKKNLKSLIDGRSQGEKDFSTAHLKLKEMQTILNAHRQRAME 658

Query: 611  ARSAVSSAENKNKVLTALSRLQKSGRIDGYHGRLGDLGTIDDKYDIAISTACPRLDDIVV 670
            ARS++S AENK+KVLTALSRLQKSGRI+G+HGRLGDLG IDD +D+AISTACPRLDD+VV
Sbjct: 659  ARSSLSKAENKSKVLTALSRLQKSGRINGFHGRLGDLGVIDDNFDVAISTACPRLDDVVV 718

Query: 671  DTVECGQQCIEHLRKNKLGYARFILLDKLRKFNLQPAHTPENVPRLFDLVKPKEPKFAPA 730
            DTVEC Q CI++LRKNKLGYARFILLD+LR+FNLQP  TPENVPRLFDLVKPK+PKF+ A
Sbjct: 719  DTVECAQHCIDYLRKNKLGYARFILLDRLRQFNLQPVDTPENVPRLFDLVKPKDPKFSNA 778

Query: 731  FYSVLRDTLVTTDLSQANRVAYGKKRYRVVTLDGKLIDISGTMTGGGDRAASGLMKSTQQ 790
            FYSVLRDTLV  DL QAN VAYGK+R+RVVT+DGKLIDISGTM+GGG+    GLM+  + 
Sbjct: 779  FYSVLRDTLVARDLKQANNVAYGKRRFRVVTIDGKLIDISGTMSGGGNHVVKGLMRIGKN 838

Query: 791  SS----LYTPEEVQRMEEELNEREKNFKVAFETFQEMESALQNYLDRQPEIEVELSKQKM 846
             S     YTPEEV ++E EL+EREKNF+VA +T  EME  L+   D++P++E ++ + +M
Sbjct: 839  QSDRMDDYTPEEVNKIENELSEREKNFRVANDTVHEMEQELKKVRDQEPDMESQILRAEM 898

Query: 847  DIETISAELESKIERKLELERSNKTSIEDSSELRTAEEKLAALNADLNSFMSASESKNQR 906
            + +++++EL    E+  E + +   S+ D+++L    + L  L  + +   + +++K +R
Sbjct: 899  EADSLASELALAEEQVKEAKMAYDKSVNDTAQLNKIMKILEHLRGEYDDLQAETKTKKER 958

Query: 907  IKELRAKIMEIGGLELQTLNSKVDSLNXXXXXXXXXXXXXXXXXXXXELELKRARKQQIT 966
            IK L+ +IM+IGG  LQ  NSKV+SL+                      ++ + +KQ   
Sbjct: 959  IKALQDQIMKIGGTNLQIQNSKVESLSQRIDILVAKLKKVKSGIKKSVGDVTKFQKQLKN 1018

Query: 967  AKDDIEHCDIEIQKMKSSY----------DTISTGMQELQKQLSDLQEEIGTLTDEHAVT 1016
             + DIE    E++ ++             DT  TG+  L+   SDL+E+   L       
Sbjct: 1019 VERDIELSSNELKVIEEKSEQIKLDLIKNDTDVTGILNLK---SDLEEQSEQL------- 1068

Query: 1017 KHELDQKNEKIDSYSSIEIELTEQLQKLQNLANYLKKEMNEYDSKLSHLKLRDLGQVMLD 1076
            K ++ +   KID + S+E+E+  +L+KL +L  Y+K ++ + + +L+ L +RD+   +L 
Sbjct: 1069 KEKVAEMEGKIDEFKSLEMEMKNKLEKLNSLLTYIKSDIKQQEKELNELSIRDVTHTLLI 1128

Query: 1077 LEENK-SLQSFSHSPTPDTKRENIQS-SMLETHLASPSPNERKISIAENNLSMEVDEQAS 1134
            L+ N+  +         +T +E+I   +  ET       ++R          M +DE + 
Sbjct: 1129 LDNNQMDILDKEGEDRQETNQEDISGEAKGETQGEEGDNDDRHC--------MNIDETSD 1180

Query: 1135 VLENGLPKLPDSELARVDLEDLERDIVQLQDYIDNSTVDIEILDEYAKRLAEYRRRRIDL 1194
             +  G+P+L + EL  +++E LE DI +L  YID + VDI +L+EYA+RLAE++RR++DL
Sbjct: 1181 EVSRGIPRLSEDELKELNIELLEGDIGELTCYIDATNVDIGVLEEYARRLAEFKRRKLDL 1240

Query: 1195 NEAIMKRDETRMHCEVLKKRRLDEFMEGFGIISITLKEMYQMITMGGNAELELVDSLDPF 1254
            N+A+ KRDE +   E+LKK+R DEFM GF IIS+TLKEMYQMITMGGNAELELVDSLDPF
Sbjct: 1241 NQAVQKRDEVKEQLEILKKKRFDEFMTGFNIISMTLKEMYQMITMGGNAELELVDSLDPF 1300

Query: 1255 SEGVLFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNV 1314
            SEGV FSVMPPKKSWRNI+NLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNV
Sbjct: 1301 SEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNV 1360

Query: 1315 SIVANYIKERTKNAQFIVISLRNNMFELAQRLVGIYKNSNMTRSTTLQNRDIIN 1368
            SIVANYIKERTKNAQFIVISLRNNMFELAQ+LVG+YK  N T+STT++N DI+N
Sbjct: 1361 SIVANYIKERTKNAQFIVISLRNNMFELAQQLVGVYKRDNRTKSTTVKNIDILN 1414

>YLR086W Chr12 (302243..306499) [4257 bp, 1418 aa] {ON}  SMC4Subunit
            of the condensin complex; reorganizes chromosomes during
            cell division; forms a complex with Smc2p that has
            ATP-hydrolyzing and DNA-binding activity; required for
            tRNA gene clustering at the nucleolus; potential Cdc28p
            substrate
          Length = 1418

 Score = 1327 bits (3434), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 705/1368 (51%), Positives = 952/1368 (69%), Gaps = 24/1368 (1%)

Query: 14   TPVKLLATSPDRKNVVSRGSSVSTTMGLRGPSLQPPVAHQIXXXXXXXXXXXXXXXXXXX 73
            TP KL+ +S + +   S+ ++ STT  L  P+LQPP                        
Sbjct: 60   TPRKLVLSSGENRYAFSQPTN-STTTSLHVPNLQPPKTSSRGRDHKSYSQSPPRSPGRSP 118

Query: 74   XXAVELIQLSPIKNSRLELQRLYDTKQ---KKVERLCIRTLVLENFKSYAGRQVVGPFHS 130
               +EL+QLSP+KNSR+ELQ++YD  Q   K+  RL I  LVLENFKSYAG+QVVGPFH+
Sbjct: 119  TRRLELLQLSPVKNSRVELQKIYDRHQSSSKQQSRLFINELVLENFKSYAGKQVVGPFHT 178

Query: 131  SFSAVVGPNGSGKSNVIDSMLFAFGFRANKMRQGKLSHLIHKSEKYPDLDFCSVEIQFQY 190
            SFSAVVGPNGSGKSNVIDSMLF FGFRANKMRQ +LS LIHKSE +P L  CSV + FQY
Sbjct: 179  SFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEAFPSLQSCSVAVHFQY 238

Query: 191  VVDEPDGTTRVLSGKPELSVMRKAFKNNTSKYYLNGKESTYTEVTRLLRDEGIDLDHKRF 250
            V+DE  GT+R+   KP L + RKAFKNN+SKYY+N KES+YTEVT+LL++EGIDLDHKRF
Sbjct: 239  VIDESSGTSRIDEEKPGLIITRKAFKNNSSKYYINEKESSYTEVTKLLKNEGIDLDHKRF 298

Query: 251  LILQGEVESIAQMKPKAEHEGDDGLLEYLEDIIGTTKYKAQIEQALVEVDSLNDICMEKE 310
            LILQGEVE+IAQMKPKAE E DDGLLEYLEDIIGT  YK  IE+ + ++++LN++C+EKE
Sbjct: 299  LILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTANYKPLIEERMGQIENLNEVCLEKE 358

Query: 311  NRFDLVEKEKLSLEPGKDEALAFLKKEKDLTLLMSKKYQYHLFHNGSKLAKTLSNVSNTM 370
            NRF++V++EK SLE GK+ AL FL+KEK LTLL SK +Q+ L  + SKLA TL  +S++ 
Sbjct: 359  NRFEIVDREKNSLESGKETALEFLEKEKQLTLLRSKLFQFKLLQSNSKLASTLEKISSSN 418

Query: 371  NXXXXXXXXXXXXXXXXXXLTDASEQLANRLVSMNNTNKESLAKMRQLERELVSNEEKQK 430
                               +    +++ +R+ S ++  K  + + R+LE   VS EE+ K
Sbjct: 419  KDLEDEKMKFQESLKKVDEIKAQRKEIKDRISSCSSKEKTLVLERRELEGTRVSLEERTK 478

Query: 431  SLLQKRSKAEKTLNTVEKSIKQCENKIEEYISQNQEYETSLTTLNHTIVDAQAELEKMKL 490
            +L+ K  KAEKTL + + SI + EN +EE   Q  E+ET +  L   +   ++ L+ +KL
Sbjct: 479  NLVSKMEKAEKTLKSTKHSISEAENMLEELRGQQTEHETEIKDLTQLLEKERSILDDIKL 538

Query: 491  ALSDKTGDITKEVAVLEKELEPWTNKVEEKKSEIKLVESEISIIKEADLKLESEIANLSQ 550
            +L DKT +I+ E+   EKELEPW  +++EK+S+I+L ESE+S+++E   KL+  +  L +
Sbjct: 539  SLKDKTKNISAEIIRHEKELEPWDLQLQEKESQIQLAESELSLLEETQAKLKKNVETLEE 598

Query: 551  EIEQLRGNISHREESIETLNVESSSIRDYILVGERECTSARSKLEEMKKVLVTHRQRVND 610
            +I   + +    ++ I  L  + +S++D    GE+  TSA  KL+EM+KVL  HRQR  +
Sbjct: 599  KILAKKTHKQELQDLILDLKKKLNSLKDERSQGEKNFTSAHLKLKEMQKVLNAHRQRAME 658

Query: 611  ARSAVSSAENKNKVLTALSRLQKSGRIDGYHGRLGDLGTIDDKYDIAISTACPRLDDIVV 670
            ARS++S A+NK+KVLTALSRLQKSGRI+G+HGRLGDLG IDD +D+AISTACPRLDD+VV
Sbjct: 659  ARSSLSKAQNKSKVLTALSRLQKSGRINGFHGRLGDLGVIDDSFDVAISTACPRLDDVVV 718

Query: 671  DTVECGQQCIEHLRKNKLGYARFILLDKLRKFNLQPAHTPENVPRLFDLVKPKEPKFAPA 730
            DTVEC Q CI++LRKNKLGYARFILLD+LR+FNLQP  TPENVPRLFDLVKPK PKF+ A
Sbjct: 719  DTVECAQHCIDYLRKNKLGYARFILLDRLRQFNLQPISTPENVPRLFDLVKPKNPKFSNA 778

Query: 731  FYSVLRDTLVTTDLSQANRVAYGKKRYRVVTLDGKLIDISGTMTGGGDRAASGLMK-STQ 789
            FYSVLRDTLV  +L QAN VAYGKKR+RVVT+DGKLIDISGTM+GGG+  A GLMK  T 
Sbjct: 779  FYSVLRDTLVAQNLKQANNVAYGKKRFRVVTVDGKLIDISGTMSGGGNHVAKGLMKLGTN 838

Query: 790  QSSL---YTPEEVQRMEEELNEREKNFKVAFETFQEMESALQNYLDRQPEIEVELSKQKM 846
            QS     YTPEEV ++E EL+ERE NF+VA +T  EME  L+   D +P++E ++SK +M
Sbjct: 839  QSDKVDDYTPEEVDKIERELSERENNFRVASDTVHEMEEELKKLRDHEPDLESQISKAEM 898

Query: 847  DIETISAELESKIERKLELERSNKTSIEDSSELRTAEEKLAALNADLNSFMSASESKNQR 906
            + +++++EL    ++  E E +   ++ D ++L    + L  L  + N   S +++K ++
Sbjct: 899  EADSLASELTLAEQQVKEAEMAYVKAVSDKAQLNVVMKNLERLRGEYNDLQSETKTKKEK 958

Query: 907  IKELRAKIMEIGGLELQTLNSKVDSLNXXXXXXXXXXXXXXXXXXXXELELKRARKQQIT 966
            IK L+ +IM+IGG++LQ  NSKV+S+                       ++ + +K    
Sbjct: 959  IKGLQDEIMKIGGIKLQMQNSKVESVCQKLDILVAKLKKVKSASKKSGGDVVKFQKLLQN 1018

Query: 967  AKDDIEHCDIEIQKMKSSYDTISTGMQELQKQLSDLQEEIGTLTDEHAVTKHELDQKNEK 1026
            ++ D+E    E++ ++         + E    +++       L ++    K +++   E 
Sbjct: 1019 SERDVELSSDELKVIEEQLKHTKLALAENDTNMNETLNLKVELKEQSEQLKEQMEDMEES 1078

Query: 1027 IDSYSSIEIELTEQLQKLQNLANYLKKEMNEYDSKLSHLKLRDLGQVMLDLEENKSLQSF 1086
            I+ + SIEIE+  +L+KL +L  Y+K E+ + +  L+ L +RD+   +  L++NK     
Sbjct: 1079 INEFKSIEIEMKNKLEKLNSLLTYIKSEITQQEKGLNELSIRDVTHTLGMLDDNKM---- 1134

Query: 1087 SHSPTPDTKRENIQSS--MLETHLASPSPNERKISIAE----NNLSMEVDEQASVLENGL 1140
                  D+ +E+++++  + + + +  + +E +I  AE    N   M +DE +  +  G+
Sbjct: 1135 ------DSVKEDVKNNQELDQEYRSCETQDESEIKDAETSCDNYHPMNIDETSDEVSRGI 1188

Query: 1141 PKLPDSELARVDLEDLERDIVQLQDYIDNSTVDIEILDEYAKRLAEYRRRRIDLNEAIMK 1200
            P+L + EL  +D+E +E  I +L  Y++ + VDI +L+EYA+RLAE++RR++DLN A+ K
Sbjct: 1189 PRLSEDELRELDVELIESKINELSYYVEETNVDIGVLEEYARRLAEFKRRKLDLNNAVQK 1248

Query: 1201 RDETRMHCEVLKKRRLDEFMEGFGIISITLKEMYQMITMGGNAELELVDSLDPFSEGVLF 1260
            RDE +    +LKK+R DEFM GF IIS+TLKEMYQMITMGGNAELELVDSLDPFSEGV F
Sbjct: 1249 RDEVKEQLGILKKKRFDEFMAGFNIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTF 1308

Query: 1261 SVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANY 1320
            SVMPPKKSWRNI+NLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANY
Sbjct: 1309 SVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANY 1368

Query: 1321 IKERTKNAQFIVISLRNNMFELAQRLVGIYKNSNMTRSTTLQNRDIIN 1368
            IKERTKNAQFIVISLRNNMFELAQ+LVG+YK  N T+STT++N DI+N
Sbjct: 1369 IKERTKNAQFIVISLRNNMFELAQQLVGVYKRDNRTKSTTIKNIDILN 1416

>Skud_12.154 Chr12 (285613..289866) [4254 bp, 1417 aa] {ON} YLR086W
            (REAL)
          Length = 1417

 Score = 1309 bits (3388), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 707/1389 (50%), Positives = 944/1389 (67%), Gaps = 43/1389 (3%)

Query: 4    PTPKKPRI------LDTPVKLLATSPDRKNVVSRGSSVSTTMGLRGPSLQPPVAHQIXXX 57
            P P  P +        TP KL+ +S + +   S+ ++ +TT  L  P+LQPP        
Sbjct: 44   PDPNSPSLESSYARSHTPRKLVLSSGENRYAFSQPTNSATT-SLHVPNLQPPKVSSRGRD 102

Query: 58   XXXXXXXXXXXXXXXXXXAVELIQLSPIKNSRLELQRLYDTKQ---KKVERLCIRTLVLE 114
                               +EL+QLSP+KNSR+ELQ+LYD+ +   K+  RL I  LVL+
Sbjct: 103  YKAYSQSPPRSPGRSPARRLELLQLSPVKNSRIELQKLYDSHKSSGKQQGRLFINKLVLD 162

Query: 115  NFKSYAGRQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFAFGFRANKMRQGKLSHLIHKSE 174
            NFKSYAGRQVVGPFH+SFSAVVGPNGSGKSNVIDSMLF FGFRANKMRQ +LS LIHKSE
Sbjct: 163  NFKSYAGRQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSE 222

Query: 175  KYPDLDFCSVEIQFQYVVDEPDGTTRVLSGKPELSVMRKAFKNNTSKYYLNGKESTYTEV 234
             +PDL  CSV + F+Y++DEP GT+R+   KP L + R+AFKNN+SKYY+N KES+YTEV
Sbjct: 223  AFPDLQACSVAVHFEYIIDEPSGTSRIDEEKPGLVITRRAFKNNSSKYYINEKESSYTEV 282

Query: 235  TRLLRDEGIDLDHKRFLILQGEVESIAQMKPKAEHEGDDGLLEYLEDIIGTTKYKAQIEQ 294
            T+LL+ EGIDLDHKRFLILQGEVE+IAQMKPKAE E DDGLLEYLEDIIGT  YK  IE+
Sbjct: 283  TKLLKKEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTANYKPLIEE 342

Query: 295  ALVEVDSLNDICMEKENRFDLVEKEKLSLEPGKDEALAFLKKEKDLTLLMSKKYQYHLFH 354
             L +++SLN+IC+EK NRF++V++EK SLE GK+ AL FLKKEK LTLL SK  Q+ +  
Sbjct: 343  RLSQIESLNEICLEKANRFEIVDREKNSLESGKETALEFLKKEKQLTLLKSKLLQFKMLQ 402

Query: 355  NGSKLAKTLSNVSNTMNXXXXXXXXXXXXXXXXXXLTDASEQLANRLVSMNNTNKESLAK 414
            + SKLA TL  +S+                     +    + + +R+ S  +  K    +
Sbjct: 403  SNSKLASTLEKISSLNREFESEKKKFQESLREVDEVKAQHKDIKDRISSSTSREKTLSLE 462

Query: 415  MRQLERELVSNEEKQKSLLQKRSKAEKTLNTVEKSIKQCENKIEEYISQNQEYETSLTTL 474
             R+LE   VS EE+ K+L+ K  KAEK L + + SI + E+  +E   Q  E+E  +  L
Sbjct: 463  KRELEGSRVSLEERTKNLVNKMGKAEKALKSTKHSISESEHMFQELQRQQTEHEKEIKDL 522

Query: 475  NHTIVDAQAELEKMKLALSDKTGDITKEVAVLEKELEPWTNKVEEKKSEIKLVESEISII 534
            N ++ + +  L+ +KL+L DKT DI+ ++   EKE EPW  +++EKKS+I+L ESE+S++
Sbjct: 523  NQSLEEERIILDDIKLSLKDKTKDISAKIIRHEKESEPWDLQLQEKKSQIQLAESELSLL 582

Query: 535  KEADLKLESEIANLSQEIEQLRGNIS--HREESIETLNVESS----SIRDYILVGERECT 588
            +E   KL+     L ++I      IS   R++ ++ L ++ S    S+ D    GER+  
Sbjct: 583  EETRAKLKKNAEALEEKI------ISKKQRKQELQGLVLDLSQRLKSLIDGRSQGERDFR 636

Query: 589  SARSKLEEMKKVLVTHRQRVNDARSAVSSAENKNKVLTALSRLQKSGRIDGYHGRLGDLG 648
            SA  KL+EM+++L  HRQR  +ARS++S A+NKN VLTALS+LQKSGRI+G+HGRLGDLG
Sbjct: 637  SAHLKLKEMQRILNAHRQRAMEARSSLSKAQNKNMVLTALSKLQKSGRINGFHGRLGDLG 696

Query: 649  TIDDKYDIAISTACPRLDDIVVDTVECGQQCIEHLRKNKLGYARFILLDKLRKFNLQPAH 708
             ID+ +D+AISTACPRLDD+VVDTVEC Q CI++LRKNKLGYARFILLD+LRKFNLQP  
Sbjct: 697  VIDNSFDVAISTACPRLDDVVVDTVECAQHCIDYLRKNKLGYARFILLDRLRKFNLQPIS 756

Query: 709  TPENVPRLFDLVKPKEPKFAPAFYSVLRDTLVTTDLSQANRVAYGKKRYRVVTLDGKLID 768
            TPENVPRLFD+VKPK+PKF+ AFYSVL+DTLV  DL QAN+VAYGK+R+RVVT+DGKLID
Sbjct: 757  TPENVPRLFDVVKPKDPKFSNAFYSVLKDTLVARDLKQANKVAYGKRRFRVVTVDGKLID 816

Query: 769  ISGTMTGGGDRAASGLMK-STQQSSL---YTPEEVQRMEEELNEREKNFKVAFETFQEME 824
            ISGTM+GGG+    GLM+  T QS     YTPEEV ++E EL EREKNF+VA +T  EME
Sbjct: 817  ISGTMSGGGNHVMKGLMRLGTNQSDEIEDYTPEEVIKIEHELAEREKNFRVANDTVHEME 876

Query: 825  SALQNYLDRQPEIEVELSKQKMDIETISAELESKIERKLELERSNKTSIEDSSELRTAEE 884
              L+   D++P++E ++S+ +M+ +++++EL    ++  E + +   ++ + +++    +
Sbjct: 877  EELKKVRDQEPDLESQISRAEMEADSLTSELMLAEQQAKEAKMAYDKAVNEKTQVNEVMK 936

Query: 885  KLAALNADLNSFMSASESKNQRIKELRAKIMEIGGLELQTLNSKVDSLNXXXXXXXXXXX 944
             L  L  +     S + +K ++IK L+ +IM+IGG +L T NSKV SL            
Sbjct: 937  NLEHLRGEYEDLQSETRTKKEQIKILQDQIMKIGGTKLHTQNSKVGSLCQRIDILVIKLK 996

Query: 945  XXXXXXXXXELELKRARKQQITAKDDIEHCDIEIQKMKSSYDTISTGMQELQKQLSDLQE 1004
                     E ++ + +KQ    + D E    E++ ++         + E    ++++  
Sbjct: 997  KVKSGIKKSEGDVLKYQKQLKNFEQDEELSSNELKVIEEKLKQTKLALTENDTNMTEISN 1056

Query: 1005 EIGTLTDEHAVTKHELDQKNEKIDSYSSIEIELTEQLQKLQNLANYLKKEMNEYDSKLSH 1064
                L D+    K  L +  E ID + S+EIE+  +L+KL +L  ++K E+ + D +L+ 
Sbjct: 1057 LKSELKDQGEQLKERLTEMEENIDEFKSLEIEMKNKLEKLNSLLIHIKNEIKQQDKELND 1116

Query: 1065 LKLRDLGQVMLDLEENKSLQSFSHSPTPDTKRENIQSSMLETHLASPS--PNERKIS--- 1119
            L +RD+   +  L+ N+           D   + I+    +     PS  P++ KI    
Sbjct: 1117 LSIRDVTHTLQMLDNNQM----------DVVEDGIKDEQ-DADQDKPSGIPDDEKIQEKD 1165

Query: 1120 IAENN-LSMEVDEQASVLENGLPKLPDSELARVDLEDLERDIVQLQDYIDNSTVDIEILD 1178
             A+NN  SM +DE +S +  G+PKL + EL  +D+E LE DI  L  YI+ ++VDI +L+
Sbjct: 1166 DADNNHHSMNIDEMSSEISRGIPKLCEEELKDLDIELLESDISGLTCYINETSVDIGVLE 1225

Query: 1179 EYAKRLAEYRRRRIDLNEAIMKRDETRMHCEVLKKRRLDEFMEGFGIISITLKEMYQMIT 1238
            EY +RL E++RR++DLN+A+ KRDE +   E+LKK R DEFM GF IIS+TLKEMYQMIT
Sbjct: 1226 EYVRRLIEFKRRKLDLNQAVQKRDEVKEQLEILKKNRFDEFMNGFNIISMTLKEMYQMIT 1285

Query: 1239 MGGNAELELVDSLDPFSEGVLFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTP 1298
            MGGNAELELVDSLDPFSEGV FSVMPPKKSWRNI+NLSGGEKTLSSLALVFALHKY+PTP
Sbjct: 1286 MGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYRPTP 1345

Query: 1299 LYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQRLVGIYKNSNMTRS 1358
            LYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQ+L+GIYK  N T+S
Sbjct: 1346 LYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLIGIYKRDNRTKS 1405

Query: 1359 TTLQNRDII 1367
            TT++N DI+
Sbjct: 1406 TTVKNIDIL 1414

>KNAG0G02020 Chr7 (449115..453449) [4335 bp, 1444 aa] {ON} Anc_8.259
            YLR086W
          Length = 1444

 Score = 1283 bits (3319), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 676/1309 (51%), Positives = 914/1309 (69%), Gaps = 25/1309 (1%)

Query: 77   VELIQLSPIKNSRLELQRLYDTKQKKV---ERLCIRTLVLENFKSYAGRQVVGPFHSSFS 133
            +ELIQLSPIKNSRLELQ+LYD    K+    RL I  LVL NFKSYAG Q +GPF +SFS
Sbjct: 137  LELIQLSPIKNSRLELQKLYDAHNAKIGKMNRLYIHKLVLHNFKSYAGEQTIGPFDASFS 196

Query: 134  AVVGPNGSGKSNVIDSMLFAFGFRANKMRQGKLSHLIHKSEKYPDLDFCSVEIQFQYVVD 193
            AVVGPNGSGKSNVIDSMLF FGFRANKMRQ +LS LIHKSE++ +L+FCSVE+ F+YV D
Sbjct: 197  AVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSERFTNLNFCSVEVHFRYVKD 256

Query: 194  E----PDGTTRVLSGKPELSVMRKAFKNNTSKYYLNGKESTYTEVTRLLRDEGIDLDHKR 249
            E     DG T  +  +  L + RKAFKNN+SKY++NGKES +TEVT+LL+++GIDLDHKR
Sbjct: 257  EYTAPTDGDT--MEAENTLVITRKAFKNNSSKYFINGKESNFTEVTKLLKEQGIDLDHKR 314

Query: 250  FLILQGEVESIAQMKPKAEHEGDDGLLEYLEDIIGTTKYKAQIEQALVEVDSLNDICMEK 309
            FLILQGEVE+IAQMK KAE + +DGLLEYLEDIIGT  YK  IEQ  VE++++N++C+EK
Sbjct: 315  FLILQGEVENIAQMKAKAEKDNEDGLLEYLEDIIGTKHYKPLIEQKTVEIEAMNELCIEK 374

Query: 310  ENRFDLVEKEKLSLEPGKDEALAFLKKEKDLTLLMSKKYQYHLFHNGSKLAKTLSNVSNT 369
            ENRF +V+ EK SLE  KD AL FL+KEK LTLL SK  QYHL+ N  K+  TL  + + 
Sbjct: 375  ENRFRIVDDEKNSLEKDKDAALEFLEKEKQLTLLKSKLTQYHLYVNNDKIKTTLGQIDSL 434

Query: 370  MNXXXXXXXXXXXXXXXXXXLTDASEQLANRLVSMNNTNKESLAKMRQLERELVSNEEKQ 429
                                L ++ ++  N L S+    K  + + R++  + VS EE  
Sbjct: 435  RTDFEQEKQRHSQFMKEVETLQNSIDESKNNLTSLTTEEKSLIQRKREINTQSVSLEETT 494

Query: 430  KSLLQKRSKAEKTLNTVEKSIKQCENKIEEYISQNQEYETSLTTLNHTIVDAQAELEKMK 489
            K+L QK  KA+ T+ + +  I + E++++E     +EYE  +  L+      +  L  +K
Sbjct: 495  KNLDQKLKKAKATVESSKSLISKNEHELQEQSQLQEEYEAEVNDLSKQREVEEKILLDIK 554

Query: 490  LALSDKTGDITKEVAVLEKELEPWTNKVEEKKSEIKLVESEISIIKEADLKLESEIANLS 549
            L L DKT   + E+A +EKELEP   +++EKKS+IKLVE EI +I+++  K+ +EI +L 
Sbjct: 555  LQLKDKTVTFSDEIASIEKELEPSNTEIQEKKSQIKLVEMEIDLIRDSKRKVGAEIESLK 614

Query: 550  QEIEQLRGNISHREESIETLNVESSSIRDYILVGERECTSARSKLEEMKKVLVTHRQRVN 609
            +E+ +L+ ++   E+ +  LN    ++      G++EC  A  KL EMK +L +HRQ+  
Sbjct: 615  EELLKLQKDLEDNEKDVTDLNKSKRNLVKEKQEGDKECKDAGVKLNEMKAILNSHRQKTM 674

Query: 610  DARSAVSSAENKNKVLTALSRLQKSGRIDGYHGRLGDLGTIDDKYDIAISTACPRLDDIV 669
            +ARS VS+A+NKNKVLT+L R+Q+SGRI+G+HGRLGDLG I D+YD+AISTACPRLDD+V
Sbjct: 675  EARSTVSTAQNKNKVLTSLMRMQQSGRINGFHGRLGDLGIIADQYDVAISTACPRLDDMV 734

Query: 670  VDTVECGQQCIEHLRKNKLGYARFILLDKLRKFNLQPAHTPENVPRLFDLVKPKEPKFAP 729
            V++VECGQ CIE LRKNKLGYARF++LDKL++F++ P  TPENVPRLFDLVKPKE +FAP
Sbjct: 735  VESVECGQTCIEFLRKNKLGYARFVVLDKLKRFDMSPIQTPENVPRLFDLVKPKEKRFAP 794

Query: 730  AFYSVLRDTLVTTDLSQANRVAYGKKRYRVVTLDGKLIDISGTMTGGGDRAASGLMKSTQ 789
            A YSVLRDTLV  DL QANRVAYGK+R+RVVTLDG+LIDISGTM+GGG R   GLM  T 
Sbjct: 795  AIYSVLRDTLVAKDLKQANRVAYGKRRFRVVTLDGQLIDISGTMSGGGSRVFKGLMNLTT 854

Query: 790  Q----SSLYTPEEVQRMEEELNEREKNFKVAFETFQEMESALQNYLDRQPEIEVELSKQK 845
            +    S +++ E+++++E EL  REK F VA ETF  ME  L+   DR+P++E+E+SK+ 
Sbjct: 855  KVSGTSEIFSLEDMKKLEMELAAREKQFDVASETFHSMEQELRKLCDREPQLELEISKKL 914

Query: 846  MDIETISAELESKIERKLELERSN--KTSIEDSSELRTAEEKLAALNADLNSFMSASESK 903
            +DI+ ++ +++  + R    E+SN  + SI+D+ +L      L ALN +L      S++ 
Sbjct: 915  IDIDALTQQIQ--LTRSQLTEKSNDYEKSIKDTDDLDLLLGNLEALNQELKYLQDQSKTS 972

Query: 904  NQRIKELRAKIMEIGGLELQTLNSKVDSLNXXXXXXXXXXXXXXXXXXXXELELKRARKQ 963
            ++R+  L+ +IM IGG ELQ  NSKV SLN                      ELK+ARK 
Sbjct: 973  SERVSFLKDEIMRIGGSELQLQNSKVSSLNQRIDILQAKLKKSKTVVKKLNTELKKARKS 1032

Query: 964  QITAKDDIEHCDIEIQKMKSSYDTISTGMQELQKQLSDLQEEIGTLTDEHAVTKHELDQK 1023
             I + ++  +   EI   K+  +     + ++ K L  +Q+E   L  E      +L + 
Sbjct: 1033 LIASTEESTNSTEEIAHAKARAEVAKNSLLDINKSLESIQDEKINLEQELENFSDKLHES 1092

Query: 1024 NEKIDSYSSIEIELTEQLQKLQNLANYLKKEMNEYDSKLSHLKLRDLGQVMLDLEENKSL 1083
            NE ++ + +I++EL  ++++  ++ +YLKKE  +   +L++ +LRD+   +  L E +  
Sbjct: 1093 NENVNEFKTIQLELENKIERANSILSYLKKENGQLLEELNNFRLRDVTHTLDLLREEEGT 1152

Query: 1084 QSFSHSPT--PDTKRENIQSSMLETHLA-----SPSPNERKISIAENNLSMEVDEQASVL 1136
            ++ +  PT   D    N+ + ML    A     + S     + +A + +SM+VD+   ++
Sbjct: 1153 EA-NQQPTTGTDETTSNVDNEMLGAADAGVENMNTSSLSNSVKVASDEISMDVDDCGDLV 1211

Query: 1137 ENGLPKLPDSELARVDLEDLERDIVQLQDYIDNSTVDIEILDEYAKRLAEYRRRRIDLNE 1196
              G+P+L D EL+ +D ++L  +I QLQ +I+N +++IEIL+EYAKRL E+++R+IDLN 
Sbjct: 1212 SQGIPRLSDKELSTIDTDNLNEEINQLQSFINNVSINIEILEEYAKRLVEFKKRKIDLNN 1271

Query: 1197 AIMKRDETRMHCEVLKKRRLDEFMEGFGIISITLKEMYQMITMGGNAELELVDSLDPFSE 1256
            ++ +R++     E LKK+R +EFMEGF IIS+TLKEMYQMITMGGNAELELVDSLDPFSE
Sbjct: 1272 SVGERNQLTSIMEELKKKRYNEFMEGFSIISMTLKEMYQMITMGGNAELELVDSLDPFSE 1331

Query: 1257 GVLFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSI 1316
            GV FSVMPPKKSWRNI+NLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSI
Sbjct: 1332 GVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSI 1391

Query: 1317 VANYIKERTKNAQFIVISLRNNMFELAQRLVGIYKNSNMTRSTTLQNRD 1365
            VANYIKERTKNAQFIVISLRNNMFELA++LVGIYK+ NMT++ T++NR+
Sbjct: 1392 VANYIKERTKNAQFIVISLRNNMFELAKQLVGIYKHENMTKNATIRNRE 1440

>NDAI0B01970 Chr2 (479208..483455) [4248 bp, 1415 aa] {ON} Anc_8.259
            YLR086W
          Length = 1415

 Score = 1267 bits (3278), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 693/1380 (50%), Positives = 948/1380 (68%), Gaps = 53/1380 (3%)

Query: 14   TPVKLLATSPDRKNVVSRGSSVSTTMGLRGPSLQPPVAHQIXXXXXXXXXXXXXXXXXXX 73
            TP KL+    D +   S+ +  +++  L+ PSLQPP                        
Sbjct: 57   TPRKLILHQSDNRYAFSQPTVSASS--LQVPSLQPPETSSSSSRGRRDIKVYSQSPPRSP 114

Query: 74   XXA----VELIQLSPIKNSRL-ELQRLYDTKQKKVERLCIRTLVLENFKSYAGRQVVGPF 128
              +    +ELIQLSP+KN+R+ +LQ LY+++ KK ERL I  LVL NFKSYAG QV+GPF
Sbjct: 115  GRSPTRKLELIQLSPVKNNRIRKLQELYNSQIKK-ERLFINKLVLNNFKSYAGEQVIGPF 173

Query: 129  HSSFSAVVGPNGSGKSNVIDSMLFAFGFRANKMRQGKLSHLIHKSEKYPDLDFCSVEIQF 188
            +++FSAVVGPNGSGKSNVIDSMLF FGFRANKMRQ +LS LIHKSE +P+L  CSV+++F
Sbjct: 174  NTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSESFPNLPSCSVDVEF 233

Query: 189  QYVVDEPDGTTRVLSGKPELSVMRKAFKNNTSKYYLNGKESTYTEVTRLLRDEGIDLDHK 248
            QYVVD+ +G++++   KP+L + RKAFKNN+SKY++NGKES+YTEVT+LL++EGIDLDHK
Sbjct: 234  QYVVDKSNGSSKIDDNKPKLIITRKAFKNNSSKYFINGKESSYTEVTKLLKEEGIDLDHK 293

Query: 249  RFLILQGEVESIAQMKPKAEHEGDDGLLEYLEDIIGTTKYKAQIEQALVEVDSLNDICME 308
            RFLILQGEVE+IAQMKPKAE EGDDGLLEYLEDIIGT  YK+ IE+  +EVD+LN+IC+E
Sbjct: 294  RFLILQGEVENIAQMKPKAEREGDDGLLEYLEDIIGTADYKSSIEKNTIEVDTLNEICIE 353

Query: 309  KENRFDLVEKEKLSLEPGKDEALAFLKKEKDLTLLMSKKYQYHLFHNGSKLAKTLSNVSN 368
            KENRF++VE+EK SLE  K+ AL F+KKE+ LTL  SK  QY++     KLA TL  +S 
Sbjct: 354  KENRFEIVEREKNSLESSKNAALEFVKKERRLTLSKSKLLQYNILKEHEKLASTLQKLSV 413

Query: 369  TMNXXXXXXXXXXXXXXXXXXLTDASEQLANRLVSMNNTNKESLAKMRQLERELVSNEEK 428
                                 L D  +Q+  ++VS+    K + +K R+L+ +  S EEK
Sbjct: 414  LQEEYQNESTKFENTQRETNKLEDNFKQMNKKIVSIKEDMKNNTSKKRELQNKKASLEEK 473

Query: 429  QKSLLQKRSKAEKTLNTVEKSIKQCENKIEEYISQNQEYETSLTTLNHTIVDAQAELEKM 488
             KS  +K+ KA K++   +K +K   N+IE      QE E++L +L   +   +  LE++
Sbjct: 474  IKSYTRKKEKASKSIAQSKKLLKNYRNEIETLNVDQQERESNLQSLLSELKKEKNVLEEI 533

Query: 489  KLALSDKTGDITKEVAVLEKELEPWTNKVEEKKSEIKLVESEISIIKEADLKLESEIANL 548
            KL+L DKT DI+ E+A  E+ELEPW  +++EKK EI++ ES+IS+++E   KL+ EI  L
Sbjct: 534  KLSLKDKTTDISNEIAQHERELEPWKKQLQEKKLEIQVAESQISLLQENQSKLKDEIEKL 593

Query: 549  SQEIEQLRGNISHREESIETLNVESSSIRDYILVGERECTSARSKLEEMKKVLVTHRQRV 608
              +++    N  ++EE +  L V+ S+I      GE EC +A+SK+++M+ VL T RQ+V
Sbjct: 594  KNDLKCQFENKKNQEEKLIDLKVQFSAISTEFDRGESECANAKSKIKDMQHVLQTQRQKV 653

Query: 609  NDARSAVSSAENKNKVLTALSRLQKSGRIDGYHGRLGDLGTIDDKYDIAISTACPRLDDI 668
             DARS +++ ENK+KVL+AL +LQKSGRI G++GRLGDLG ID++YDIAISTA  RLDDI
Sbjct: 654  MDARSRLATVENKSKVLSALHKLQKSGRISGFYGRLGDLGVIDNEYDIAISTASARLDDI 713

Query: 669  VVDTVECGQQCIEHLRKNKLGYARFILLDKLRKFNLQPAHTPENVPRLFDLVKPKEPKFA 728
            VVD+VECGQ CIE+LRKNKLGYARFILL+KLR   L+   TPENV RLFDLVKP +  F 
Sbjct: 714  VVDSVECGQHCIEYLRKNKLGYARFILLEKLRNLILKRIQTPENVKRLFDLVKPDKDIFI 773

Query: 729  PAFYSVLRDTLVTTDLSQANRVAYGKKRYRVVTLDGKLIDISGTMTGGGDRAASGLMKST 788
            PAFYSVLR+TLV  DL QANRVAYG  R+RVVT+DGKLIDISGT+TGGG + A GLMK  
Sbjct: 774  PAFYSVLRNTLVAKDLKQANRVAYGATRFRVVTMDGKLIDISGTITGGGKQTAQGLMKLR 833

Query: 789  QQSS----LYTPEEVQRMEEELNEREKNFKVAFETFQEMESALQNYLDRQPEIEVELSKQ 844
            ++      +Y+ ++++++E+EL ERE NFK A +T+ EME ALQ   DR+PE+E+E+SK 
Sbjct: 834  KKGQENIDIYSNDDIEKIEKELVERENNFKFANDTYFEMEQALQRLKDRKPELELEISKC 893

Query: 845  KMDIETISAELES---KIERKLEL-ERSNKTSIEDSSELRTAEEKLAALNADLNSFMSAS 900
             MD +  S ELES   ++++K+   ER      ++  E+   E +L  L  +    + ++
Sbjct: 894  LMDTDISSKELESTQDQLKQKITFYERHT----QNKDEVVEIEHQLNLLQKEYQLLLDST 949

Query: 901  ESKNQRIKELRAKIMEIGGLELQTLNSKVDSLNXXXXXXXXXXXXXXXXXXXXELELKRA 960
            ++ +++I +L+ +IMEIGG++LQ  NSKV+S+                     E E++R+
Sbjct: 950  KNISEKIDKLKKRIMEIGGIDLQMQNSKVNSIIQNIDIIKSKQKRGISSMKKIENEIRRS 1009

Query: 961  RKQQITAKDDIEHCDIEIQKMKSSYDTISTGMQELQKQLSDLQEEIGTLTDEHAVTKHEL 1020
             K    A+ D + C  E+       D+ S  M+ +++ L  + E    L +E++  + E 
Sbjct: 1010 EKALSGAELDFKTCSKEM-------DSFSQEMESVERSLGSIDETFLKLENENSELEIEC 1062

Query: 1021 DQKNEKID-------SYSSIEIELTEQLQKLQNLANYLKKEMNEYDSKLSHLKLRDLGQV 1073
                EKI+        + S EI++ ++L+KL NL  ++K+ + EYD +L  L+LR+   +
Sbjct: 1063 CNLKEKINEAEIEGTKFKSYEIDVKDRLEKLNNLLKHIKRVIKEYDEQLRALELRNTTTI 1122

Query: 1074 MLDLEENKSLQSF---SHS---PTPDTKRENIQSSMLETHLASPSPNERKISIAENNLSM 1127
              D  +N S+      SH    P  D  +   +++M          NE+  + AE    M
Sbjct: 1123 FGDEGDNNSINGVDRTSHGGGVPLQDQNKVVRENNM---------RNEKNSTEAE----M 1169

Query: 1128 EVDEQASVLENGLPKLPDSELARVDLEDLERDIVQLQDYIDNSTVDIEILDEYAKRLAEY 1187
            E+D+ A     G+P++  ++L ++D++ LE +I QL++Y+  + V+I++L+EYA+RLA+Y
Sbjct: 1170 EIDDVADEFSPGIPRISKAKLLQIDVQALEAEIGQLEEYVAITNVNIDVLEEYARRLADY 1229

Query: 1188 RRRRIDLNEAIMKRDETRMHCEVLKKRRLDEFMEGFGIISITLKEMYQMITMGGNAELEL 1247
              R++DLN+A+ +R+  +   + LKK+R DEFM+GFGIIS+TLKEMYQMITMGGNAELEL
Sbjct: 1230 NSRKLDLNQAVERREALKKLLDELKKKRYDEFMQGFGIISMTLKEMYQMITMGGNAELEL 1289

Query: 1248 VDSLDPFSEGVLFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDA 1307
            +DSLDPFSEGV FSVMPPKKSWRNI+NLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDA
Sbjct: 1290 IDSLDPFSEGVTFSVMPPKKSWRNIANLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDA 1349

Query: 1308 ALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQRLVGIYKNSNMTRSTTLQNRDII 1367
            ALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQ+L+GIYK  N T+S  ++N+D +
Sbjct: 1350 ALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLIGIYKRDNKTKSAAIRNKDFL 1409

>KLLA0F19085g Chr6 (1758111..1762229) [4119 bp, 1372 aa] {ON} similar
            to uniprot|Q12267 Saccharomyces cerevisiae YLR086W SMC4
            subunit of the condensin complex which reorganizes
            chromosomes during cell division
          Length = 1372

 Score = 1254 bits (3244), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 704/1387 (50%), Positives = 936/1387 (67%), Gaps = 48/1387 (3%)

Query: 2    DIPTPKKPRI----LDTPVKLLATSPDRKNVVSRG---SSVSTTMGLRGPSLQPPVAHQI 54
            D P  K+ R+      TP KL+  SP++K  VS     ++ S TM    PSLQPP AH +
Sbjct: 12   DSPEIKRQRVSQSPTRTPRKLVLGSPEKKYAVSNSQATTAASNTMD--PPSLQPPTAHAV 69

Query: 55   XXXXXXXX--XXXXXXXXXXXXXAVELIQLSPIKNSRLELQRLYDTKQKKVERLCIRTLV 112
                                    +ELI+LSP K++RLELQ++++   +  +RLCI  LV
Sbjct: 70   RGREYSQSPPRSPTRSPTRSPTRKLELIRLSPKKSTRLELQKMHEANTQTSQRLCIDKLV 129

Query: 113  LENFKSYAGRQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFAFGFRANKMRQGKLSHLIHK 172
            L NFKSYAG Q +GPFH+SFSAVVGPNGSGKSNVIDSMLF FGFRANKMRQGKLS LIHK
Sbjct: 130  LNNFKSYAGIQEIGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLSELIHK 189

Query: 173  SEKYPDLDFCSVEIQFQYVVDEPDGTTRVLSGKPELSVMRKAFKNNTSKYYLNGKESTYT 232
            SE++P L  CSV+I F YV D  +G T++L     + V R+AFKNN+SKYY+NGKES YT
Sbjct: 190  SEQFPSLASCSVQIHFHYVHDTDNGETKILPSAGTMVVERRAFKNNSSKYYVNGKESNYT 249

Query: 233  EVTRLLRDEGIDLDHKRFLILQGEVESIAQMKPKAEHEGDDGLLEYLEDIIGTTKYKAQI 292
            EVTRLL++EGIDLDHKRFLILQGEVESIAQMK KAE + DDGLLEYLEDIIGT K+K QI
Sbjct: 250  EVTRLLKEEGIDLDHKRFLILQGEVESIAQMKAKAEKDNDDGLLEYLEDIIGTAKFKPQI 309

Query: 293  EQALVEVDSLNDICMEKENRFDLVEKEKLSLEPGKDEALAFLKKEKDLTLLMSKKYQYHL 352
            E+ L E+++LN++CMEKENRF+LV+KEK +LE GK+EAL FL KE+  T+L ++  Q  +
Sbjct: 310  EKCLEEIETLNEVCMEKENRFELVDKEKQNLESGKEEALEFLDKERKHTILKAQLLQRQI 369

Query: 353  FHNGSKLAKTLSNVSNTMNXXXXXXXXXXXXXXXXXXLTDASEQLANRLVSMNNTNKESL 412
            + +  KLA +   +S  +N                  L   +E L + +   NNT KES 
Sbjct: 370  YDSNRKLATSCDKIS-ALNMEFQEEKSQYEH------LQKEAETLTHEI---NNTKKEST 419

Query: 413  A----------KMRQLERELVSNEEKQKSLLQKRSKAEKTLNTVEKSIKQCENKIEEYIS 462
            A          K R LE++ ++ +EK KS+ +K   AEK  +  E + K   N+IE    
Sbjct: 420  ALETESKNVNSKKRSLEKDFIATDEKLKSIARKLKAAEKAFSQSESNGKAAVNEIESLKK 479

Query: 463  QNQEYETSLTTLNHTIVDAQAELEKMKLALSDKTGDITKEVAVLEKELEPWTNKVEEKKS 522
             + + E  L  LNH+I   + +L ++K+ L +KT D+++E+  LE++LEP+ ++++EK+S
Sbjct: 480  NHDDCEIELHNLNHSISIEKEKLNEIKIHLHEKTKDLSQEMESLERQLEPFRDQIQEKQS 539

Query: 523  EIKLVESEISIIKEADLKLESEIANLSQEIEQLRGNISHREESIETLNVESSSIRDYILV 582
            EIKL E++I+++K +   L  E A +  +IE L+     ++E+  +L  E S +   I  
Sbjct: 540  EIKLSETKITMLKSSHSNLLKEKATIESKIEDLQLEELKQKETETSLRNEKSKVEARIST 599

Query: 583  GERECTSARSKLEEMKKVLVTHRQRVNDARSAVSSAENKNKVLTALSRLQKSGRIDGYHG 642
             ++EC  A+ +  EM+ VL+  RQ V +A++ ++  +NKN+VL AL++LQ SGRI G+HG
Sbjct: 600  AQKECEEAQKQTNEMRDVLIQQRQIVEEAKANLNGFQNKNRVLLALTKLQNSGRITGFHG 659

Query: 643  RLGDLGTIDDKYDIAISTACPRLDDIVVDTVECGQQCIEHLRKNKLGYARFILLDKLRKF 702
            RLGDLGTIDD+YDIAISTACPRLDDIVV+TVECGQQCI+HLRKNKLGY RFILLDKLRK 
Sbjct: 660  RLGDLGTIDDQYDIAISTACPRLDDIVVETVECGQQCIDHLRKNKLGYGRFILLDKLRKC 719

Query: 703  NLQPAHTPENVPRLFDLVKPKEPKFAPAFYSVLRDTLVTTDLSQANRVAYGKKRYRVVTL 762
            NL    TPENVPRLFDL+ P    F PAFYSVLRDTLV  DL QANRVAYGK+R+RVVTL
Sbjct: 720  NLDRIATPENVPRLFDLITPVRDLFRPAFYSVLRDTLVARDLQQANRVAYGKRRFRVVTL 779

Query: 763  DGKLIDISGTMTGGGDRAASGLMKS-TQQSSLYTPEEVQRMEEELNEREKNFKVAFETFQ 821
            DGKLIDISGTM+GGG    SGLM+S    +S Y+ +EV++ME +L+ +E N++ A     
Sbjct: 780  DGKLIDISGTMSGGGSSPQSGLMRSKATTASQYSRDEVEKMEVQLSTKETNYRSALSMVH 839

Query: 822  EMESALQNYLDRQPEIEVELSKQKMDIETISAELESKIERKLELERSNKTSIEDSSELRT 881
            EMESALQ   DR PEI++++SK +++  +  AE+ES  +R  +L R    + ++   L  
Sbjct: 840  EMESALQKLTDRLPEIDIQISKIQLEKGSRVAEVESYHQRLSQLARELSMNEKNQQPLLD 899

Query: 882  AEEKLAALNADLNSFMSASESKNQRIKELRAKIMEIGGLELQTLNSKVDSLNXXXXXXXX 941
             E+KL  L   L   + AS+    +I +L+ +IM+ GG+EL+   +KV SL         
Sbjct: 900  EEKKLDILRQHLQQTIDASKFSQDKIDDLKDRIMQKGGIELKMQIAKVASLEQHIEILHE 959

Query: 942  XXXXXXXXXXXXELELKRARKQQITAKDDIEHCDIEIQKMKSSYDTISTGMQELQKQLSD 1001
                        +++L RA +++    +++  C+ +I  +    ++I    + +++Q+ +
Sbjct: 960  KQKKEKTRSKKLDIDLARATREKNKYSEEVLVCNKDISILSEQLESIRLEKERIEEQVIE 1019

Query: 1002 LQEEIGTLTDEHAVTKHELDQKNEKIDSYSSIEIELTEQLQKLQNLANYLKKEMNEYDSK 1061
              E    L       K EL       + + + E+E +++L+KL  L  Y+KK++  Y++ 
Sbjct: 1020 NNERKAELNSSVEKLKQELLSIERDSNEFKAKELEYSDRLEKLHGLQEYVKKQLRSYETS 1079

Query: 1062 LSHLKLRDLGQVMLDLEENKSLQSFSHSPTPDTKRENIQSSMLETHLASPSPNERKISIA 1121
            L  LK+RD+ +++  L +         S T D   + +   +++T         + I+  
Sbjct: 1080 LQSLKIRDVSKLLSQLND-----GIIESCT-DVTAKVMNGDIVQT---------QSITDV 1124

Query: 1122 ENNLSMEVDEQASVLENGLPKLPDSELARVDLEDLERDIVQLQDYIDNSTVDIEILDEYA 1181
             NN +ME D   +   +GLP L ++EL  +DLE LE ++ QLQDY+DN   DIE+L+EYA
Sbjct: 1125 GNNDAME-DSGEAATHSGLPSLTETELENLDLETLELELHQLQDYLDNFNGDIEVLEEYA 1183

Query: 1182 KRLAEYRRRRIDLNEAIMKRDETRMHCEVLKKRRLDEFMEGFGIISITLKEMYQMITMGG 1241
            +RLAEY+RR++DLN+A+ KR+E R  CE  K  RL++FMEGFGIIS+TLKEMYQMITMGG
Sbjct: 1184 RRLAEYQRRKLDLNQAVAKREEVRNKCESFKNERLEKFMEGFGIISMTLKEMYQMITMGG 1243

Query: 1242 NAELELVDSLDPFSEGVLFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYV 1301
            NAELELVDSLDPFSEGVLFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYV
Sbjct: 1244 NAELELVDSLDPFSEGVLFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYV 1303

Query: 1302 MDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQRLVGIYKNSNMTRSTTL 1361
            MDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQ LVGIYKN+NMT+STTL
Sbjct: 1304 MDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQNLVGIYKNNNMTKSTTL 1363

Query: 1362 QNRDIIN 1368
            QN DI++
Sbjct: 1364 QNIDILH 1370

>TBLA0E04410 Chr5 (1122005..1126273) [4269 bp, 1422 aa] {ON} Anc_8.259
            YLR086W
          Length = 1422

 Score = 1234 bits (3194), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 677/1373 (49%), Positives = 929/1373 (67%), Gaps = 41/1373 (2%)

Query: 14   TPVKLLATSPDRKNVVSRG---SSVSTTMGLRGPSLQPPVAHQIXXXXXXXXXXXXXXXX 70
            TP KL+ +S D +  +S+    S+ S T  L+ PS+     H+                 
Sbjct: 70   TPRKLIVSSADHRFTMSQPNLLSADSQTPSLQHPSVSTGREHKFYSQSPPRSPHRSPVRS 129

Query: 71   XXXXXAVELIQLSPIKNSRLELQRLYDTKQ--KKVERLCIRTLVLENFKSYAGRQVVGPF 128
                 A+ELIQLSPIKN+R ELQ++Y+ +Q  K+  RL I  LVL NFKSYAGRQVVGPF
Sbjct: 130  PKK--ALELIQLSPIKNNRAELQKMYELQQTQKRTIRLVIERLVLTNFKSYAGRQVVGPF 187

Query: 129  HSSFSAVVGPNGSGKSNVIDSMLFAFGFRANKMRQGKLSHLIHKSEKYPDLDFCSVEIQF 188
            H++FSAVVGPNGSGKSNVIDSMLF FGFRANKMRQGKL  LIHKSEKYP+L  CSVEI F
Sbjct: 188  HTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLKDLIHKSEKYPELSSCSVEIHF 247

Query: 189  QYVVDEPDG-TTRVLSGKPELSVMRKAFKNNTSKYYLNGKESTYTEVTRLLRDEGIDLDH 247
            QYV+D+P+G  +++   K +L VMRKAFKNN+SKYY+N KES++T+VT LL++EGIDLDH
Sbjct: 248  QYVIDDPNGGPSKIDESKEKLVVMRKAFKNNSSKYYINDKESSFTQVTTLLKNEGIDLDH 307

Query: 248  KRFLILQGEVESIAQMKPKAEHEGDDGLLEYLEDIIGTTKYKAQIEQALVEVDSLNDICM 307
            KRFLILQGEVE+IAQMKPK+E EGDDGLLEYLEDIIGT+ YK QIE  L +V++LN+IC+
Sbjct: 308  KRFLILQGEVENIAQMKPKSEKEGDDGLLEYLEDIIGTSHYKVQIEHNLSKVEALNEICI 367

Query: 308  EKENRFDLVEKEKLSLEPGKDEALAFLKKEKDLTLLMSKKYQYHLFHNGSKLAKTLSNVS 367
            EKENRF++VEKEK SL  GK+EAL +L  EK+L L  SKKYQ+ L+ +  KL  TL+ ++
Sbjct: 368  EKENRFNIVEKEKDSLVDGKNEALKYLANEKNLVLAKSKKYQHQLYIDNKKLTSTLAKIT 427

Query: 368  NTMNXXXXXXXXXXXXXXXXXXLTDASEQLANRLVSMNNTNKESLAKMRQLERELVSNEE 427
            +                     L D    L  RL       ++ L+  R+   EL+S +E
Sbjct: 428  DAQENYDKELEKYSTISKELKNLQDEEITLNKRLNETKKYEEKLLSNQRKNNSELISTQE 487

Query: 428  KQKSLLQKRSKAEKTLNTVEKSIKQCENKIEEYISQNQEYETSLTTLNHTIVDAQAELEK 487
              K++ +K+  AEK +NT EKSI Q  NK+E   +Q ++Y   +  LN  +   +++LE+
Sbjct: 488  MIKNIEKKKDNAEKLVNTTEKSITQTNNKLETLNNQQEDYTKQIEELNEKLKIEKSKLEE 547

Query: 488  MKLALSDKTGDITKEVAVLEKELEPWTNKVEEKKSEIKLVESEISIIKEADLKLESEIAN 547
            +K++L  KT   + E+   EKELEP+  +++EK S+I+L++SEIS++ E    L +EI +
Sbjct: 548  IKISLKGKTEQFSNEILKNEKELEPYQIQLQEKMSQIQLLQSEISLLNENKDNLSNEIIS 607

Query: 548  LSQEIEQLRGNISHREESIETLNVESSSIRDYILVGERECTSARSKLEEMKKVLVTHRQR 607
            + + IE+ + ++    E I     +    R  +  G+ E      K++EM+  L +HRQ+
Sbjct: 608  IKKLIEEKKLSVVRMSEKITGWKQQLLEQRKEVESGDIEFNKFTKKIQEMRDKLDSHRQK 667

Query: 608  VNDARSAVSSAENKNKVLTALSRLQKSGRIDGYHGRLGDLGTIDDKYDIAISTACPRLDD 667
             ND+R+++S+ +NKN VLTAL +LQKSGRI G++GRLGDLG ID+KYD+AISTACPRL+D
Sbjct: 668  ANDSRTSLSNVQNKNSVLTALFKLQKSGRISGFYGRLGDLGVIDEKYDVAISTACPRLED 727

Query: 668  IVVDTVECGQQCIEHLRKNKLGYARFILLDKLRKFNLQPAHTPENVPRLFDLVKPKEPKF 727
            +VVD+V+CGQQCI++LRKN+LGYARFILLDKLRKFNL    TP+N PRLFDL++ +E KF
Sbjct: 728  LVVDSVDCGQQCIDYLRKNRLGYARFILLDKLRKFNLNRIETPDNAPRLFDLIQVREDKF 787

Query: 728  APAFYSVLRDTLVTTDLSQANRVAYGKKRYRVVTLDGKLIDISGTMTGGGDRAASGLMKS 787
             PAFYSVLRDTLV T+L  AN+VAYGK+R+RVVTLDGKLIDISGTM+GGG+    GLMK 
Sbjct: 788  LPAFYSVLRDTLVATNLLHANKVAYGKRRFRVVTLDGKLIDISGTMSGGGNYVLRGLMKL 847

Query: 788  TQ--------QSSLYTPEEVQRMEEELNEREKNFKVAFETFQEMESALQNYLDRQPEIEV 839
             Q        Q+S   PEEVQ++E EL   EKNFKVA+ + +EM   + +  ++ P  E+
Sbjct: 848  GQDLPENDFEQTS---PEEVQKLERELEILEKNFKVAYNSLKEMNQEILHMKEQIPATEL 904

Query: 840  ELSKQKMDIETISAELESKIERKLELERSNKTSIEDSSELRTAEEKLAALNADLNSFMSA 899
             +SK  ++IE    E++  I +  E +  +     ++ E++ A++KL AL  +  S    
Sbjct: 905  NISKTTIEIEYCENEIKQLISQLKEKQEIHDQESNNNDEIKVADDKLQALKKEYYSLNDQ 964

Query: 900  SESKNQRIKELRAKIMEIGGLELQTLNSKVDSLNXXXXXXXXXXXXXXXXXXXXELELKR 959
            ++   Q I++LR +IM+ GG+EL+  NSKV SL                        LK+
Sbjct: 965  TKVTKQEIEKLRQQIMDAGGIELKMQNSKVTSLVNQLKIVNSKQKNDKSAIKKNNNILKK 1024

Query: 960  ARKQQITAKDDIEHCDIEIQKMKSSYDTISTGMQELQKQLSDLQ---EEIGTLTDEHAVT 1016
             + +  T KD+       ++  K     +S  + +L+  ++D Q   EEI    D +   
Sbjct: 1025 LQNELNTTKDNSLEFKTNLENSKKKVTLLSEELAKLESDINDTQNAKEEILLNIDGNKEK 1084

Query: 1017 KHELDQKNEKIDSYSSIEIELTEQLQKLQNLANYLKKEMNEYDSKLSHLKLRDLGQVMLD 1076
              EL++ +    ++ S E+E+  +L KL++L+++L+K++ + D++L+ L +R++ Q +  
Sbjct: 1085 AQELEEDSR---NFKSFELEIKNKLDKLKDLSHHLEKQIGKLDTELNALTIREISQNLES 1141

Query: 1077 LEENKSLQSFSHSPTPDTKRENIQSSMLETHLASPSPNERKISIAE-NNLSMEVDEQASV 1135
             +E   L+ +  S    T+     SS L              S++  N  +M++D   + 
Sbjct: 1142 FDE--RLEKYDISKNGATEDTQHTSSALN-------------SVSNINTDTMDIDSTDNE 1186

Query: 1136 LENGLPKLPDSELARVDLEDLERDIVQLQDYIDNSTVDIEILDEYAKRLAEYRRRRIDLN 1195
            +  G+ +L + E+  +D+E L+ +I  L++ +++ST +IEIL+EY +RL+EY++R+ DL+
Sbjct: 1187 INPGIKRLSELEINELDIESLDAEIENLEEQLEHSTANIEILEEYVRRLSEYKKRKSDLD 1246

Query: 1196 EAIMKRDETRMHCEVLKKRRLDEFMEGFGIISITLKEMYQMITMGGNAELELVDSLDPFS 1255
            E+I +++  +   EVLKK+RL+EF  GF IIS+TLKEMYQMITMGGNAELELVDSLDPFS
Sbjct: 1247 ESISEKETAKEETEVLKKKRLEEFTTGFDIISLTLKEMYQMITMGGNAELELVDSLDPFS 1306

Query: 1256 EGVLFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVS 1315
            EGV FSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVS
Sbjct: 1307 EGVTFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVS 1366

Query: 1316 IVANYIKERTKNAQFIVISLRNNMFELAQRLVGIYKNSNMTRSTTLQNRDIIN 1368
            IVANYIKERTK+AQ IVISLRNNMFEL+++LVGIYK+ NMT+S TL N D++N
Sbjct: 1367 IVANYIKERTKDAQLIVISLRNNMFELSKQLVGIYKSENMTQSATLVNNDMLN 1419

>TPHA0J00720 Chr10 (161017..165198) [4182 bp, 1393 aa] {ON} Anc_8.259
            YLR086W
          Length = 1393

 Score = 1204 bits (3115), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 662/1365 (48%), Positives = 910/1365 (66%), Gaps = 33/1365 (2%)

Query: 14   TPVKLLATSPDRKNVVSRGSSVSTTMGLRGPSLQPPVA----HQIXXXXXXXXXXXXXXX 69
            TP+K++  S +  N +S   S   +   + PSLQ P +      +               
Sbjct: 48   TPMKVI-ISNNHSNSISPLPSQLMSSSTQPPSLQHPSSSSRGRAVKAYSQSPPRSPDRSP 106

Query: 70   XXXXXXAVELIQLSPIKNSRLELQRLYDTKQK-KVERLCIRTLVLENFKSYAGRQVVGPF 128
                   +ELIQLSPIKNSR ELQ++Y +KQ+ K+ER+C+  LVL NFKSYAG Q +GPF
Sbjct: 107  VRSPTRKLELIQLSPIKNSRSELQKIYSSKQEEKIERICLNKLVLHNFKSYAGTQTIGPF 166

Query: 129  HSSFSAVVGPNGSGKSNVIDSMLFAFGFRANKMRQGKLSHLIHKSEKYPDLDFCSVEIQF 188
            HSSFSAVVGPNGSGKSNVIDSMLF FGFRANKMRQGKL+ LIHKSE+YPDL  C+V++ F
Sbjct: 167  HSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLADLIHKSEEYPDLTSCAVDVHF 226

Query: 189  QYVVDEPDGTTRVLSGKPELSVMRKAFKNNTSKYYLNGKESTYTEVTRLLRDEGIDLDHK 248
            +Y++D PD TT++   K  L + R+AFKN+TSKYYLNGKES Y  +T LL++EGIDLDH 
Sbjct: 227  EYLIDYPDDTTKINPSKQPLIITRRAFKNSTSKYYLNGKESNYKTITALLKEEGIDLDHN 286

Query: 249  RFLILQGEVESIAQMKPKAEHEGDDGLLEYLEDIIGTTKYKAQIEQALVEVDSLNDICME 308
            RFLILQGEVE+IAQMKPKAE EGDDGLLEYLEDIIGTTKYK  I++  +E+++LNDIC+E
Sbjct: 287  RFLILQGEVENIAQMKPKAEKEGDDGLLEYLEDIIGTTKYKELIDKKFIEIEALNDICIE 346

Query: 309  KENRFDLVEKEKLSLEPGKDEALAFLKKEKDLTLLMSKKYQYHLFHNGSKLAKTLSNVSN 368
            +ENRFD++++EK SLE  K+ AL +L KEK+  ++ SK  QY ++ N  KL+ TL  ++ 
Sbjct: 347  RENRFDIIDREKESLESEKESALEYLSKEKEQVIVKSKLIQYKIWQNNIKLSNTLEKITK 406

Query: 369  TMNXXXXXXXXXXXXXXXXXXLTDASEQLANRLVSMNNTNKESLAKMRQLERELVSNEEK 428
              +                  L     +  + L ++    KE +   R L+ + VSN E+
Sbjct: 407  LEDEYNQEKNKNTELKNKIDELRKLYTKNQDELQALLKDEKELVNAKRSLDSDNVSNTEQ 466

Query: 429  QKSLLQKRSKAEKTLNTVEKSIKQCENKIEEYISQNQEYETSLTTLNHTIVDAQAELEKM 488
             K++ +K  K  K +    K+I     +++ +    + +ET L  L++ +V     LE +
Sbjct: 467  LKNIEKKLKKTAKEIEEDLKTISSSNVRLKNFHDNKKLFETQLIELDNNLVTESQLLENI 526

Query: 489  KLALSDKTGDITKEVAVLEKELEPWTNKVEEKKSEIKLVESEISIIKEADLKLESEIANL 548
            KL L DKT  +++E+   EK+LEPW  K++E KSEI++ ESE ++ +E+  KL++ I  L
Sbjct: 527  KLDLKDKTVGLSEEILKTEKDLEPWNIKLDELKSEIQIKESEKALFEESKNKLKANIEAL 586

Query: 549  SQEIEQLRGNISHREESIETLNVESSSIRDYILVGERECTSARSKLEEMKKVLVTHRQRV 608
             +++ +       R + ++ L  +  ++   ++ G  E   A  KL EM+K+L+  RQ+ 
Sbjct: 587  EKDVNEKSKLTEDRRKEVKNLMTKLENVSKEVIFGTNELKKANEKLCEMQKILIQDRQKA 646

Query: 609  NDARSAVSSAENKNKVLTALSRLQKSGRIDGYHGRLGDLGTIDDKYDIAISTACPRLDDI 668
            NDAR+++S+ EN++KVL AL +LQKSGRI+G+HGRLG+LG ID+KYD+AISTACPRL+DI
Sbjct: 647  NDARTSLSNVENRSKVLRALLKLQKSGRINGFHGRLGNLGVIDEKYDVAISTACPRLNDI 706

Query: 669  VVDTVECGQQCIEHLRKNKLGYARFILLDKLRKFNLQPAHTPENVPRLFDLVKPKEPKFA 728
            VVD+VECGQQCIE+LRKN LG+ARFILLDKL KF+++   TP NVPRLFDL+K  + KF 
Sbjct: 707  VVDSVECGQQCIEYLRKNNLGHARFILLDKLNKFSMEKISTPRNVPRLFDLIKVNDEKFL 766

Query: 729  PAFYSVLRDTLVTTDLSQANRVAYGKKRYRVVTLDGKLIDISGTMTGGGDRAASGLMK-- 786
            PAFYSVLR+TLV  DL +AN VAYGK RYRVVTL G LIDISGTM+GGG++A+ G M+  
Sbjct: 767  PAFYSVLRNTLVANDLKEANAVAYGKTRYRVVTLKGNLIDISGTMSGGGNQASKGAMQLS 826

Query: 787  --STQQSSLYTPEEVQRMEEELNEREKNFKVAFETFQEMESALQNYLDRQPEIEVELSKQ 844
              ++++ S Y+ EEV  +E+EL+ REKN++ A+ T QEME  L+N  + +P+IE+E+S  
Sbjct: 827  NSTSKEKSTYSSEEVMEIEKELSIREKNYQNAYNTVQEMEIELRNLKESEPKIELEIS-- 884

Query: 845  KMDIETISAELESKIERKLELERSNKTSIED--SSELRTAEEKLAALNADLNSFMSASES 902
            K++ E  S E E  ++RK   E +   SIED  S+++   +  L  LN       S  +S
Sbjct: 885  KLNFEIDSLENECSLKRKQLNEPNASFSIEDNMSADITEMDNALYTLNEKQKLIESQMKS 944

Query: 903  KNQRIKELRAKIMEIGGLELQTLNSKVDSLNXXXXXXXXXXXXXXXXXXXXELELKRARK 962
            K  RIKEL+ KIM+IGG++LQ  NSKVDSL                     E ++++  K
Sbjct: 945  KKDRIKELQDKIMKIGGIKLQMQNSKVDSLQEQKKILIKKQKSEKAGIMKIESDVRKLSK 1004

Query: 963  QQITAKDDIEHCDIEIQKMKSSYDTISTGMQELQKQLSDLQEEIGTLTDEHAVTKHELDQ 1022
            +   ++ D    + +   +++    I   + + +  ++ +Q++  TL ++  +T +EL +
Sbjct: 1005 KLKESESDNTKLNEKKIALENELKNIEELLAQNENNMNCIQDKKFTLREKSEITMNELTE 1064

Query: 1023 KNEKIDSYSSIEIELTEQLQKLQNLANYLKKEMNEYDSKLSHLKLRDLGQVMLDLEENKS 1082
                +  + ++E+E   + +KL +L N +KK +   +   S L +R   +V  DL+    
Sbjct: 1065 MEGLLSEFKTLEVEYKIKSEKLASLLNQIKKILKALEEDHSSLSIR---EVAYDLD---- 1117

Query: 1083 LQSFSHSPTPDTKRENIQSSMLETHLASPSPNERKISIAENNLSMEVDEQASVLENGLPK 1142
                      + K +  Q    E + A    N+    I   N  M +++  + +  G+P 
Sbjct: 1118 --------LLNIKEQEAQKIKTELY-ADFEQNQSNDVI---NDEMIIEDNNNEIAKGIPS 1165

Query: 1143 LPDSELARVDLEDLERDIVQLQDYIDNSTVDIEILDEYAKRLAEYRRRRIDLNEAIMKRD 1202
              +S+  + D+  LE ++VQLQDY + + VD++IL+EY +R+ EYR+R+ DLN+++ +RD
Sbjct: 1166 YMESDFKQFDISSLEAELVQLQDYFEIAKVDLDILEEYTRRMIEYRQRKYDLNQSVEQRD 1225

Query: 1203 ETRMHCEVLKKRRLDEFMEGFGIISITLKEMYQMITMGGNAELELVDSLDPFSEGVLFSV 1262
            + R   E LKK R +EFME F IIS+TLKEMYQ+ITMGGNAELELVDSLDPFSEGV FSV
Sbjct: 1226 KVRKELEDLKKCRFNEFMESFNIISMTLKEMYQIITMGGNAELELVDSLDPFSEGVTFSV 1285

Query: 1263 MPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIK 1322
            MPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIK
Sbjct: 1286 MPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIK 1345

Query: 1323 ERTKNAQFIVISLRNNMFELAQRLVGIYKNSNMTRSTTLQNRDII 1367
            ERTKNAQFIVISLRNNMFELA++LVGIYKN N T+S TL+N DI+
Sbjct: 1346 ERTKNAQFIVISLRNNMFELAEQLVGIYKNVNQTKSATLKNNDIL 1390

>CAGL0L12188g Chr12 (1310968..1315164) [4197 bp, 1398 aa] {ON} similar
            to uniprot|Q12267 Saccharomyces cerevisiae YLR086w Stable
            Maintenance of Chromosomes
          Length = 1398

 Score = 1176 bits (3043), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 684/1409 (48%), Positives = 902/1409 (64%), Gaps = 79/1409 (5%)

Query: 3    IPTPK------KPRILDTPVKLLATSPDRKNVVSRGSSVSTTMGLRGPSLQPP--VAHQI 54
            I TPK       PR + TP  LL +  + +NV+  G S      L+ PSL PP  +    
Sbjct: 22   IHTPKAVTFEQSPRAI-TPRNLLGS--ENRNVLPTGGS----QNLQIPSLLPPESLGSAR 74

Query: 55   XXXXXXXXXXXXXXXXXXXXXAVELIQLSPIKNSRLELQRLYDTKQKKV--ERLCIRTLV 112
                                  ++LI+LSPIKNSR ELQ+LY++K+  V  ERL I  LV
Sbjct: 75   GRDFKSYSQSPPRSPGRSPTRRLKLIELSPIKNSRAELQKLYESKKLDVKKERLFIHQLV 134

Query: 113  LENFKSYAGRQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFAFGFRANKMRQGKLSHLIHK 172
            L +FKSYAGRQV+GPFH+SFSA+VGPNGSGKSNVIDSMLF FGFRANKMRQ +LS LIHK
Sbjct: 135  LNDFKSYAGRQVIGPFHTSFSAIVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHK 194

Query: 173  SEKYPDLDFCSVEIQFQYVVDEPDGTTRVLSGKPELSVMRKAFKNNTSKYYLNGKESTYT 232
            SE +PDL  CSVE+ F+YV+D+ DG+T +   K  L V RKAFKNN SKY++NGKES YT
Sbjct: 195  SETFPDLKSCSVEVHFKYVIDKDDGSTTIDETKGNLVVTRKAFKNNASKYFVNGKESNYT 254

Query: 233  EVTRLLRDEGIDLDHKRFLILQGEVESIAQMKPKAEHEGDDGLLEYLEDIIGTTKYKAQI 292
            EVT LL+ EGIDLDHKRFLILQGEVE+IAQMK KAE E DDGLLEYLEDIIGT+KYK  I
Sbjct: 255  EVTTLLKKEGIDLDHKRFLILQGEVENIAQMKAKAEKENDDGLLEYLEDIIGTSKYKESI 314

Query: 293  EQALVEVDSLNDICMEKENRFDLVEKEKLSLEPGKDEALAFLKKEKDLTLLMSKKYQYHL 352
            E+  +E++SLN+IC+EKENRF +VE+EK SLE GK+EAL FL KEK+L L  SK YQY+L
Sbjct: 315  EKLSMEIESLNEICVEKENRFSIVEREKNSLESGKEEALQFLNKEKELVLEKSKLYQYNL 374

Query: 353  FHNGSKLAKTLSNVSNTMNXXXXXXXXXXXXXXXXXXLTDASEQLANRLVSMNNTNKESL 412
              +  KL   L+  +N                     +T +   L   L  + +T + +L
Sbjct: 375  MQDNKKLDDVLNKKTNVQQEQTKQEDEFRKANSHISDITASLNVLKADLEKV-HTEEVNL 433

Query: 413  AKM-RQLERELVSNEEKQKSLLQKRSKAEKTLNTVEKSIKQCENKIEEYISQNQEYETSL 471
            +K  R LE + V NE+   +L  KR + E+    ++  I   + +I+  I +        
Sbjct: 434  SKTKRTLENKKVENEQIVNNLDSKRKEFEEQSKILQDKINSTDQEIQTIIEEQSSLAEGT 493

Query: 472  TTLNHTIVDAQAELEKMKLALSDKTGDITKEVAVLEKELEPWTNKVEEKKSEIKLVESEI 531
            T L+  +   + +LE +KL L +KT  +T ++A  EKEL PW  + ++ K EIK+ ESE+
Sbjct: 494  TVLSTNLDIEKEKLENIKLKLREKTEHLTIQIAEYEKELSPWNEQSQQLKKEIKITESEL 553

Query: 532  SIIKEADLKLESEIANLSQEIEQLRGNISHREESIETLNVESSSIRDYILVGERECTSAR 591
            SII+E    LE++IA L   I   + ++  +E+ I++L  + + +     +GEREC +A+
Sbjct: 554  SIIEENRKGLENDIAGLENAILSQKRDLEVQEQEIKSLLEQKTKVIQERELGERECKNAQ 613

Query: 592  SKLEEMKKVLVTHRQRVNDARSAVSSAENKNKVLTALSRLQKSGRIDGYHGRLGDLGTID 651
            + L  +++ +   RQ+  + RS  S+ EN NKVL+AL RLQKSGR++G+HGRLGDL  ID
Sbjct: 614  ATLANVREKVEALRQKAIEIRSTYSATENNNKVLSALLRLQKSGRLNGFHGRLGDLAVID 673

Query: 652  DKYDIAISTACPRLDDIVVDTVECGQQCIEHLRKNKLGYARFILLDKLRKFNLQPAHTPE 711
             KYD+AISTACPRL+D+VVDTVE GQQCIE+LRKNKLGYARFILLDKL  FN     TP+
Sbjct: 674  PKYDVAISTACPRLNDLVVDTVESGQQCIEYLRKNKLGYARFILLDKLNTFNTNRIDTPD 733

Query: 712  NVPRLFDLVKPKEPKFAPAFYSVLRDTLVTTDLSQANRVAYGKKRYRVVTLDGKLIDISG 771
               RLFDL+  KE +F  AFYSVLRDTLV  ++ QANRVAYGKKRYRVVTLDG LID+SG
Sbjct: 734  QSQRLFDLITVKEKRFNNAFYSVLRDTLVCQNMEQANRVAYGKKRYRVVTLDGNLIDLSG 793

Query: 772  TMTGGGDRAASGLM----KSTQQSSLYTPEEVQRMEEELNEREKNFKVAFETFQEMESAL 827
            TMTGGG   + GLM     S++ S+ ++PEEVQ +E ELN++E  +K A + + EME  L
Sbjct: 794  TMTGGGRNVSKGLMKLSKSSSKGSAFFSPEEVQAIENELNQKENQYKSALDAYHEMEEEL 853

Query: 828  QNYLDRQPEIEVELSKQKMDIETISAELESKIE------RKLE-LERSNKTSIEDSSELR 880
            +   DR PEI+  +SK++MDIET   ++ S I       +KLE ++  N  SI       
Sbjct: 854  RRLRDRAPEIDNLVSKKEMDIETAHNDINSNINVLEEKRKKLESMKNQNDPSI------- 906

Query: 881  TAEEKLAALNADLNSFMSASESKNQRIKELRAKIMEIGGLELQT-------LNSKVDSLN 933
            T   KL  L + L+     ++S   +IK ++ KI+E+GG EL+        + +K+   +
Sbjct: 907  TLLAKLKELKSKLDDIDVQTKSTKDKIKTIKDKIIELGGDELKNQSLLVTDITNKISENS 966

Query: 934  XXXXXXXXXXXXXXXXXXXXELELKRARKQQITAKDDIEHCDIEIQKMKSSYDTISTGMQ 993
                                  EL  A ++      + E+ DIE               +
Sbjct: 967  RRLKKIKSNKLKKESLLKKFNKELTEANEELTNFSKNAENADIE--------------SK 1012

Query: 994  ELQKQLSDLQEEIGTLTDEHAVTKHELDQKNEKIDS-------YSSIEIELTEQLQKLQN 1046
            E++ +L D++E I  L +     +HE++ K+ +++S       Y SI +E   +L+KL+ 
Sbjct: 1013 EIESKLLDIKESIENLKENEVKLEHEIEMKHNELESHQKVVSDYKSISLEYNNKLEKLEA 1072

Query: 1047 LANYLKKEMNEYDSKLSHLKLRDLGQVM--LDLEENKSLQSFSHSPTPDTKRENIQSSML 1104
                LKK +  Y+  LS L +RD+ QV+  +  EEN S+         D K EN  + + 
Sbjct: 1073 SEASLKKSIKRYNDLLSELTIRDVTQVLNTIMTEENASVDK------SDPKLENTSAVIN 1126

Query: 1105 --ETHLASPSPNERKISIAENN----LSMEVDEQASVLENGLPKLPDSELARVDLEDLER 1158
              +  +++ S N+      EN+      ME+D Q   +  G+P L  SELA+VD +++E 
Sbjct: 1127 ADDDGISAVSENQSFNHNDENDDIDSNKMEIDSQGGFINPGIPVLSASELAKVDPQEVEL 1186

Query: 1159 DIVQLQDYIDNSTVDIEILDEYAKRLAEYRRRRIDLNEAIMKRDETRMHCEVLKKRRLDE 1218
             I  L D+I +S  ++++L+EYA R  E+ +R+ DLN A+  RD  +   E +K++R DE
Sbjct: 1187 LITSLDDFITSSEANVDVLEEYALRFVEFNKRKNDLNSAVQSRDSVKDRLEGIKRKRYDE 1246

Query: 1219 FMEGFGIISITLKEMYQMITMGGNAELELVDSLDPFSEGVLFSVMPPKKSWRNISNLSGG 1278
            FMEGF IIS+TLKEMYQMIT+GGNAELELVDSLDPFSEGV FSVMPPKKSWRNISNLSGG
Sbjct: 1247 FMEGFKIISMTLKEMYQMITLGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNISNLSGG 1306

Query: 1279 EKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNN 1338
            EKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNN
Sbjct: 1307 EKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNN 1366

Query: 1339 MFELAQRLVGIYKNSNMTRSTTLQNRDII 1367
            MFEL ++LVGIYK+ NMT+S  L N D++
Sbjct: 1367 MFELTKQLVGIYKHENMTKSAALVNEDLV 1395

>Kpol_1011.5 s1011 complement(13399..17064) [3666 bp, 1221 aa] {ON}
            complement(13399..17064) [3666 nt, 1222 aa]
          Length = 1221

 Score =  248 bits (632), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 343/1315 (26%), Positives = 611/1315 (46%), Gaps = 157/1315 (11%)

Query: 111  LVLENFKSYAGRQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFAFGFRANKMRQGKLSHLI 170
            L L NFKSY G   VG   S+F++++GPNGSGKSN++D++ F  G +++ +R   L  LI
Sbjct: 7    LELNNFKSYKGVVNVGFGESNFTSIIGPNGSGKSNMMDAISFVLGVQSSHLRSNVLKDLI 66

Query: 171  HKSEKYPDLDFCSVEIQFQYVVDEPDGTTRVLSGKPELS--VMRKAFKNNTSKYYLNGKE 228
            ++     D +  + E      V+      +    K +++  +MR    +  S Y +N K 
Sbjct: 67   YRGFLSGDDEDNNNE-----DVNPNSAYVKAFYQKEDVTHELMRSISNSGDSTYKINNKT 121

Query: 229  STYTEVTRLLRDEGIDLDHKRFLILQGEVESIAQMKPKAEHEGDDGLLEYLEDIIGTTKY 288
             +Y + T  L DE I +  K FL+ QG+VE IA        +    L +  E++ G+ +Y
Sbjct: 122  VSYKQYTSFLEDENILIKAKNFLVFQGDVEQIA-------SQSTTDLTKLFEEVSGSIQY 174

Query: 289  KAQIEQALVEVDSLNDICMEKENRFDLVEKEKLSLEPG--KDEAL-AFLKKEKDLTLLMS 345
            K + E+   +V+ L+    E       +  E    + G  KDE   A L+K ++L +  S
Sbjct: 175  KKEYEELKEKVEKLSQSTAESIKNRRRINNEIKVYKDGITKDEKYKAQLEKRRNLLVYSS 234

Query: 346  KKYQYHLFHNGS----KLAKTLSNVSNTMNXXXXXXXXXXXXXXXXXXLTDASEQLANRL 401
                YHL    S    KL +  S VS                       T A  +  N+L
Sbjct: 235  LWQLYHLDEKKSQSKNKLKEAKSKVSKLKEKLANEEKILQKAKNSIVKDTAAITKYKNKL 294

Query: 402  VSMNNTNKESLAKMRQLERELVSNEEKQKSLLQKRSKAEKTLNTVEKSIKQCENKIEEYI 461
                +  KE LA       +L+  +  Q++  +K S  E+ +  +E+ I++ ++ +E Y 
Sbjct: 295  -EYRSKEKEKLAS------QLIPIKVSQRNTTKKISNIERRIEGIERDIERQKSYVERYE 347

Query: 462  SQNQEYETSLTTLNHTIVDAQAELEKMKL---------ALSDK---TG--DITKEVAVLE 507
            SQ +    S  +    I ++    +K +L         ALS+K   +G  DI  ++++L 
Sbjct: 348  SQLKVVTKSKESFELEIKESAKNFDKYRLSDEDLVTYDALSEKYLSSGGFDIDTKISLLN 407

Query: 508  KELEPWTNKVEEKKSEIKLVESEIS--IIKEADLKLESEIANLSQEIEQLRGNISHREES 565
             + +  +++V   K+ I+L +S+I+  ++ + + +LE EI+ L+  + +     S +   
Sbjct: 408  NDKQETSDEVAMFKNRIELAKSKIADDLVLQGE-RLELEISELTSSLNEKNSLHSQKVSE 466

Query: 566  IETLN--VESSSIRDYILVGERECTSARSKLEEMKKVLVTHRQRVNDARSAVSSAENKNK 623
            ++TL   +ES+S ++Y L           KL E    LV    +++D  ++   + N+ K
Sbjct: 467  LKTLQGEIESTSNKEYDL---------NYKLRE---TLV----KLDDLSASQRESTNERK 510

Query: 624  VLTALSRLQKSGRIDGYHGRLGDLGTID-DKYDIAISTACPR-LDDIVVDTVECGQQCIE 681
            +   +S L++     G  G + DL     +KY +A+ST   +  D I+ D +   Q+CI 
Sbjct: 511  LRENVSMLRR--LFPGVRGLVSDLCQPKKEKYALAVSTILGKNFDSIITDNISVAQECIA 568

Query: 682  HLRKNKLGYARFILLDKLR-KFNLQPAHTPENVPRLFDLVKPKEPKFAPAFYSVLRDTLV 740
            +L+K + G A FI L+ +  +    P    +      + ++  EP++  A   V  D+++
Sbjct: 569  YLKKQRAGVASFIPLESIESEVPTLPFSDGQGCILTINAIEY-EPEYERAMQYVCSDSII 627

Query: 741  TTDLSQANRVAYGKK-RYRVVTLDGKLIDISGTMTGGGDRAASGLM-KSTQQSSLYTPEE 798
               L+ A  + +    + ++VTL+G LI  +G MTGG  R A+    K   QS     ++
Sbjct: 628  CDTLTIAKDLKWKHNVKSKLVTLEGALIHKAGLMTGGILRDATNRWDKEEFQSLTVLKDK 687

Query: 799  VQRMEEELNEREKNFKVAFETFQEMESALQNYLDRQPEIEVELSKQKMDIETISAELESK 858
            +    EEL+   K+F +                 +  ++E  +S    DI ++ +E  ++
Sbjct: 688  LLSQIEELSTSSKSFAI-----------------KGRDLESTISLLNTDITSLRSEF-TQ 729

Query: 859  IERKLELERSNKTSIEDSSELRTAE--EKLAALNADLNSF---MSASESKNQRIK-ELRA 912
            + R LE    NK  I+  +++   E   KL ALN  +  +   +S  E+K + ++ E+  
Sbjct: 730  LNRALE---ENKVEIQYQTDMIDKEFGPKLDALNDKIKVYDEEISQFENKKEDLQGEIFK 786

Query: 913  KIMEIGGLELQTLNSKVDSLNXXXXXXXXXXXXXXXXXXXXELELKRARKQQITAKDDIE 972
            +     G    T+    +                       E +L+  +++  + +   E
Sbjct: 787  EFTNRLGF---TIKEYEEHSGEIRRKQAKELQQLQRQILNIENKLQFEQERLASTEKRFE 843

Query: 973  HCDIEIQKMKSSYDTISTGMQELQKQLSDLQEEIGTLTDEHAVTKHELDQKNEKIDSYSS 1032
                E+QK K S D++ T   ELQ Q+ ++  E+ T   E    +  LD K + I   S 
Sbjct: 844  KGQSELQKTKISLDSLETEESELQTQIEEIDNELETQRTEIDEMQKALDSKLKDI---SF 900

Query: 1033 IEIELTEQLQKLQNLANYLKKEMNEYDSKLSHLKLRDLGQVMLDLEENKSLQSFSHSPTP 1092
            IE    + L ++ N     K+E   ++  +  + L  +G     + +N  +       T 
Sbjct: 901  IE----DSLNEVSNSLEISKREKLGFNDDIEKVDLEKIG-----IYKNCKISGIELPITS 951

Query: 1093 DTKRENIQSSMLETHLASPSPNER---KISIAENNLSMEVDE-QASVLENGLPKLPDSEL 1148
                EN+             PN++      +  N + ++ DE  A   E+G   +   + 
Sbjct: 952  AITLENL-------------PNDKIDNDTILISNEIEVDYDELPAEYKESGNEAV--GQK 996

Query: 1149 ARVDLEDLERDIVQLQDYIDNSTVDIEILDEYAKRLAEYRRRRIDLNEAIMKRDETRMHC 1208
               +++D E  +++LQ    NS   +E  DE   +  E     ID     +K+ E ++  
Sbjct: 997  IEKEIKDAEEKLMELQP---NSKA-VERYDEAKDKFDE-----IDKETEGLKKKERKLLT 1047

Query: 1209 EV--LKKRRLDEFMEGFGIISITLKEMYQMIT---------MGGNAELELVDSLDPFSEG 1257
            +   +KK+R + F + F  ++  +  +Y+ +T          GGNA L L D  +P++ G
Sbjct: 1048 QFVNIKKKRKELFEKAFEYVNEHIDPIYRELTKNPNSSVELAGGNASLTLEDEDEPYNGG 1107

Query: 1258 VLFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIV 1317
            V +   PP K ++++  LSGGEKT+++LAL+FA++ Y+P+P +V+DEIDAALD  NV  +
Sbjct: 1108 VKYHATPPLKRFKDMEYLSGGEKTVAALALLFAINSYQPSPFFVLDEIDAALDITNVERI 1167

Query: 1318 ANYIKERTKNA--QFIVISLRNNMFELAQRLVGIYKNS--NMTRSTTLQNRDIIN 1368
            A YI +R  N   QFIVISL+N+MFE ++ LVGIY++   N +R  TL   + +N
Sbjct: 1168 ATYI-QRHGNPELQFIVISLKNSMFEKSEALVGIYRHQKENSSRIITLNLTNYVN 1221

>CAGL0F02079g Chr6 (201002..204673) [3672 bp, 1223 aa] {ON} similar to
            uniprot|P32908 Saccharomyces cerevisiae YFL008w SMC1
            chromosome segregation protein
          Length = 1223

 Score =  230 bits (587), Expect = 9e-61,   Method: Compositional matrix adjust.
 Identities = 309/1311 (23%), Positives = 573/1311 (43%), Gaps = 183/1311 (13%)

Query: 111  LVLENFKSYAGRQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFAFGFRANKMRQGKLSHLI 170
            L L NFKSY G   V    S+F++++GPNGSGKSN++D++ F  G R++ +R   L  LI
Sbjct: 7    LELYNFKSYKGTVNVDFGDSNFTSIIGPNGSGKSNLMDAISFVLGIRSSSLRSSALKDLI 66

Query: 171  HKS----EKYP---DLDFCSVEIQFQYVVDEPDGTTRVLSGKPELSVMRKAFKNNTSKYY 223
            ++     E  P   D D       +     E DG          + +MR   +   + Y 
Sbjct: 67   YRDIISRENTPTGADNDENGNRTAYVKAFYEYDGKV--------VELMRLISRLGDTSYK 118

Query: 224  LNGKESTYTEVTRLLRDEGIDLDHKRFLILQGEVESIAQMKPKAEHEGDDGLLEYLEDII 283
            L+G   TY E ++ L  + I +  K FL+ QG+VE IA   P        GL + +E++ 
Sbjct: 119  LDGNTVTYKEYSQFLESQNILIKAKNFLVFQGDVEQIASQSPL-------GLTKLIEEVS 171

Query: 284  GTTKYKAQIEQALVEVDSLNDICMEKENRFDLVEKEKLSLEPG---KDEALAFLKKEKDL 340
            G+ +YK + E+   + D +     E   +   +  E  + + G    +E   +++K+K +
Sbjct: 172  GSMQYKKEYEELKDQYDKICQASTESIKKRRRIHAELKTYKEGMSRDEEYRKYVQKKKRV 231

Query: 341  TLLMSKKYQYHLFHNGSKLAKTLSNVSNTMNXXXXXXXXXXXXXXXXXXLTDASEQLANR 400
               +S    + L+H   +  + L  +  + N                     A  + A  
Sbjct: 232  QTNLS---LWQLYHMEDERYQCLQKLEESQNDVDVIREKLEAEEKNLEVFKKALSKEAVL 288

Query: 401  LVSMNNTNKESLAKMRQLERELVSNEEKQKSLLQKRSKAEKTLNTVEKSIKQCENKIEEY 460
            L    N  +    +  + E +L   +  Q + + +    +K +++++K +++ E  +E+Y
Sbjct: 289  LTKKKNHIRSISKEKEKAESDLKVVKIPQNASINRLKNLDKRVDSLQKDLEREEANLEKY 348

Query: 461  ISQNQEYETSLTTLNHTIVDAQAELEKMKLALSDKT------GDITKEVAV-LEKELEPW 513
              Q +    S       I+       K  L+  D        G+      + +E  L   
Sbjct: 349  KHQLKVVTDSKNAFEQEILSKSKNNNKFTLSEDDLKLYDELKGEYLNNGGIEIEDTLNLL 408

Query: 514  TNKVEEKKSEIKLVESEISIIKEADLKLESEIANLSQEIEQLRGNISHREESIETLNVES 573
             NK EE  +++K++  ++ I K+   ++E E+             ++ +EE       + 
Sbjct: 409  DNKKEEITADLKIINDKVEISKQ---RIEDEL-------------VTKKEE-------QD 445

Query: 574  SSIRDYILVGERECTSARSKLEEMKKVL------------VTHRQR-----VNDARSAVS 616
            + IRD  L+   +      KL+E++K              + H+ R     ++D  +   
Sbjct: 446  AKIRDSTLLLNEKNDLHSHKLDELRKTQKDIEYWNNKEFDLNHKLRDTLVKLDDLNATQR 505

Query: 617  SAENKNKVLTALSRLQKSGRIDGYHGRLGDLGTID-DKYDIAISTACPR-LDDIVVDTVE 674
             +  + K+   ++ L++     G  G + +L     DKY +A+ST   +  D ++VD++ 
Sbjct: 506  ESNKERKLRENVAMLKRF--FPGVRGLVHELCKPKRDKYKLAVSTVLGKNFDSVIVDSLS 563

Query: 675  CGQQCIEHLRKNKLGYARFILLDKLRKFNLQ-PAHTPENVPRLFDLVKPKEPKFAPAFYS 733
              Q+CI  L+K + G   FI LD +     + P    E      + V+ K+     A Y 
Sbjct: 564  VAQECISFLKKQRAGVISFIPLDTIDAATPRMPVPESETYTLAINTVEYKDD-LVRAMYY 622

Query: 734  VLRDTLVTTDLSQANRVAYGKK-RYRVVTLDGKLIDISGTMTGG-GDRAASGLMKSTQQS 791
            V  DT++  +L  A  + + K    ++VTLDG LI+ +G MTGG    +A+   K   QS
Sbjct: 623  VCSDTIICDNLDIARDLKWNKNANVKIVTLDGALINKTGLMTGGITSDSANRWDKDEYQS 682

Query: 792  SLYTPEE-VQRMEEELNEREKNFKVAFETFQEMESALQNYLDRQPEIEVELSKQKMDIET 850
             L   ++ +  +EE  N+  ++  +A    +E+E +L +       I  ++++ K  +E 
Sbjct: 683  LLDLKDKLIVDVEEAANKSRQSTLIA----RELEISLSSLTSEISYIRTQITQTKRAVEE 738

Query: 851  ISAELESKIERKLELERSNKTSIEDSSELRTAEEKLAALNADLNSFMSASESKNQRIKEL 910
               E+            +N    E   +++  E K++ L  ++  + +  E+  ++    
Sbjct: 739  TETEIN---------HHNNLIDREFIPQVKDLENKISGLEDEIRDWNTKREALQEKC--- 786

Query: 911  RAKIMEIGGLELQTLNSKVDSLNXXXXXXXXXXXXXXXXXXXXELELKRARKQQITAKDD 970
             A++ E  G  ++   S    +                       EL+  +KQ +  ++ 
Sbjct: 787  FARLTEKVGFTMKDYESHTGEMIRKQTK-----------------ELQILQKQILNLENK 829

Query: 971  IEHCDIEIQKMKSSYDTISTGMQELQKQLSDLQEEIGTLTDEHAVTK-------HELDQK 1023
            +E    E  +  ++ D     +Q +Q+  + +Q E+  L D+    K        ELD K
Sbjct: 830  VE---FETGRCNATKDR----LQNVQETKNSVQHELNELVDQEKSIKLSIETLEGELDGK 882

Query: 1024 NEKIDSYSSIEIELTEQLQKLQNLANYLKKEMNEYDSKLSHLKLRDLGQV-----MLDLE 1078
            NE++ S  +            Q  A+  +  ++EY+++L+ ++  D  ++      LDLE
Sbjct: 883  NEELKSIKA-------AFDSKQKDASATEDIISEYNNRLASIE-SDRNEIKDDITRLDLE 934

Query: 1079 ENKSLQSFSHSPTPDTKRENIQSSMLETHLASPSPNERKISIAENNLSMEVDEQASVLEN 1138
            +   L+             N Q S +   + S    E    +  + +  E  E A  +E 
Sbjct: 935  KMSILK-------------NCQVSGIIVPVVSEVGLE---ELPASKVDDEAIEIAKKIEI 978

Query: 1139 GLPKLP------DSELARVDLEDLERDIVQLQDYIDNSTVDIEILDEYAKRLAEYRRRRI 1192
               KLP       S   + DL +  RDI  + + +  +   +E  D+   R  E     +
Sbjct: 979  DFSKLPRKYKEATSAAVKQDLNNQIRDIDDVLEELQPNARAVERFDDAKSRFDE-----V 1033

Query: 1193 DLNEAIMKRDETRMHCEVLK--KRRLDEFMEGFGIISITLKEMYQMITM---------GG 1241
            D     +K +E ++  E LK  ++R + F   F  I+  L  +Y  +T          GG
Sbjct: 1034 DKETEGLKTEERKVFDEFLKVKQKRKELFENAFEKINEHLDAIYSELTRNVNSTSILGGG 1093

Query: 1242 NAELELVDSLDPFSEGVLFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYV 1301
            +A + + D  +PF+ G+ +   PP K ++++  LSGGEKT+++LAL+FA++ Y P+P ++
Sbjct: 1094 SASMTIEDEDEPFNAGIRYHATPPMKRFKDMEYLSGGEKTVAALALLFAINSYNPSPFFI 1153

Query: 1302 MDEIDAALDFRNVSIVANYIKER-TKNAQFIVISLRNNMFELAQRLVGIYK 1351
            +DE+DAALD  NV  +A YI+     + QFIVISL+N MFE +  LVG+++
Sbjct: 1154 LDEVDAALDISNVQRIAAYIRRHGNPDLQFIVISLKNTMFEKSDALVGVFR 1204

>Ecym_7303 Chr7 (638719..642387) [3669 bp, 1222 aa] {ON} similar to
            Ashbya gossypii AGL023W
          Length = 1222

 Score =  218 bits (554), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 327/1308 (25%), Positives = 588/1308 (44%), Gaps = 160/1308 (12%)

Query: 111  LVLENFKSYAGRQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFAFGFRANKMRQGKLSHLI 170
            L L NFKSY G   VG  +  F ++VGPNGSGKSN++D++ F  G R+N +R   L  LI
Sbjct: 7    LELNNFKSYKGTHNVGFGNKHFISIVGPNGSGKSNMMDAISFVLGIRSNHLRSNALVDLI 66

Query: 171  HKSEKYPDLDFCSVEIQFQYVV------DEPDGTTRVLSGKPELSVMRKAFKNNTSKYYL 224
            ++       D      +  YV       D  +  T++         MR       S Y +
Sbjct: 67   YRGRMDDRSDEHVASPKSAYVKAFYLKDDNGEQGTKI-------EFMRIIQNTGDSVYRI 119

Query: 225  NGKESTYTEVTRLLRDEGIDLDHKRFLILQGEVESIAQMKPKAEHEGDDGLLEYLEDIIG 284
            +GK  ++      L  E I +  + FL+ QG+VE IA        +    L +  E + G
Sbjct: 120  DGKTVSFKRYVEYLEGESILVKARNFLVFQGDVEQIAS-------QSGIELTKLFEQVSG 172

Query: 285  TTKYKAQIEQALVEVDSLNDICMEKENRFDLVEKEKLSLEPGKDEALAFLKKEKDLTLLM 344
            + +Y+ + E+   E     +   E  +      K ++ L+  K+     + KE+    L+
Sbjct: 173  SVQYQREYERLKEEYQKATE---EYGDSLKSKRKMQIDLKSFKEG----VHKEQHYKNLL 225

Query: 345  SKKYQ-------YHLFHNGSKLAKTLSNVSNTMNXXXXXXXXXXXXXXXXXXLTDASEQL 397
            S++ +       + L+H   + +  +S++ ++ +                  L  +  Q 
Sbjct: 226  SERTKLNRQYVLWQLYHLEDRRSGLISSLKDSKSKLAQLKSKLTNEEHI---LHKSKSQA 282

Query: 398  ANRLVSMNNTNKESLAKMRQLERELVSNEEKQKSLL---QKRSKAEKTLNTVEKSIKQCE 454
            A   + +    KE L++++Q ER  +++E     LL     R  A K +N +EK I   +
Sbjct: 283  AKDEIVITR-KKEKLSQLQQ-ERSKLNSE-----LLPVGSSRQSASKRINHIEKRIDSLK 335

Query: 455  NKI---EEYISQNQEYETSLTTLNHTI-VDAQAEL--------EKMKLALSDKTGDITKE 502
              I   E Y+ Q Q     +T    ++ +D +A          E++K   S K   +   
Sbjct: 336  RDITRQESYVQQFQNQLKVVTKAKDSLEIDIKASSSGKFNLSKEQLKEYESLKETYLCSG 395

Query: 503  VAVLEKELEPWTNKVEEKKSEIKLVESEISIIKEADLKLESEIA-NLSQEIEQLRGNISH 561
             + LE+++    NK EE   EI L E   +I K       S I+  L+ E E+L   +S 
Sbjct: 396  GSALEEKMTLLQNKREELLEEISLYERRANISK-------SRISVELNVEREKLELELSE 448

Query: 562  REESIETLN-VESSSIRDYILVGERECTSARSKLEEM----KKVLVTHRQRVNDARSAVS 616
                + + N + S+ ++++  V +    SA +K  E+    K+VLV       D R +  
Sbjct: 449  VTRVLNSKNALHSAKVKEWKEV-QSAIESANNKEYELNYKLKEVLVKLDDLTADQRESNK 507

Query: 617  SAENKNKVLTALSRLQKSGRIDGYHGRLGDLGTID-DKYDIAISTACPR-LDDIVVDTVE 674
              + +  V T L RL       G  G + DL     DKY +A+S+   +  D IVVD+V 
Sbjct: 508  ERKLRENVAT-LKRL-----FPGVKGLVHDLCRPKKDKYALAVSSMLGKNFDSIVVDSVS 561

Query: 675  CGQQCIEHLRKNKLGYARFILLDKLRKFNLQPAHTPENVPRLFDLVKPKE--PKFAPAFY 732
              QQCI +L+K++ G A FI LD +   N  P     N+      V   E   +   A  
Sbjct: 562  VAQQCISYLKKHRSGAASFIPLDTI-DIN-TPTLPVRNLKGCILTVNAIEYDSELEKAMQ 619

Query: 733  SVLRDTLVTTDLSQANRVAYGKK-RYRVVTLDGKLIDISGTMTGGGDRAASGLMKSTQQS 791
             V  D+++   L  A  + + +  + ++VT+ G LI  +G MTGG  R  +      +  
Sbjct: 620  YVCSDSIICDTLDIAKNLKWDRGIKSKLVTIQGALIHRAGLMTGGVGRNNTNRWDKAEYQ 679

Query: 792  SLYTPEEVQRMEEELNEREKNFKVAFETFQEMESALQN-YLDRQPEIEVELSKQKMDIET 850
            SL   +E               KV+ +  + + S  QN  L R  E E+ L         
Sbjct: 680  SLLLLKE---------------KVSGQISELVTSIRQNSVLSRGFENELSL--------- 715

Query: 851  ISAELESKIERKLELERSNKTSIEDSSELRTAEEKLAALNADLNSFMSASESKNQRIKEL 910
            +++EL   +  + +L + N+   E   E+   E+    +N++ +  +SA    N  +KEL
Sbjct: 716  LNSEL---VTLRTQLVQINRLIEEKKVEINYHED---LINSEYSPKISAL---NNSMKEL 766

Query: 911  RAKIMEIGGLELQTLNSKV--DSLNXXXXXXXXXXXXXXXXXXXXELELKRARKQQITAK 968
              ++  I   + +TL   +  D  N                      EL++ +KQ +T +
Sbjct: 767  DEQLSNISKNK-ETLQGSIYKDFANKVGFTIAEYEEHTGETLREHSRELQQLQKQIMTIE 825

Query: 969  DDIEHCDIEIQKMKSSYDTISTGMQELQKQLSDLQEEIGTLTDEHAVTKHELDQKNEKID 1028
            + +E     +Q  +  ++     +++++++   L+E+   +  +      ++ Q NE+I+
Sbjct: 826  NKLEFETERLQGTRVRHEKTIGDLEKVKQETESLEEQESKIQSQIEQVDSQISQHNEEIE 885

Query: 1029 SYSSIEIELTEQLQKLQNLANYLKKEMNEYDSKLSHLKLRDLGQVMLDLEEN--KSLQSF 1086
                   +  + ++ L+ +AN    ++NE    +     R++ Q+  D+E+   + +  F
Sbjct: 886  HLQEASRKKYQSVKALEEIAN----DLNE----MVQTSKREVDQLKDDIEKTGIERVNLF 937

Query: 1087 SHSPTPDTKRENIQSSMLETHLASPSPNERKISIA-ENNLSMEVDEQASVLENGLPKLPD 1145
             +    + +    +S++ E       P ER  S A E   S+ VD   S L+N   K   
Sbjct: 938  KNCKMTNVELPTDKSTLDEL------PIERIDSEAIEMANSITVD--YSSLDNKY-KESG 988

Query: 1146 SELARVDLEDLERDIVQLQDYIDNSTVDIEILDEYAKRLAEYRRRRIDLNEAI--MKRDE 1203
            S L R + ED  +DI      +  ++  +E  DE  ++ +      ID +E +  ++R+ 
Sbjct: 989  SNLTREEFEDSIKDIENTLRELQPNSKAVERFDEAKEQFS----VAIDESEKLKEIERES 1044

Query: 1204 TRMHCEVLKKRRLDEFMEGFGIISITLKEMYQMIT---------MGGNAELELVDSLDPF 1254
               + ++ K++R+  F+  F  ++  +  +Y+ +T          GG+A L L D  +P+
Sbjct: 1045 KEKYLKI-KEKRVKTFLSCFQHVTDHIDRIYRELTRNPGSTAELAGGSASLTLEDEDEPY 1103

Query: 1255 SEGVLFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNV 1314
              G+ +   PP K ++++  LSGGEKT+++LAL+FA++ Y+P+P +++DE+DAALD  NV
Sbjct: 1104 LAGIRYHATPPMKRFKDMDYLSGGEKTMAALALLFAINSYQPSPFFILDEVDAALDVTNV 1163

Query: 1315 SIVANYIKER-TKNAQFIVISLRNNMFELAQRLVGIYKNSNMTRSTTL 1361
              +A YIK   +   QFIVISL++N+F  +Q + G+++N     S  +
Sbjct: 1164 ERIAAYIKRHASPKFQFIVISLKSNLFGKSQSMAGVFRNQQANSSMVI 1211

>NDAI0G03320 Chr7 (781468..785163) [3696 bp, 1231 aa] {ON} 
          Length = 1231

 Score =  185 bits (470), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 200/755 (26%), Positives = 351/755 (46%), Gaps = 118/755 (15%)

Query: 639  GYHGRLGDLG-TIDDKYDIAISTACPR-LDDIVVDTVECGQQCIEHLRKNKLGYARFILL 696
            G  G + DL     DKY +A+ST   +  D I+VD +   Q+CI   +K + G A FI L
Sbjct: 534  GVRGLVHDLCRPKKDKYGLAVSTILGKNFDSIIVDNLNVAQECIAFFKKQRSGTASFIPL 593

Query: 697  DKLRKFNLQPAHTPENVPRLFDLVKP-----KEPKFAPAFYSVLRDTLVTTDLSQANRVA 751
            D +   + QP     N+P   D +        +P++  A   V  D+++   L  A  + 
Sbjct: 594  DTIS--SEQPTL---NLPSSQDYILTINAIEYDPEYERAMQYVCSDSIICNSLDIARDLK 648

Query: 752  YGKK-RYRVVTLDGKLIDISGTMTGGGDRAASGLMKSTQQSSLYTPEEVQRMEEELNERE 810
            + K  R ++VT++G LI  +G MTGG  + ++      +  SL T ++   ++ E     
Sbjct: 649  WNKGVRSKLVTIEGALIHKAGLMTGGISKDSNNRWDKEEYQSLMTLKDKLLLQVE----- 703

Query: 811  KNFKVAFETFQEMESALQNYLDRQPEIEVELSKQKMDIETISAELESKIERKLELERSNK 870
                    T   + S       R  ++E+ELS    +I ++  +L S+++R L+    NK
Sbjct: 704  -----EISTKSRLSST------RARDVEIELSTLNAEISSLRMQL-SQVQRSLD---ENK 748

Query: 871  TSIEDSS---------ELRTAEEKLAALNADLNSFMSASES-KNQRIKELRAKIMEIGGL 920
            T I   +         +L++ +EK+   +   N   S  E  +N+  KEL  K+    G 
Sbjct: 749  TEINHQNTLLDQQYNPKLKSLKEKVDEFDKSWNELKSNKEKLQNEIFKELTDKV----GF 804

Query: 921  ELQTLNSKVDSLNXXXXXXXXXXXXXXXXXXXXELELKRARKQQITAKDDIEHCDIEIQK 980
             ++        L                       EL++ +K+ +  ++ ++    EI++
Sbjct: 805  TIEEYERHSGEL-----------------LRKQSKELQQLQKEILNIENKLQ---FEIER 844

Query: 981  MKSSYDTISTG----------MQELQKQLSDLQEEIGTLTDEHAVTKHELDQKNEKIDSY 1030
            ++++   +++           ++ LQK  ++L E++  +  E    ++ELD  N K+ + 
Sbjct: 845  LENTQKRLTSAESNLEKAHETLKSLQKDENELAEQVKQIESEINSARNELDSVN-KVFTA 903

Query: 1031 SSIEIE-LTEQLQKLQNLANYLKKEMNEYDSKLSHLKLRDLGQVMLDLEENKSLQSFSHS 1089
              ++I  + E L +L + +  LK+  +E    ++   L  +G +                
Sbjct: 904  QQLDINRMEESLGELNDNSQTLKRNRDEIKEDIAKNDLERIGIL---------------- 947

Query: 1090 PTPDTKRENIQSSML-ETHLASPSPNERKISIAENNLSMEVDEQASVLENGLPKLPDSEL 1148
               + K  NI   ++ ET+L S  P +R   I E+ +S  V  +  V    LP     E+
Sbjct: 948  --KNAKVTNIDIPVISETNL-SDLPIDR---IDEDTIS--VSNEIDVDYTALPAKYKEEM 999

Query: 1149 ARVDLEDLERDIVQLQDYIDNSTVDIEILDEYAKRLAEYRRRRIDLNEAIMKRDETRMHC 1208
                  +L+  I  ++D +D    +    D + +  A+ R   ID     +K  E +   
Sbjct: 1000 GSATKNELDTKIKNVEDLLDVLQPNARAADRFTE--AQERFEIIDGETEKIKTTERKALQ 1057

Query: 1209 EVLK--KRRLDEFMEGFGIISITLKEMYQMIT---------MGGNAELELVDSLDPFSEG 1257
            + LK  K+R + F   F  +S  L  +Y+ +T          GGNA L L D  +PF+ G
Sbjct: 1058 QFLKIKKKRKELFENAFDFVSEHLDNIYRELTRNPNSSADLAGGNASLTLEDEDEPFNAG 1117

Query: 1258 VLFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIV 1317
            V +   PP K ++++  LSGGEKT+++LAL+FA++ Y+P+P +V+DE+DAALD  NV  +
Sbjct: 1118 VRYHATPPLKRFKDMEYLSGGEKTVAALALLFAINAYQPSPFFVLDEVDAALDITNVERI 1177

Query: 1318 ANYIKER-TKNAQFIVISLRNNMFELAQRLVGIYK 1351
            A YI+     N QFIVISL+N MFE +  LVG+++
Sbjct: 1178 AAYIRRHGNPNLQFIVISLKNTMFEKSDALVGVFR 1212

 Score =  100 bits (248), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 61/206 (29%), Positives = 104/206 (50%), Gaps = 16/206 (7%)

Query: 111 LVLENFKSYAGRQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFAFGFRANKMRQGKLSHLI 170
           L L NFKSY G   VG   S+F++++GPNGSGKSN++D++ F  G R++ +R   +  LI
Sbjct: 7   LELNNFKSYKGITKVGFGDSNFTSIIGPNGSGKSNMMDAISFVLGVRSSHLRSNIVKDLI 66

Query: 171 HK--------SEKYPDLDFCSVEIQFQYVVDEPDGTTRVLSGKPELSVMRKAFKNNTSKY 222
           ++        + ++  +    V+  ++    +          +P + +MR    N  + Y
Sbjct: 67  YRGVINDNGDTNEHGKVTSAYVKAFYEKNTADDGDNDDDDDERP-VELMRAISTNGDTTY 125

Query: 223 YLNGKESTYTEVTRLLRDEGIDLDHKRFLILQGEVESIAQMKPKAEHEGDDGLLEYLEDI 282
            +NGK  TY E +  L  E I +  K FL+ QG+VE IA   P         L +  E++
Sbjct: 126 KINGKTVTYKEYSEFLERENILIKAKNFLVFQGDVEQIASQSPM-------DLSKLFEEV 178

Query: 283 IGTTKYKAQIEQALVEVDSLNDICME 308
            G+ +YK + ++   +++ LN    E
Sbjct: 179 SGSIQYKKEYDELKEQIEKLNQSAAE 204

>TDEL0C00960 Chr3 (153572..157240) [3669 bp, 1222 aa] {ON} Anc_8.68
            YFL008W
          Length = 1222

 Score =  171 bits (434), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 197/770 (25%), Positives = 352/770 (45%), Gaps = 112/770 (14%)

Query: 639  GYHGRLGDLGTID-DKYDIAISTACPR-LDDIVVDTVECGQQCIEHLRKNKLGYARFILL 696
            G  G + DL     ++Y +A+ST   R  D I+VD +   Q+CI +L+K + G A FI L
Sbjct: 525  GIRGLVSDLCQPKKERYALAVSTILGRNFDSIIVDNLAVAQECIAYLKKQRAGIASFIPL 584

Query: 697  DKLR-KFNLQPAHTPENVPRLFDLVKPKEPKFAPAFYSVLRDTLVTTDLSQANRVAYGKK 755
            D +  + +  PA          + ++  +P++  A   V  D+++   L  A  + + + 
Sbjct: 585  DTIEVETSTLPASESSGCILAINAIEY-DPEYERAMRYVCSDSIICNTLEIARDMKWKRN 643

Query: 756  -RYRVVTLDGKLIDISGTMTGGGDRAASGLM-KSTQQSSLYTPEEVQRMEEELNEREKNF 813
             R ++VTL+G LI  +G MTGG  + +S    K   QS +   +++    EE+    +  
Sbjct: 644  VRSKLVTLEGTLIHRAGLMTGGISKDSSNRWDKEEYQSLMTLKDKILVQIEEVGSHSRAC 703

Query: 814  KVAFETFQEMESALQNYLDRQPEIEVELSKQKMDIETISAELESKIERKLELERSNKTSI 873
             +     +E+E  +         I  ++S+ K  +E  + ++E            N    
Sbjct: 704  SI---RARELEGNISLIYSEASSIRTQISQLKRALEDTNTDIEY---------HQNLIKQ 751

Query: 874  EDSSELRTAEEKLAALNADLNSFMSASESKNQRIKELRAKIMEIGGLELQTLNSKVDSLN 933
            E   +++  E+KLA +N          +S+ Q ++E      E   L+ QT     D L 
Sbjct: 752  EYDPKIQELEQKLAIIN----------DSRKQ-LEE------EKDSLQTQTFKEFTDKLG 794

Query: 934  XXXXXXXXXXXXXXXXXXXXELELKRARKQQITAKDDIEH-------CDIEIQKMKSSYD 986
                                  EL++ +KQ +  ++ +E            ++K ++   
Sbjct: 795  FSMKEYETHSGDAKRQQSK---ELQQLQKQILNVENKLEFEKERLTSTSNRLEKTETDMK 851

Query: 987  TISTGMQELQKQLSDLQEEIGTLTD--EHAVTKHELDQKNEKIDSYSSIEIELTEQLQKL 1044
             +   +Q LQKQ    +E++G  T   E A+  H++  K            ++ E+L+  
Sbjct: 852  KVFIELQSLQKQ----EEDVGVQTKKVEKAIKDHKIKLK------------KVEEELKNK 895

Query: 1045 QNLANYLKKEMNEYDSKLSHLKL-RDLGQVML---DLEENKSLQS--FSHSPTPDTKREN 1098
            Q   N   +++ EY+S L  LK  RD  + ++   DLE    L++   S+   P     +
Sbjct: 896  QRTMNLNDEQLIEYNSSLQSLKRERDEVKDVIEKGDLERICVLKNCKISNMQIPIVSDVD 955

Query: 1099 IQSSMLETHLASPSPNERKISIAENNLSMEVDEQAS-VLENGLPKLPDSELARVDLEDLE 1157
            +QS  ++   A       +I I  + L  +  E     +E G                 E
Sbjct: 956  LQSLPIDRIDAEAIRTSNEIEIDYDALPAKYKENGGEAVEKGF----------------E 999

Query: 1158 RDIVQLQDYIDNSTVDIEILDEYAK---RLAEYRRRRIDLNEAI--MKRDETRMHCEVLK 1212
            R++ Q+ + ++       +L   AK   R  E +++   +N+    +K+DE ++  + +K
Sbjct: 1000 RELKQVDEILN-------VLQPNAKATDRFNEAQQKFGSINDETEQLKKDEKKVLAQFIK 1052

Query: 1213 --KRRLDEFMEGFGIISITLKEMYQMIT---------MGGNAELELVDSLDPFSEGVLFS 1261
              ++R   F E F  ++  +  +Y+ +T          GG+A L L D  +PF+ G+ + 
Sbjct: 1053 IKRKRKSLFEEAFEYVTEHIDPIYRELTKNPNSTSELAGGSASLTLEDEDEPFNAGIRYH 1112

Query: 1262 VMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI 1321
              PP K ++++  LSGGEKT+++LAL+F ++ Y+P+P +V+DE+DAALD  NV  VA YI
Sbjct: 1113 ATPPLKRFKDMEYLSGGEKTVAALALLFTVNSYQPSPFFVLDEVDAALDTTNVERVATYI 1172

Query: 1322 KER-TKNAQFIVISLRNNMFELAQRLVGIYKNS--NMTRSTTLQNRDIIN 1368
            +     + QFIVISL+N MFE +  LVG+Y+    N ++  TL  R+  N
Sbjct: 1173 RRHGNPDLQFIVISLKNTMFEKSDALVGVYRQQELNTSKIVTLNLRNYAN 1222

>NCAS0C04000 Chr3 (807106..810777) [3672 bp, 1223 aa] {ON} Anc_8.68
            YFL008W
          Length = 1223

 Score =  167 bits (423), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 202/766 (26%), Positives = 352/766 (45%), Gaps = 110/766 (14%)

Query: 639  GYHGRLGDLGTID-DKYDIAISTACPR-LDDIVVDTVECGQQCIEHLRKNKLGYARFILL 696
            G  G + DL     +KY +A+S    +  D I+V+ +   ++CI  L+K + G A FI L
Sbjct: 526  GVKGLVHDLCRPKKEKYGLAVSVMLGKNFDSIIVENLSVARECISFLKKQRAGTASFIPL 585

Query: 697  DKLRKFNLQPAHTPENVPRLFDLVKPKEPKFA--PAFYSVLRDTLVTTDLSQANRVAYGK 754
            D +   + QP  +          +   E   A   A   V  D+++   L  A  + + +
Sbjct: 586  DTID--SEQPTLSAPPSQEYILTINAIEYDLAYERAMQYVCGDSIICDTLDIARDLKWNR 643

Query: 755  K-RYRVVTLDGKLIDISGTMTGGGDRAASGLMKSTQQSSLYTPEEVQRMEEELNEREKNF 813
              R ++V+LDG LI  +G MTGG  + +       +  SL T ++  ++  ++ E     
Sbjct: 644  GVRSKLVSLDGSLIHKAGLMTGGISKDSKNRWDKEEYQSLMTLKD--KLLIQIEEVSTVG 701

Query: 814  KVAFETFQEMESALQNYLDRQPEIEVELSKQKMDIETISAELESKIERKLELERSNKTSI 873
            + A    +E+ES+L         +  ELS  +  +  +   +E   E   E+   NK   
Sbjct: 702  RDAAAKARELESSL-------SLLNAELSSLRTQLVQVKRSVE---ENANEINYHNKLLT 751

Query: 874  ED-SSELRTAEEKLAALNADLNSFMSASESKNQRI-KELRAKIMEIGGLELQTLNSKVDS 931
            E  + +L + +E++ A+   ++S  +   S  + I KEL  K+    G  +Q        
Sbjct: 752  EQYTPKLESLQEEIQAIENSISSITAEKVSLQETIFKELTDKV----GFSIQDYERYSGD 807

Query: 932  LNXXXXXXXXXXXXXXXXXXXXELELKRARKQQITAKDDIEHCDIEIQKMKSSYDTISTG 991
            L                       EL++ +KQ +  K+ ++    E +++K++       
Sbjct: 808  LMREQSK-----------------ELQQLQKQILNIKNKLQ---FESERLKTTEGKYHAS 847

Query: 992  MQELQKQLSDLQEEIGTLTDEHAVTKHELDQKNEKIDSYSSIEIELTEQLQKLQNLANYL 1051
            ++ L+   S+LQ    +L +E    ++E  QK ++I+ + S   E   +L +LQ +    
Sbjct: 848  LESLESAKSNLQ----SLEEE----ENECQQKRKQIEQHIS---EDEAELNRLQRV---- 892

Query: 1052 KKEMNEYDSKLSHLKLRDLGQVMLDLEENKSLQSFSHSPTP--------DTKRENIQSSM 1103
                  YD++   L   +L  V+   E N  LQS  H+           D +R  +  + 
Sbjct: 893  ------YDAR--QLDFNNLDDVLA--EYNNELQSLKHNRNQIREDMEKIDLERVGVLKNC 942

Query: 1104 LETHLASPSPNERKIS------IAENNLSMEVDEQASVLENGLPKLPDSELARVDLEDLE 1157
              T++  P  ++  +S      I E+ ++  +  +  V  N LP       A    E+LE
Sbjct: 943  KITNMEIPILSDINLSNLPIDKIDEDTIA--ISNEIDVDYNDLPAKYKESSATTIREELE 1000

Query: 1158 RDIVQLQDYID----NSTVDIEILDEYAKRLAEYRRRRIDLNEAIMKRDETRMHCEVLK- 1212
              I  ++D ++    N+   +E  D+  +R     +   DL     K  E +   + LK 
Sbjct: 1001 NHIRSIEDTLNVLQPNARA-VERFDDAQERFEVVEKETEDL-----KAREKKALTQFLKI 1054

Query: 1213 -KRRLDEFMEGFGIISITLKEMYQMITM---------GGNAELELVDSLDPFSEGVLFSV 1262
             KRR + F   F  ++  L  +Y+ +T          GGNA L L D  +PF+ G+ +  
Sbjct: 1055 KKRRRELFENAFDFVNEHLDPIYRELTRNPNSSALLSGGNASLTLEDEDEPFNAGIKYHA 1114

Query: 1263 MPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIK 1322
            MPP K ++++  LSGGEKT+++LAL+FA++ Y+P+P +V+DE+DAALD  NV  +A YI+
Sbjct: 1115 MPPLKRFKDMEYLSGGEKTVAALALLFAINAYQPSPFFVLDEVDAALDITNVERIAAYIR 1174

Query: 1323 ER-TKNAQFIVISLRNNMFELAQRLVGIYKNS--NMTRSTTLQNRD 1365
                 + QFIVISL+N MFE +  LVG+Y+    N ++  TL  R+
Sbjct: 1175 RHGNPDLQFIVISLKNTMFEKSDALVGVYRQQQENSSKIVTLDLRN 1220

 Score = 87.8 bits (216), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 64/208 (30%), Positives = 97/208 (46%), Gaps = 43/208 (20%)

Query: 111 LVLENFKSYAGRQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFAFGFRANKMRQGKLSHLI 170
           L L NFKSY G   +G   S+F++++GPNGSGKSN++D++ F  G R++ +R   L  LI
Sbjct: 7   LELSNFKSYRGVTKIGFGDSNFTSIIGPNGSGKSNMMDAISFVLGVRSSHLRSNILKDLI 66

Query: 171 HKS--------------EKYPDLDFCSVEIQFQYVVDEPDGTTRVLSGKPELSVMRKAFK 216
           ++               E++P     S  ++  Y   E DG          + +MR    
Sbjct: 67  YRGVIRDFSEEDPEDGEEQHP----TSAYVKAFY---EMDGKV--------VELMRTINI 111

Query: 217 NNTSKYYLNGKESTYTEVTRLLRDEGIDLDHKRFLILQGEVESIAQMKPKAEHEGDDGLL 276
           N  + Y ++ K  +Y +    L  E I +  K FL+ QG+VE IA             L 
Sbjct: 112 NGDTTYKIDNKTVSYKQYAAFLEKENILIKAKNFLVFQGDVEQIASQSAL-------DLS 164

Query: 277 EYLEDIIGTTKYKAQIEQALVEVDSLND 304
           +  E+I G+ +YK        E DSL D
Sbjct: 165 KLFEEISGSIQYKK-------EYDSLKD 185

>AGL023W Chr7 (670877..674545) [3669 bp, 1222 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YFL008W (SMC1)
          Length = 1222

 Score =  145 bits (366), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 191/714 (26%), Positives = 308/714 (43%), Gaps = 104/714 (14%)

Query: 111 LVLENFKSYAGRQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFAFGFRANKMRQGKLSHLI 170
           L ++NFKSY G   VG    +F ++VGPNGSGKSN++D++ F  G R++ +R   L  LI
Sbjct: 7   LEVKNFKSYKGVHNVGFGGKNFISIVGPNGSGKSNMMDAISFVLGIRSSHLRSSALVDLI 66

Query: 171 HKS---------EKYPDLDFCSVEIQFQYVVDEPDGTTRVLSGKPELSVMRKAFKNNTSK 221
           ++          E  P     S  +   YV  +  G  R       +   R       S 
Sbjct: 67  YRGRMEEGGSAHENNPK----SAYVTAFYVKQDASGAER------RMEFTRVIHNTGDST 116

Query: 222 YYLNGKESTYTEVTRLLRDEGIDLDHKRFLILQGEVESIAQMKPKAEHEGDDGLLEYLED 281
           Y L+GK   Y E   +L  E I +  + FL+ QG+VE IA         G D L +  E 
Sbjct: 117 YKLDGKTVGYKEYVDVLEGERILVKARNFLVFQGDVEQIAS------QSGVD-LTKLFEQ 169

Query: 282 IIGTTKYKAQIEQALVEVDSLNDICMEKENRFDLVEKEKLSLEPGKDEALAFLKKEKDLT 341
           + G+ +Y+ + E+     D       E         K ++ L+  K+      K+E+ ++
Sbjct: 170 VSGSVQYQREYERL---KDDYEKASAEYNESLKARRKMQIDLKSFKE---GVQKEEQYIS 223

Query: 342 LLMSK-KYQ-----YHLFHNGSKLAKTLSNVSNTMNXXXXXXXXXXXXXXXXXXLTDASE 395
           LL  + K Q     + LFH  SK +  ++++ ++                    L+    
Sbjct: 224 LLAERVKLQQQFMLWQLFHLQSKRSGLVASLKDS-----------------KAKLSQLKR 266

Query: 396 QLANRLVSMNNTN----KESLAKMRQLERELVSNEEKQKSLLQ------KRSKAEKTLNT 445
           QL+N    +  +     KE L   R+ E  L   ++K +   Q       R    + +  
Sbjct: 267 QLSNEEAILGKSKSLVAKEELLLARRRETLLQKQQDKARLNAQLLPVGSARQGTTRRMVN 326

Query: 446 VEKSIKQCENKIEEYISQNQEYETSLTTLNHTIVDAQAELEKM---KLALSD---KTGDI 499
           +EK I   +  IE   S  ++ +  L  +  T    +AELEK    K  LS+   K  + 
Sbjct: 327 IEKRIDSLQRDIERQESYVKQLKNQLKVVGKTKASFEAELEKSASGKFTLSEEQKKEYEE 386

Query: 500 TKEVAV------LEKELEPWTNKVEEKKSEIKLVESEISIIK---EADLKLESEIANLSQ 550
            KEV +       E++L    NK EE   EI + E  I I K   E DLK+  +I  L  
Sbjct: 387 LKEVYLSSGGSEFEEKLAILQNKKEELSEEIAVFEKRIGISKTRAEHDLKV--DIERLEV 444

Query: 551 EIEQLRGNISHREESIETLNVESSSIRDYILVGERECTSARSKLEEMKKVLVTHRQRVND 610
           E+ +  GN++ +        + S  +R++  + + E  SA +K  E+   L     +++D
Sbjct: 445 EVSERTGNLNDKNA------IHSEKVREWKQI-QSEIESANNKEYELSYKLREVLAKLDD 497

Query: 611 ARSAVSSAENKNKVL----TALSRLQKSGRIDGYHGRLGDLGTI-DDKYDIAISTACPR- 664
             SA     NK + L      L RL       G  G + DL     +KY + +ST   + 
Sbjct: 498 L-SANQRETNKERKLRENVATLRRL-----FPGVRGLVHDLCRPKKEKYAVGVSTILGKN 551

Query: 665 LDDIVVDTVECGQQCIEHLRKNKLGYARFILLDKLRKFN-LQPAHTPENVPRLFDLVKPK 723
            D ++VD++   QQCI +L+K++ G A FI LD +   +   PA          D ++  
Sbjct: 552 FDSVIVDSLSVAQQCISYLKKHRSGVASFIPLDTIDTSSPTLPAGDNTGCILTLDAIEY- 610

Query: 724 EPKFAPAFYSVLRDTLVTTDLSQANRVAYGKK-RYRVVTLDGKLIDISGTMTGG 776
           E     A   V  D+++   L  A  + + +  + ++VTL+G LI  +G MTGG
Sbjct: 611 ESSLEKAMQYVCSDSIICDSLDIARNLKWNRNVKSKLVTLEGALIHRAGLMTGG 664

 Score =  125 bits (313), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 59/165 (35%), Positives = 105/165 (63%), Gaps = 14/165 (8%)

Query: 1211 LKKRRLDEFMEGFGIISITLKEMYQMIT---------MGGNAELELVDSLDPFSEGVLFS 1261
            +K++R++ F+  F  +   +  +Y+ +T          GG+A L L D  +P+  G+ + 
Sbjct: 1051 IKEKRINTFLACFNHVRDNIDRIYRELTRNPGSTAELAGGSASLTLEDEDEPYLGGIRYH 1110

Query: 1262 VMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI 1321
              PP K ++++  LSGGEKT+++LAL+FA++ Y+P+P +++DE+DAALD  NV  +A YI
Sbjct: 1111 ATPPMKRFKDMDYLSGGEKTMAALALLFAINSYQPSPFFILDEVDAALDVTNVERIAAYI 1170

Query: 1322 KER-TKNAQFIVISLRNNMFELAQRLVGIYK----NSNMTRSTTL 1361
            +   +   QFIVISL++N+F  ++ + G+++    NS+M  +T L
Sbjct: 1171 RRHASPKMQFIVISLKSNLFSKSESMAGVFRNQHENSSMVITTDL 1215

>ZYRO0F03828g Chr6 (318190..321843) [3654 bp, 1217 aa] {ON} similar
           to uniprot|P32908 Saccharomyces cerevisiae YFL008W SMC1
           Subunit of the multiprotein cohesin complex essential
           protein involved in chromosome segregation and in
           double-strand DNA break repair SMC chromosomal ATPase
           family member binds DNA with a preference for DNA with
           secondary structure
          Length = 1217

 Score =  142 bits (358), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 190/734 (25%), Positives = 323/734 (44%), Gaps = 90/734 (12%)

Query: 111 LVLENFKSYAGRQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFAFGFRANKMRQGKLSHLI 170
           L L NFKSY G   VG   S+F +++GPNGSGKSN++D++ F  G +++ +R   L  LI
Sbjct: 7   LELYNFKSYRGTVRVGFGDSNFISIIGPNGSGKSNMMDAISFVLGVKSSHLRSQILKDLI 66

Query: 171 HKSEKYPDLDFCSVEIQFQYVVDEPDGTTRVLSGKPELSVMRKAFKNNTSKYYLNGKEST 230
           ++  +  + +    E +  YV          L     + + R   +N  ++Y +NGK   
Sbjct: 67  YRGVEGEEDE-EDGEGRTAYV------KAFYLKSDSTVELSRSISRNGDTQYKMNGKNCG 119

Query: 231 YTEVTRLLRDEGIDLDHKRFLILQGEVESIAQMKPKAEHEGDDGLLEYLEDIIGTTKYKA 290
           Y +    L +E I +  + FL+ QG+V  IA             L +  E+I G+ +YK 
Sbjct: 120 YKQYAEFLEEENILIKAQNFLVFQGDVVQIASQSAT-------DLTKLFEEISGSIQYKK 172

Query: 291 QIEQALVEVDSLNDICMEKENRFDLVEKEKLSLEPGKDEALAF---LKKEKDLTLLMSKK 347
           + +    +VDSLN    E       +  E  S   G D+   F   ++K K+L    +  
Sbjct: 173 EYDSLKGKVDSLNQSAAESIKNRRRIHGELKSYREGIDKNQEFYHQVEKRKELQRHYALW 232

Query: 348 YQYHLFHNGSKLAKTLSNVSNTMNXXXXXXXXXXXX-XXXXXXLTDASEQLANRLVSMNN 406
             YHL     +L   L+N+ N++                        S  +  +   M +
Sbjct: 233 QLYHLETQRHELEDKLANLKNSIKTIRGKETSQEQILQRSRASFARESASILKQRSKMES 292

Query: 407 TNKESLAKMRQL---------ERELVSNEEKQKSLLQKR--------SKAEKTLNTVEKS 449
            ++E     +QL           + ++N +K+ S LQ+          + E  LN V K+
Sbjct: 293 KSREKEKINQQLLPIKLSQRSAAKRIANVQKRISSLQRDIDRQREYVERFENQLNVVTKA 352

Query: 450 IKQCENKIEEYISQNQEY-----ETSL-TTLNHTIVDAQA-ELEKMK-LALSDKTGDITK 501
               E +I+E    + +Y     +T L  +LN   ++     LE  K L L+DK  ++  
Sbjct: 353 KSDFEKEIKESSKDHDKYKLNEDDTKLYASLNEKYLNQGGFSLESQKQLTLNDKQ-ELMD 411

Query: 502 EVAVLEKELEPWTNKVEEKKSEIKLVESEISIIKEADLKLESEIANLSQEIEQLRGNISH 561
           E+  L+K      N +   +     V  E+S+I E   KLES+++ +S  + +     S 
Sbjct: 412 EMETLKKR-----NDISRSR-----VTDELSVIAE---KLESQLSEISSTLNERNSTHSD 458

Query: 562 REESIETLN--VESSSIRDYILVGERECTSARSKLEEMKKVLVTHRQRVNDARSAVSSAE 619
           + + ++ L+  +ESSS ++Y L              ++++VLV   +     R  V   +
Sbjct: 459 KVKELQKLHSQIESSSNKEYDLNY------------KLREVLVKIEELSASQRETVKERK 506

Query: 620 NKNKVLTALSRLQKSGRIDGYHGRLGDLGTI-DDKYDIAISTACPR-LDDIVVDTVECGQ 677
            +  + T L R        G  G + DL     DKY +AIST   +  D ++VD V   Q
Sbjct: 507 LRENIAT-LKRF-----FPGVRGLVCDLCQPKKDKYALAISTILGKNFDSVIVDNVMVAQ 560

Query: 678 QCIEHLRKNKLGYARFILLD----KLRKFNLQPAHTPENVPRLFDLVKPKEPKFAPAFYS 733
           +CI +L+K + G A FI LD    ++    L  +          D     E ++  A   
Sbjct: 561 ECIAYLKKQRAGIASFIPLDTIDVEIPTLTLSDSQGCTLAINAIDY----EQEYERALQY 616

Query: 734 VLRDTLVTTDLSQANRVAYGKK-RYRVVTLDGKLIDISGTMTGGGDRAASGLMKSTQQSS 792
           V  D+++  D++ A  + + K  R ++VTL+G LI  +G MTGG  +  S      +  S
Sbjct: 617 VCSDSIICDDMNIAKDLKWNKGVRSKLVTLEGALIHKAGLMTGGISKNTSNRWDKEEYQS 676

Query: 793 LYTPEE--VQRMEE 804
           L T ++  +Q++EE
Sbjct: 677 LMTLKDKLLQQVEE 690

>KAFR0C03200 Chr3 (643231..646902) [3672 bp, 1223 aa] {ON} Anc_8.68
            YFL008W
          Length = 1223

 Score =  138 bits (348), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 71/167 (42%), Positives = 107/167 (64%), Gaps = 14/167 (8%)

Query: 1211 LKKRRLDEFMEGFGIISITLKEMYQMITM---------GGNAELELVDSLDPFSEGVLFS 1261
            +KKRR + F + F  ++  L  +Y+ +T          GGNA L L D  +PF+ G+ + 
Sbjct: 1054 IKKRRRELFEKAFEHVTNHLDSIYRELTRDPHSSAELSGGNASLTLEDEDEPFNAGIRYH 1113

Query: 1262 VMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI 1321
              PP K ++++  LSGGEKT+++LAL+FA++ ++P+P +V+DE+DAALD RNV  +A YI
Sbjct: 1114 ATPPLKRFKDMEYLSGGEKTMAALALLFAINSFQPSPFFVLDEVDAALDVRNVERIAAYI 1173

Query: 1322 KER-TKNAQFIVISLRNNMFELAQRLVGIYK----NSNMTRSTTLQN 1363
            +     N QFIVISL+N MFE +  LVG+Y+    NS+   +  LQN
Sbjct: 1174 RRHGNPNLQFIVISLKNTMFEKSDALVGVYRQQQENSSKIVTLNLQN 1220

>KNAG0G00910 Chr7 (172759..176439) [3681 bp, 1226 aa] {ON} Anc_8.68
            YFL008W
          Length = 1226

 Score =  138 bits (348), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 79/207 (38%), Positives = 124/207 (59%), Gaps = 19/207 (9%)

Query: 1174 IEILDEYAKRLAEY-----RRRRIDLNEAIMKRDETRMHCEVLK--KRRLDEFMEGFGII 1226
            +EIL   A+ +  +     R   ID     +K +E +++ + LK  K+R + F   F  +
Sbjct: 1013 LEILQPNARAVGRFDEAQERFNAIDNETERLKSEERKIYAQFLKTKKKRKELFDRAFDYV 1072

Query: 1227 SITLKEMYQMIT---------MGGNAELELVDSLDPFSEGVLFSVMPPKKSWRNISNLSG 1277
            S  +  +Y+ +T          GG+A L L D  +PF+ G+ +   PP K ++++  LSG
Sbjct: 1073 STHIDGIYRELTKDPNSTAELAGGSASLTLEDEDEPFNAGIKYHATPPLKRFKDMEYLSG 1132

Query: 1278 GEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI-KERTKNAQFIVISLR 1336
            GEKT+++LAL+FA++ Y+P+P +V+DEIDAALD +NV  +A YI K    + QFIVISL+
Sbjct: 1133 GEKTVAALALLFAINSYQPSPFFVLDEIDAALDIKNVERIAAYIRKHGNPSLQFIVISLK 1192

Query: 1337 NNMFELAQRLVGIYK--NSNMTRSTTL 1361
            N+MFE +  LVG+Y+    N +R  TL
Sbjct: 1193 NSMFEKSDALVGVYRRQQENSSRLVTL 1219

>TPHA0P00340 Chr16 (65711..69370) [3660 bp, 1219 aa] {ON} Anc_8.68
            YFL008W
          Length = 1219

 Score =  138 bits (348), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 70/177 (39%), Positives = 115/177 (64%), Gaps = 14/177 (7%)

Query: 1199 MKRDETRMHCEVL--KKRRLDEFMEGFGIISITLKEMYQMITM---------GGNAELEL 1247
            +K+ E ++  + L  KK+R + F + F  +S  ++ +Y+ +T          GGNA L L
Sbjct: 1036 LKKQERKLLTQFLAIKKKRREVFEKAFDYVSEHIEPIYRELTKNPNSTAELSGGNASLTL 1095

Query: 1248 VDSLDPFSEGVLFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDA 1307
             D  +PF  G+ +   PP K ++++  LSGGEKT+++LAL+FA++ Y+P+P +++DE+DA
Sbjct: 1096 EDEDEPFDAGIKYHATPPLKRFKDMEYLSGGEKTVAALALLFAINSYQPSPFFILDEVDA 1155

Query: 1308 ALDFRNVSIVANYIKERTK-NAQFIVISLRNNMFELAQRLVGIYKNS--NMTRSTTL 1361
            ALD  N+  +ANYI++ +  + QFIVISL+N+MFE +  LVGI++    N +R  TL
Sbjct: 1156 ALDVTNIERIANYIRKHSNSDIQFIVISLKNSMFEKSDALVGIHRQQQENSSRVVTL 1212

 Score =  128 bits (322), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 245/1001 (24%), Positives = 442/1001 (44%), Gaps = 149/1001 (14%)

Query: 111  LVLENFKSYAGRQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFAFGFRANKMRQGKLSHLI 170
            L L NFKSY G   VG   S+F++++GPNGSGKSN++D++ F  GF+++ +R   L  L+
Sbjct: 7    LELFNFKSYKGVTKVGFGESNFTSIIGPNGSGKSNMMDAISFVLGFQSSNLRSSTLKDLV 66

Query: 171  HKSEKYPDLD-FCSVEIQFQYV--VDEPDGTTRVLSGKPELSVMRKAFKNNTSKYYLNGK 227
            ++     D + F     +  YV    E DGT         + +MR       S Y ++ K
Sbjct: 67   YRDIASADENEFGEDGERSAYVKAFYEKDGTV--------VELMRAITAGRDSVYKIDNK 118

Query: 228  ESTYTEVTRLLRDEGIDLDHKRFLILQGEVESIAQMKPKAEHEGDDGLLEYLEDIIGTTK 287
             +TY   +  L  E I +  + FL+ QG+VE IA   P+        L +  E++ G+ K
Sbjct: 119  TTTYKHYSDFLAAENILIKARNFLVFQGDVEQIAAQSPRQ-------LTKLFEEVSGSIK 171

Query: 288  YKAQIEQALVEVDSLNDICMEKENRFDLVEKEKLSLEPG--KDEALAFLKKEKDLTLLMS 345
            YK + E+   +++ L++   E       ++ E    E G  KDE     KK+    L + 
Sbjct: 172  YKKEYEELKEKIEKLSESAAESAKNRRRIQGEMKIYEDGISKDEK---YKKQ----LEVR 224

Query: 346  KKYQYH-----LFH--NGSKLA-KTLSNVSNTMNXXXXXXXXXXXXXXXXXXLTD-ASEQ 396
             K Q H     LFH     KL+ K L  V N +                   LTD  +E+
Sbjct: 225  DKLQVHLALWQLFHLEQEEKLSTKKLKEVKNKV-----------------MKLTDQVNEE 267

Query: 397  LANRLVSMNNTNKESLAKMRQLERELVSNEEKQKSL-------LQKRSKAEKTLNTVEKS 449
              N   + N   KE+  +M+Q  R     +EK   L       L +RS AEK L  +EK 
Sbjct: 268  ETNVKKAKNEVIKETSLQMKQQNRLDYKEKEKDNLLSELTPIQLSQRS-AEKRLANIEKR 326

Query: 450  IKQCENKIEEYISQNQEYETSLTTLNHTIVDAQAEL--------------EKMKL----- 490
            I+     +E   +    YE  L  +  T    + EL              E MKL     
Sbjct: 327  IESIARDMERQKTYVSRYEKQLKVVKKTKDTFEEELKQSNSNPDKYRLNDEDMKLYERLN 386

Query: 491  --ALSDKTGDITKEVAVLEKELEPWTNKVEEKKSEIKLVESEIS---IIKEADLKLES-E 544
               L++   ++  ++++L  E +   +++E  +  I + ++ I+    +K  + +L++ E
Sbjct: 387  EQYLTEGGFELDTKLSLLNNEKKDIDDELELLQKRIDMSKNRITDEFAVKGENFELQAVE 446

Query: 545  IANLSQEIEQLRGNISHREESIETLNVESSSIRDYILVGERECTSARSKLEEMKKVLVTH 604
            +++   E   L  N++++ + I++ ++ES+S ++Y L              +++  LV  
Sbjct: 447  LSSELNEKNSLHLNLANKLKKIQS-DIESTSNKEYELN------------HKLRDTLV-- 491

Query: 605  RQRVNDARSAVSSAENKNKVLTALSRLQKSGRIDGYHGRLGDLG-TIDDKYDIAISTACP 663
              +++DA +       + K+   +S L++     G  G + DL     +KY +A+ST   
Sbjct: 492  --KLDDASANQRETLKEKKLRENVSMLKRF--FPGVKGLVSDLCHPKKEKYALAVSTILG 547

Query: 664  R-LDDIVVDTVECGQQCIEHLRKNKLGYARFILLDKLRKF-NLQPAHTPENVPRLFDLVK 721
            +  D +VVDT+   Q+CI +L+K + G   FI LD +  F    P    + +  + + + 
Sbjct: 548  KNFDSVVVDTLSVAQECITYLKKQRAGIISFIPLDTIDAFVPTLPTTNIQGITLVLNAI- 606

Query: 722  PKEPKFAPAFYSVLRDTLVTTDLSQANRVAYGKK-RYRVVTLDGKLIDISGTMTGGGDRA 780
              + ++  A   V  D+++   LS A  + +      ++VTL+G LI  +G MTGG  + 
Sbjct: 607  DYDQEYDKAMQYVCSDSIMCDTLSIAKSLKWKHNVTSKLVTLEGTLIHRAGLMTGGVSKE 666

Query: 781  ASGLMKSTQQSSLYTPEEVQRME-EELNEREKNFKVAFETFQ----EMESALQNYLDRQP 835
                    +   L T ++   ++ E+L+   K F +     +    ++ S++ +   +  
Sbjct: 667  QGNRWDKEEYQGLVTLKDKLLIQIEQLSNNSKTFAIEARDLESNISQLNSSISDLRTQIS 726

Query: 836  EIEVELSKQKMDIETISAELESKIERKLELERSNKTSIEDS-SELRTAEEKLAALNADLN 894
            +I   + + K +++     L+ + E K     +   SIE S SE+   +E L   N    
Sbjct: 727  QINRSIEENKAEVQYHEDMLKKEYEPKQNQLNTKLESIEKSKSEIIGQKELLQ--NTVFK 784

Query: 895  SF-----MSASESKNQRIKELRAKIMEIGGLELQTLNSKVDSLNXXXXXXXXXXXXXXXX 949
             F      +  E ++   + LR    E+  LE Q LN  ++S                  
Sbjct: 785  EFHNKLGFTIQEYEHHSGEALRQSNKELQQLEKQVLN--IES-------------KLQFE 829

Query: 950  XXXXELELKRARKQQITAKDDIEHCDIEIQKMK-------SSYDTISTGMQELQKQLSDL 1002
                E   KR +K QI    D+E+ +  I+ ++       +    I  GM E++K L D 
Sbjct: 830  VERYESTEKRHKKAQI----DLENNNSTIESLQENEAEVVAKIKDIENGMLEIKKVLEDF 885

Query: 1003 QEEIGTLTDEHAVTKHELDQKNEKIDSYSSIEIELTEQLQK 1043
             +EI     + A+ +  L +K+E + + ++ +I + E+++K
Sbjct: 886  SKEIDRKKKKLAIAEDSLSEKSELLTTSTNEKISIKEEIEK 926

>Kwal_23.5043 s23 (978758..982435) [3678 bp, 1225 aa] {ON} YFL008W
            (SMC1) - SMC chromosomal ATPase family member [contig 7]
            FULL
          Length = 1225

 Score =  137 bits (346), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 66/163 (40%), Positives = 109/163 (66%), Gaps = 12/163 (7%)

Query: 1211 LKKRRLDEFMEGFGIISITLKEMYQMIT---------MGGNAELELVDSLDPFSEGVLFS 1261
            +K+ R + F + F  +S ++ E+Y+ +T          GGNA L L D  +P+  G+ + 
Sbjct: 1056 IKRLRKEAFEKAFDHVSSSIDEIYRELTRDPHSRAELAGGNASLTLEDEDEPYLAGIRYH 1115

Query: 1262 VMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI 1321
              PP K ++++  LSGGEKT+++LAL+FA++ ++P+P +V+DE+DAALD  NV  VA+YI
Sbjct: 1116 ATPPAKRFKDMEYLSGGEKTIAALALLFAINSFQPSPFFVLDEVDAALDISNVERVASYI 1175

Query: 1322 KERT-KNAQFIVISLRNNMFELAQRLVGIYK--NSNMTRSTTL 1361
            + +   + QFIVISL+N MFE +Q LVG+++   +N +++ TL
Sbjct: 1176 RRKAGADLQFIVISLKNTMFEKSQALVGVFRQQQNNTSKALTL 1218

 Score = 94.7 bits (234), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 73/261 (27%), Positives = 122/261 (46%), Gaps = 39/261 (14%)

Query: 111 LVLENFKSYAGRQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFAFGFRANKMRQGKLSHLI 170
           L L NFKSY G+  +G   S+F++++GPNGSGKSN++D++ F  G ++  +R   L+ LI
Sbjct: 7   LELNNFKSYKGKVSIGFRDSNFTSIIGPNGSGKSNLMDAISFVLGVKSVHLRSHLLADLI 66

Query: 171 HK--------------SEKYPDLDFCSVEIQFQYVVDEPDGTTRVLSGKPELSVMRKAFK 216
           ++              SE +P+  +      F    +  D          ELS  R   +
Sbjct: 67  YRGTLSEEEASSADFESENHPNSAYVKA---FYSPSNNEDDVV-------ELS--RTVTR 114

Query: 217 NNTSKYYLNGKESTYTEVTRLLRDEGIDLDHKRFLILQGEVESIAQMKPKAEHEGDDGLL 276
           +  S Y ++GK   Y + ++ L  E I +  + FL+ QG+VE +A  KP+        L 
Sbjct: 115 SQESTYRIDGKTVGYKKYSQFLESENILIKARNFLVFQGDVEQVAAQKPQE-------LT 167

Query: 277 EYLEDIIGTTKYKA---QIEQALVEVDSLNDICMEKENRFDLVEKEKLSLEPGKDEALAF 333
           +  E + G+ +YK    +I + L    S    C++   R  +  K   S + G D+   +
Sbjct: 168 DLFEQVSGSLQYKQDYDRIREELERARSETSDCIQSRKRAHIGLK---SFKEGVDKDEEY 224

Query: 334 LKKEKDLTLLMSKKYQYHLFH 354
            K  +D   L  +   + LFH
Sbjct: 225 RKHLEDRNNLQQQLIVWQLFH 245

>KLLA0D07502g Chr4 complement(642751..646482) [3732 bp, 1243 aa] {ON}
            similar to uniprot|P32908 Saccharomyces cerevisiae
            YFL008W SMC1 Subunit of the multiprotein cohesin complex
            essential protein involved in chromosome segregation and
            in double-strand DNA break repair SMC chromosomal ATPase
            family member binds DNA with a preference for DNA with
            secondary structure
          Length = 1243

 Score =  131 bits (330), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 68/169 (40%), Positives = 106/169 (62%), Gaps = 14/169 (8%)

Query: 1211 LKKRRLDEFMEGFGIISITLKEMYQMIT---------MGGNAELELVDSLDPFSEGVLFS 1261
            +K +R + F   F  +   + ++Y+ +T          GGNA L + +  +P+  G+ + 
Sbjct: 1073 VKAKRKELFEACFKHVDKHIDQIYRALTKNPHDKSELAGGNASLTVENEDEPYLGGIKYF 1132

Query: 1262 VMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI 1321
              PP K ++++  LSGGEKT+++LAL+F ++ Y+P+P +V+DE+DAALD  NV  +A+YI
Sbjct: 1133 ATPPLKRFKDMEYLSGGEKTMAALALLFTINSYQPSPFFVLDEVDAALDITNVERIAHYI 1192

Query: 1322 KERTK-NAQFIVISLRNNMFELAQRLVGIYK----NSNMTRSTTLQNRD 1365
            K     NAQFIVISL+N MFE +Q LVGI++    NS+   S  L+N D
Sbjct: 1193 KRNANPNAQFIVISLKNAMFEKSQSLVGIFREQEDNSSRMVSLNLENYD 1241

 Score = 84.7 bits (208), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 64/215 (29%), Positives = 96/215 (44%), Gaps = 50/215 (23%)

Query: 111 LVLENFKSYAGRQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFAFGFRANKMRQGKLSHLI 170
           L L NFKSY     VG   S F++++GPNGSGKSN++D++ F  G R+N++R   L  LI
Sbjct: 7   LELHNFKSYKDTVQVGFGESYFTSIIGPNGSGKSNLMDAISFVLGVRSNQLRSSALVDLI 66

Query: 171 HK----------------------SEKYP-DLDFCSVEIQFQYV--------VDEPDGTT 199
           ++                      SE  P +  +   E +  YV        +DEP   T
Sbjct: 67  YRGRIENGDPDNGNAKRMHRSDADSEAGPENATYSEEEPRSAYVSCVYQKDDLDEPTKFT 126

Query: 200 RVLSGKPELSVMRKAFKNNTSKYYLNGKESTYTEVTRLLRDEGIDLDHKRFLILQGEVES 259
           R ++   +            S Y +N +  +Y +    L  E I +  K FL+ QG+VE 
Sbjct: 127 RTINTSGD------------SVYKINDRAVSYKKYNEELESENILVKAKNFLVFQGDVER 174

Query: 260 IAQMKPKAEHEGDDGLLEYLEDIIGTTKYKAQIEQ 294
           IA   P++       L   LE + G+  YK   E+
Sbjct: 175 IASQGPES-------LTLLLEQVSGSINYKNDYEK 202

>Skud_6.64 Chr6 (121616..125308) [3693 bp, 1230 aa] {ON} YFL008W
           (REAL)
          Length = 1230

 Score =  127 bits (319), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 168/720 (23%), Positives = 325/720 (45%), Gaps = 101/720 (14%)

Query: 111 LVLENFKSYAGRQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFAFGFRANKMRQGKLSHLI 170
           L L NFKSY G   VG   S+F++++GPNGSGKSN++D++ F  G R+N +R   L  LI
Sbjct: 7   LELSNFKSYRGVTKVGFGESNFTSIIGPNGSGKSNMMDAISFVLGVRSNHLRSNVLKDLI 66

Query: 171 HKS---EKYPDLDFCSVEIQFQYVVDEPDGT---TRVLSGKPELSVMRKAFKNNTSKYYL 224
           ++    +   + +              P           G   + +MR   +N  + Y +
Sbjct: 67  YRGILNDGNDNDNDDDSASDDDATTSNPKSAYVKAFYQKGNKLVELMRIISRNGDTSYKI 126

Query: 225 NGKESTYTEVTRLLRDEGIDLDHKRFLILQGEVESIAQMKPKAEHEGDDGLLEYLEDIIG 284
           +GK  +Y + +  L +E I +  K FL+ QG+VE IA   P         L +  E++ G
Sbjct: 127 DGKSVSYRDYSVFLENENILIKAKNFLVFQGDVEQIAAQSPIE-------LSKMFEEVSG 179

Query: 285 TTKYKAQIEQALVEVDSLNDICMEKENRFDLVEKEKLSLEPGKDEALAFLK---KEKDLT 341
           + +YK + ++   +++ L     E       +  E  + + G ++   ++K   K+ +L 
Sbjct: 180 SIQYKKEYDELKEKIEKLGKSATESIKNRRRIHGELKTYKEGINKNEEYIKQVDKKNELQ 239

Query: 342 LLMSKKYQYHLFHNGSKLAKTLSNVSNTMNXXXXXXXXXXXXXXXXXXLTDASEQLANRL 401
              +    YHL     +L   LS  SN+                    ++   E++ N +
Sbjct: 240 RFQALWQLYHLEQQKEELMDKLS-ASNS-------------------EVSSLKEKINNEM 279

Query: 402 VSMNNTN----KES--LAKMRQLERELVSNEEK-----------QKSLLQKRSKAEKTLN 444
            S+  +     KE   ++K +     +V ++EK           Q++  ++ S  EK + 
Sbjct: 280 KSLQRSKSSFVKEGTIISKQKSKLEYIVKDKEKLVSDLRLIKVPQQAAGKRISHIEKRIE 339

Query: 445 TVEKSIKQCENKIEEYISQNQEYETSLTTLNHTIVDAQAELEKMKLALSD-KTGD----- 498
           ++++ + + E  +E + +Q +    S  T    I ++    EK KL  +D KT D     
Sbjct: 340 SLQRDLGRQEAYVERFETQLKVVTKSKKTFEEEIKESARNYEKFKLNENDLKTYDLLHEK 399

Query: 499 -ITKEVAVLEKELEPWTNKVEE---------KKSEI--KLVESEISIIKEADLKLESEIA 546
            +T+  +VLE+++    N  +E         K+++I  + +  E+ I  E   KL++++ 
Sbjct: 400 YLTQGGSVLEEKISLSNNHKQEILDELDRFNKRADISKRRITEELLITGE---KLDTQLN 456

Query: 547 NLSQEIEQLRGNISHREESIETL--NVESSSIRDYILVGERECTSARSKLEEMKKVLVTH 604
           +L   + +     + R   ++ L  ++ES++ ++Y L              ++++ LV  
Sbjct: 457 DLRASLNEKNALHTERLNQLKKLQSDIESANNKEYDLNF------------KLRETLV-- 502

Query: 605 RQRVNDARSAVSSAENKNKVLTALSRLQKSGRIDGYHGRLGDLG-TIDDKYDIAISTACP 663
             +++D  +       + K+   ++ L++     G  G + DL     +KY +A+ST   
Sbjct: 503 --KIDDLSANQRETMKERKLRENIAMLKRF--FPGVKGLVHDLCHPKKEKYGLAVSTILG 558

Query: 664 R-LDDIVVDTVECGQQCIEHLRKNKLGYARFILLDKLRKFNLQPAHTPENVPRLFDL-VK 721
           R  D ++V+ +   Q+CI  L+K + G A FI LD +   +L     P++   +  +   
Sbjct: 559 RNFDSVIVENLTVAQECIAFLKKQRAGTASFIPLDTIET-DLPTLSLPDSQDYILSINAI 617

Query: 722 PKEPKFAPAFYSVLRDTLVTTDLSQANRVAYGKK-RYRVVTLDGKLIDISGTMTGG--GD 778
             + ++  A   V  D+++   L+ A  + + K  R ++VT++G LI  +G MTGG  GD
Sbjct: 618 DYDSEYEKAMQYVCGDSIICNTLNIAKDLKWKKSVRAKLVTIEGALIHKAGLMTGGISGD 677

>KAFR0G02930 Chr7 complement(609210..612722) [3513 bp, 1170 aa] {ON}
           Anc_7.186 YFR031C
          Length = 1170

 Score =  119 bits (297), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 199/793 (25%), Positives = 344/793 (43%), Gaps = 141/793 (17%)

Query: 108 IRTLVLENFKSYAGRQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFAFGFRA-NKMRQGKL 166
           I  L+++ FKSYA R V+  +   F+A+ G NGSGKSN++D++ F  G  + + +R   L
Sbjct: 3   IEELIIDGFKSYAARTVISDWDPQFNAITGLNGSGKSNILDAICFVLGISSMSTVRASNL 62

Query: 167 SHLIHKSEKYPDLDFCSVEIQFQYVVDEPDGTTRVLSGKPELSVMRKAFKNNTSKYYLNG 226
             LI+K  +   +   SV + F     + D +    +  P++SV R+     TSKY +NG
Sbjct: 63  QDLIYKRGQ-AGVTKASVTVVFDN--SDRDNSPIGFTNSPKISVTRQVVLGGTSKYLING 119

Query: 227 KESTYTEVTRLLRDEGIDLDHKRFLILQGEVESIAQMKPKAEHEGDDGLLEYLEDIIGTT 286
             +    V +L +   +++++  FLI+QG++  +  MKP         +L  +E+  GT 
Sbjct: 120 HRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMKPTE-------ILSLIEEAAGTK 172

Query: 287 KYKAQIEQALVEVDSLNDICMEKENRFDLVEKEKLSLEPGKDEALAFL---KKEKDL--- 340
            ++ + E+A  E          +ENR  L E+ +  LE  + E   FL     + DL   
Sbjct: 173 MFEDRREKA--ERTMAKKETKLQENRALLAEEIEPKLEKLRSEKRIFLDFQTTQTDLERT 230

Query: 341 TLLMSKKYQYHLFHNGSKLAKTLSNVSNTMNXXXXXXXXXXXXXXXXXXLTDASEQLANR 400
           + ++S    Y++ H  S   +TL +  +  N                  L +  E+++  
Sbjct: 231 SRVVSAFNYYNMKHRQSSFEQTLQDSEDKCNH-----------------LKEEIEKVSEE 273

Query: 401 LVSMNNTNKE-SLAKMRQLERE--LVSNEEKQKSLLQKRSKAEKTLNTVEKSIKQCENKI 457
           + S+N   +E  L K  +++ E  LV+ E+++  LL++ S+ + TL     SIK      
Sbjct: 274 IKSLNEDLEELKLQKKNEMDNEGRLVNFEKEESDLLKQISRIKTTL-----SIK------ 322

Query: 458 EEYISQNQEYETSLTTLNHTIVDAQAELEKMKLALSDKTGDITKEVAVLEKELEPWTNKV 517
                            N +I +A+ EL+K    L+    ++TKE   LE +L  +T+  
Sbjct: 323 -----------------NDSIDEAEKELQK----LNSNNEELTKE---LEMKLAQYTST- 357

Query: 518 EEKKSEIKLVESEISIIKEADLKLESEIANLSQEIE-----------QL---RGNISHRE 563
            EK+ EI    SE++ +KE   K    ++ LS  I            QL   +  ++  E
Sbjct: 358 -EKEYEI--ANSELTRLKELQGKKSELLSTLSTGISSNGATDDGYSAQLVATKKKLNDTE 414

Query: 564 ESIETLNVESSSIRDYILVGERECTSARSKLEEMKKVLVTHRQRVNDARSAVSSAE---- 619
             I+ LN++ S ++  +   E +   A+ + E+  K++  + +   + RS ++S      
Sbjct: 415 VLIKKLNMKRSMLQKELASNEPKLFQAKREHEKSSKIMEQNEKYCGELRSQLASFGYDPD 474

Query: 620 -----------------NKNKVLTALSR---------LQKSGRID--GYHGRLGDLGTID 651
                              N+   AL R          + S   D     G    L T+D
Sbjct: 475 LLKFLRKEESEVQQQLYRANEEAEALKRRVANIEFNYTRPSANFDPKSVKGVAAQLFTVD 534

Query: 652 DK-YDIAIS---TACPRLDDIVVDTVECGQQCIEHLRKNKLGYARFILLDKL--RKFN-- 703
            + +D AI+    A  RL +I+VD      Q +E  R  K      I L K+  R  N  
Sbjct: 535 QQQFDNAIALQVCAGGRLYNIIVDNEITASQLLERGRLKK--RVTIIPLSKIATRTLNKN 592

Query: 704 ---LQPAHTPENVPRLFDLVKPKEPKFAPAFYSVLRDTLVTTDLSQANRVAYGKK-RYRV 759
              L     P  V    +L+   + + + A   +  + LV  D   A +V +    R R 
Sbjct: 593 TLALAKELAPGKVELALNLI-GYDDEVSKAMEFIFGNGLVCKDADTAKKVTFHPNIRTRS 651

Query: 760 VTLDGKLIDISGTMTGGGDRAASGLMKSTQQSSLYTPEEVQRMEEELNEREKNFKVAFET 819
           +T  G + D  GT++GG       L+   Q+ + +   +V  +E +L E +K  K   ET
Sbjct: 652 ITQQGDVYDPEGTLSGGSRNTTRSLLVDIQKYN-HAVAKVNELELKLIEMQKKLKEQEET 710

Query: 820 FQEMESALQNYLD 832
            Q+ +S LQN L+
Sbjct: 711 SQKTKS-LQNELN 722

 Score = 82.8 bits (203), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 57/79 (72%), Gaps = 1/79 (1%)

Query: 1269 WR-NISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1327
            W+ ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLVELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1328 AQFIVISLRNNMFELAQRL 1346
            +QFIV+SL+  MF  A R+
Sbjct: 1137 SQFIVVSLKEGMFNNANRV 1155

>Suva_6.104 Chr6 complement(183396..186908) [3513 bp, 1170 aa] {ON}
           YFR031C (REAL)
          Length = 1170

 Score =  117 bits (294), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 223/924 (24%), Positives = 386/924 (41%), Gaps = 189/924 (20%)

Query: 108 IRTLVLENFKSYAGRQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFAFGFRA-NKMRQGKL 166
           +  L+++ FKSYA R V+  +   F+A+ G NGSGKSN++D++ F  G  +   +R   L
Sbjct: 3   VEELIIDGFKSYATRTVITDWDPQFNAITGLNGSGKSNILDAICFVLGIASMTTVRASSL 62

Query: 167 SHLIHKSEKYPDLDFCSVEIQFQYV--VDEPDGTTRVLSGKPELSVMRKAFKNNTSKYYL 224
             LI+K  +   +   SV I F      + P G T      P++SV R+     TSKY +
Sbjct: 63  QDLIYKRGQ-AGVTKASVTIVFDNTDKSNSPIGFT----NSPQISVTRQVVLGGTSKYLI 117

Query: 225 NGKESTYTEVTRLLRDEGIDLDHKRFLILQGEVESIAQMKPKAEHEGDDGLLEYLEDIIG 284
           NG  +    V +L +   +++++  FLI+QG++  +  MKP         +L  +E+  G
Sbjct: 118 NGHRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMKPTE-------ILSLIEEAAG 170

Query: 285 TTKYKAQIEQALVEVDSLNDICMEK------ENRFDLVEKEKLSLEPGKDEALAFLK--- 335
           T  ++ + E+A        +  M K      ENR  L E+ +  LE  ++E   FL+   
Sbjct: 171 TKMFEDRREKA--------ERTMSKKETKLQENRTLLTEEIEPKLEKLRNEKRMFLEFQS 222

Query: 336 ----KEKDLTLLMSKKYQYHLFHNGSKLAKTLSNVSNTMNXXXXXXXXXXXXXXXXXXLT 391
                EK   ++ S  Y Y++ H  + + +TL N    M                   L 
Sbjct: 223 TQTDLEKTERIVASCDY-YNIKHKHTSIRETLENGEAHM-----------------KELN 264

Query: 392 DASEQLANRLVSMNNTNKE-SLAKMRQLER--ELVSNEEKQKSLLQKRS--------KAE 440
           +  E+ A  + S+N   KE  L K ++L +  E+   E ++ +LL + S        KAE
Sbjct: 265 EFIEKTAQEIESLNEDVKEIKLQKQKELHKDSEISKLETQESTLLNEISRLKTSLSIKAE 324

Query: 441 KTLNTVEK-----------SIKQCENKIEEYISQNQEYETS-----------------LT 472
              +T EK           S +  E KI EY    ++Y+T                  ++
Sbjct: 325 SVNDTTEKLKALELEIANSSARLNEKKI-EYTKTEEDYKTVQEELSKQRELYKKKEELVS 383

Query: 473 TLNHTIVDA-------QAELEKMKLALSDKTGDITKEVAVLEKELEPWTNKVEEKKSEIK 525
           TL   I           A+L K K  LSD +  I K    ++                  
Sbjct: 384 TLTTGISSTGAADGGYNAQLIKAKAGLSDVSLAIKKSTMKMD------------------ 425

Query: 526 LVESEISIIKEADLKLESEIANLSQEIEQLRGNISHREESIETLNVESSSIRDYILVGER 585
           L++ E+S+I+            L+Q  +    NI H +E  +  N   + + +Y     R
Sbjct: 426 LLKRELSVIE----------PKLTQATKDNELNIKHVKECQDNCNKLQAQLTEYGFDPSR 475

Query: 586 ECTSARSKLEEMKKVLVTHRQRVNDARSAVSSAENKNKVLTALSRLQKSGRIDGYHGRLG 645
                + K  E+K     + Q  ND+        N     T      K+  + G  G+L 
Sbjct: 476 -IKDLKQKENELKS---QYYQISNDSEYLKRRVANLEFNYTTPYPDFKANLVYGVVGQLF 531

Query: 646 DLGTIDDKYDIAIST-ACPRLDDIVVDTVECGQQCIEHLRKNKLGYARFILLDKLRKFNL 704
           +L     +Y  A+ T A  RL ++VV   +   Q +E  R  K      I L+K+    +
Sbjct: 532 ELDDDKIRYSTALQTCAGGRLFNVVVQDSQTATQLLERGRLRK--RVTIIPLNKISTRPI 589

Query: 705 QPAH-------TPENVPRLFDLVKPKEPKFAPAFYSVLRDTLVTTDLSQANRVAYGKK-R 756
            P          P  V    +L+K  +     A   +  ++L+  D   A ++ +  K R
Sbjct: 590 SPQVLELAKKIAPGKVELAINLIKF-DKSVTKAMEFIFGNSLICEDPETAKKITFHPKIR 648

Query: 757 YRVVTLDGKLIDISGTMTGGGDRAASGLMKSTQQSSLYTPEEVQR----MEEELNEREKN 812
            R +TL G + D  GT++GG    +  L+   Q+ +     ++QR    ++ +LN   + 
Sbjct: 649 ARSITLQGDVYDPEGTLSGGSRNTSDSLLVDIQKYN-----QIQRKIEIIQADLNHVTEE 703

Query: 813 FKVAFETFQEMESALQNYLDRQPEIEVELSKQKMDIETIS-------------AELESKI 859
            +  + T Q+ ++ +QN L+     +++L+K+ +++   S              E E++I
Sbjct: 704 LQKQYTTSQKTKT-IQNDLNASLH-KLDLAKRNLEVNPSSQIMARNEEILREIGECENEI 761

Query: 860 E-RKLELERSNK--TSIE---------DSSELRTAEEKLAALNADLNSFMSASESKNQRI 907
           + R+++LER  +  +SIE           S+L   + +L +L  +L    S SE K    
Sbjct: 762 KIRQMDLERCRQEVSSIEKDMKEYDNDKGSKLNELKNELKSLAKNLEEQESESEGKYDLF 821

Query: 908 KELRAKIMEIGGLELQTLNSKVDS 931
           + L         LE + L+S++DS
Sbjct: 822 QNLE--------LETEQLSSELDS 837

 Score = 83.6 bits (205), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 57/79 (72%), Gaps = 1/79 (1%)

Query: 1269 WRN-ISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1327
            W++ +  LSGG+++L +LAL+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKDSLIELSGGQRSLIALALIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1328 AQFIVISLRNNMFELAQRL 1346
            +QFIV+SL+  MF  A R+
Sbjct: 1137 SQFIVVSLKEGMFTNANRV 1155

>Ecym_4390 Chr4 (816076..819588) [3513 bp, 1170 aa] {ON} similar to
           Ashbya gossypii AGR236W
          Length = 1170

 Score =  112 bits (281), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 194/823 (23%), Positives = 337/823 (40%), Gaps = 177/823 (21%)

Query: 108 IRTLVLENFKSYAGRQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFAFGFRA-NKMRQGKL 166
           +  L+++ FKSYA R V+  +   F+A+ G NGSGKSN++DS+ F  G  +   +R   L
Sbjct: 3   VEELIIDGFKSYATRTVISDWDPQFNAITGLNGSGKSNILDSICFVLGISSMATVRAQNL 62

Query: 167 SHLIHKSEKYPDLDFCSVEIQFQY--VVDEPDGTTRVLSGKPELSVMRKAFKNNTSKYYL 224
             LI+K  +   +   SV I F    +   P G  R     P++SV R+     TSKY +
Sbjct: 63  QDLIYKRGQAGVIK-ASVTIVFDNSDIKSSPIGFERY----PKISVTRQIALGGTSKYLI 117

Query: 225 NGKESTYTEVTRLLRDEGIDLDHKRFLILQGEVESIAQMKPKAEHEGDDGLLEYLEDIIG 284
           NG  +    V  L +   +++++  FLI+QG++  +  MKP         +L  +E+  G
Sbjct: 118 NGHRAQQQTVLHLFQSVQLNINNPNFLIMQGQITKVLNMKPTE-------ILSLIEEAAG 170

Query: 285 TTKYK----------AQIEQALVEVDSLNDICMEKENRFDLVEKEKLSLEPGKDEALAFL 334
           T  ++          A+ E  L E+ +L  +  E E + D    EK +        L F 
Sbjct: 171 TRMFEDRREKAEKTMAKKETKLQEIRAL--LQEEIEPKLDKFRSEKRAF-------LEFQ 221

Query: 335 KKEKDL--TLLMSKKYQYH-LFHNGSKLAKTLSNVSNTMNXXXXXXXXXXXXXXXXXXLT 391
           + + DL  TL +   + YH L    + + +T+ N    +                   L 
Sbjct: 222 ETQTDLEMTLRIVNTHDYHNLVTKQNSIQETVQNSEQRVQE-----------------LE 264

Query: 392 DASEQLANRLVSMN------NTNKE-------SLAKMRQLERELVSN------------- 425
            + ++  N L S+N         KE       SL K+ +LE  L ++             
Sbjct: 265 SSIKKYQNELSSLNEDFTAIKNQKECELLKDGSLTKLEKLENTLSTDLSRFSTALGIAKD 324

Query: 426 --EEKQKSLLQKRSKAE----------KTLNTVEKSIKQCENKIEEYISQNQEYETSLTT 473
             ++++KSL+  +S  E          K L T+E+   +  + IE+  SQ+++ E  L+T
Sbjct: 325 DLKQEKKSLIDIQSSLESSEKDLFVKAKNLKTIEQQYNELNDSIEKLKSQHKDKEELLST 384

Query: 474 LNHTIVDAQA-------ELEKMKLALSDKTGDITK---EVAVLEKEL---EPWTNKVEEK 520
           L   I    A       +L   K  L +    I K    +A+L+KEL   EP   + ++ 
Sbjct: 385 LTTGISSTGATDGGYNSQLAAAKAKLGEAEISIKKANMRIAMLQKELASSEPLLQRAKKD 444

Query: 521 KSEIKLVESEISIIKEADLKLESEIANLSQEIEQLRGNISHREESIETLNVESSSIRDYI 580
             E      +I  +K+             QEIE+L+ +++    + E +           
Sbjct: 445 NEE------QIMQVKQR-----------GQEIEKLKVSLNKSGFNPELMK---------- 477

Query: 581 LVGERECTSARSKLEEMKKVLVTHRQRVNDARSAVSSAENKNKVLTALSRLQKSGRIDGY 640
                   + R +  E+K  L   ++  ND         N     T+ ++      + G 
Sbjct: 478 --------TLRRRENELKNNL---QKLSNDTEYLRRKVANLEFNYTSPTKDFNPQSVKGV 526

Query: 641 HGRLGDLGTIDDKYDIAIS---TACPRLDDIVVDTVECGQQCIEH--LRKNKLGYARFIL 695
             ++  LG   D +D A +    A  RL +I+VD  +   Q +E   LRK        I 
Sbjct: 527 AAQVFTLG--KDNFDSANALQVCAGGRLFNIIVDNEKTASQLLEKGMLRKR----VTIIP 580

Query: 696 LDKL-------RKFNLQPAHTPENVPRLFDLVKPKEPKFAPAFYSVLRDTLVTTDLSQAN 748
           L+K+           L     P  V    +L+  +E   + A   +   +L+  D   A 
Sbjct: 581 LNKISTRVLSDESLALAKKIAPGKVELALNLIGYEED-VSKAMQYIFGGSLICADAETAK 639

Query: 749 RVAYGKK-RYRVVTLDGKLIDISGTMTGGGDRAASGLMKSTQQSSLYTPEEVQRMEEELN 807
           ++ +  + R R +TLDG + D  GT++GG     + L+K  Q+ +            E +
Sbjct: 640 KITFHPQIRARSITLDGDIYDPEGTLSGGSSNNTNSLLKDIQKYN------------EAS 687

Query: 808 EREKNFKVAFETFQE--MESALQNYLDRQPEIEVELSKQKMDI 848
            R K+F+      Q+  ME    + L +  + E++L++ K  +
Sbjct: 688 RRSKSFESELSLIQQQIMECERASQLTKSLQNELDLAEHKFQL 730

 Score = 70.1 bits (170), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 57/79 (72%), Gaps = 1/79 (1%)

Query: 1269 WR-NISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1327
            W+ ++  LSGG+++L +L+L+ AL ++KP P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLVELSGGQRSLIALSLILALLQFKPAPMYILDEVDAALDLNHTQNIGHLIKTRFKG 1136

Query: 1328 AQFIVISLRNNMFELAQRL 1346
            +QFIV+SL+  MF  A R+
Sbjct: 1137 SQFIVVSLKEGMFNNANRV 1155

>Smik_10.167 Chr10 complement(290936..294625) [3690 bp, 1229 aa]
           {ON} YJL074C (REAL)
          Length = 1229

 Score =  107 bits (267), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 167/733 (22%), Positives = 312/733 (42%), Gaps = 120/733 (16%)

Query: 106 LCIRTLVLENFKSYAGRQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFAFGFRANKMRQGK 165
           + I+ ++++ FK+Y    ++  F    + ++G NGSGKSN   ++ F      + +++ +
Sbjct: 1   MYIKRVIIKGFKTYRNETIIDNFSPHQNVIIGSNGSGKSNFFAAIRFVLSDDYSNLKREE 60

Query: 166 LSHLIHKSEKYPDLDFCSVEIQFQYVVDEPDGT----TRVLSGKPELSVMRKAFKNNTSK 221
              LIH+      +   SVEI F     +PD +    + VLS   +   +R+        
Sbjct: 61  RQGLIHQGSGGSVMS-ASVEIVFH----DPDHSMILPSGVLSRGDDEVTIRRTVGLKKDD 115

Query: 222 YYLNGKESTYTEVTRLLRDEGIDLDHKRFLILQGEVESIAQMKPKAEHEGDDGLLEYLED 281
           Y LN +  T  ++ R+L   G  +++   ++ QG++ ++   K K         L+ LED
Sbjct: 116 YQLNDRNVTKGDIVRMLETAGFSMNNPYNIVPQGKIVALTNAKDKER-------LQLLED 168

Query: 282 IIGTTKYKAQIEQALVEVDSLNDICMEKENRFDLVEKEKLSLEPGKDEALAFLKKEKDLT 341
           ++G   ++ +++ +L +++       +     D +  +   +E  + E   + + E+   
Sbjct: 169 VVGAKSFEVKLKASLKKMEETEQKKFQINKEMDELNSKLTEMEQERKELEKYNELERK-- 226

Query: 342 LLMSKKYQYHLFHNGSKLAKTLSNVSNTM--------NXXXXXXXXXXXXXXXXXXLTDA 393
               K YQY L+       + L++V N M        N                  +   
Sbjct: 227 ---RKIYQYTLYD------RELNDVINQMERLDGDYNNTVYSSEQYIQELDKREDMIEQV 277

Query: 394 SEQLANRLVSMNNTNKESL------------------AKMRQLERELVSNEEKQKSLLQK 435
           S++L+N   S+   N   L                   K++++E ++ SN E       +
Sbjct: 278 SKKLSNIEASLKIKNTTDLQQAKLRESETSQNLTDVNVKIKEVELQIESNSE-------Q 330

Query: 436 RSKAEKTLNTVEKSIKQCENKIEEYISQNQEYETSLTTLNHTIVDAQ-AELEKMKLALSD 494
           RS    TL  ++  I+Q + K+ + + + QE      T    +   Q A L++ +  L  
Sbjct: 331 RSLDSTTLEEIKSIIRQRKKKLSKILPRYQEL-----TKEEAMYKLQLASLQQKQRDLIL 385

Query: 495 KTGDITKEVAVLEKELEPWTNKVEEKKSEIKLVESEISIIKEADLKLESEIANLSQEIEQ 554
           K G+  +  +  ++E + W        SEI+ ++S +  + E   KL++E A+L ++  +
Sbjct: 386 KKGEYARFKS--KEERDAWI------YSEIEELKSSVQNLNEQGNKLQTERASLKEQYSK 437

Query: 555 LRGNISHREESIETLNVESSSIRDYILVGERECTSARSKLE---EMKKVLVTHRQRVNDA 611
           + G I   EE I+++N     I+  +   + E  + + KL    + +K L    Q++   
Sbjct: 438 IDGEI---EELIDSVN--GPDIKGQLEDFDSELINLKQKLNGSLDTRKELWRKEQKLQTV 492

Query: 612 RSAVSSAENKNK--VLTALSRLQKSGRID-------------GYHGRLGDLGTIDDKYDI 656
              + S  N+N+  V   +SR   +G I+                G LG+L  ++DKY  
Sbjct: 493 LETLLSDVNQNQRNVNETMSRSLANGIINVKEITEKLKISPESVFGTLGELIKVNDKY-- 550

Query: 657 AISTACPR------LDDIVVDTVECGQQCIEHLRKNKLGYARFILLDKLR-----KFNLQ 705
               AC        L  +VVDT E     +  L + K G   FI L++L      KF   
Sbjct: 551 ---KACAEVIGGNSLFHVVVDTEETATLIMNELYRMKGGRVTFIPLNRLSLDSDVKF--- 604

Query: 706 PAHTPENVPRLFDLVK--PKEPKFAPAFYSVLRDTLVTTDLSQANRVAYGKKRYRVVTLD 763
           P++T   + +   L+K    +P+F  A   V   T+V  DL Q  ++A  K +   +TLD
Sbjct: 605 PSNTTTQI-QFTPLIKKIKYQPRFEKAVKHVFGRTIVVKDLGQGLKLA-KKHKLNAITLD 662

Query: 764 GKLIDISGTMTGG 776
           G   D  G +TGG
Sbjct: 663 GDRADKRGVLTGG 675

 Score = 76.6 bits (187), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 73/258 (28%), Positives = 121/258 (46%), Gaps = 42/258 (16%)

Query: 1132 QASVLENGLPKLPDSELARVDLEDLERDIVQLQDYIDNSTVDIEILDEYAKRLAE----Y 1187
            Q  + E GL  LP+  L   D  D+  D  QL   +++   +I  L    KR  E    +
Sbjct: 951  QQRIREIGL--LPEDALVN-DFSDITSD--QLLQKLNDMNTEISGLKNVNKRAFENFKKF 1005

Query: 1188 RRRRIDLNEAIMKRDETRMHCE----VLKKRRLDEFMEGFGIISITLKEMYQMITMGGNA 1243
              +R DL+E   + DE++   +     LK+++++     F  +S   + +++ +   G A
Sbjct: 1006 DEKRKDLSERASELDESKDSIQDLIVKLKQQKVNAVDSTFQKVSENFEAVFERLVPRGIA 1065

Query: 1244 ELEL---------VDSLDP-----------------FSEGVLFSVMPPKKSWR--NISNL 1275
            +L +         +DS+D                     GV  SV    K     ++  L
Sbjct: 1066 KLVIHRRDDTKDQMDSIDDDMDVASSERTSSKDGDIMYTGVSISVSFNSKQNEQLHVEQL 1125

Query: 1276 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISL 1335
            SGG+KT+ ++AL+ A+    P   Y+ DEIDAALD +  + VA  IKE +KNAQFI  + 
Sbjct: 1126 SGGQKTVCAIALILAIQMVDPASFYLFDEIDAALDKQYRTAVATLIKELSKNAQFICTTF 1185

Query: 1336 RNNMFELAQRLVGI-YKN 1352
            R +M ++A +   + Y+N
Sbjct: 1186 RTDMLQVADKFFRVKYEN 1203

>Smik_7.346 Chr7 complement(577634..581146) [3513 bp, 1170 aa] {ON}
           YFR031C (REAL)
          Length = 1170

 Score =  101 bits (252), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 80/274 (29%), Positives = 136/274 (49%), Gaps = 37/274 (13%)

Query: 108 IRTLVLENFKSYAGRQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFAFGFRA-NKMRQGKL 166
           +  L+++ FKSYA R V+  +   F+A+ G NGSGKSN++D++ F  G  + + +R   L
Sbjct: 3   VEELIIDGFKSYATRTVITDWDPQFNAITGLNGSGKSNILDAICFVLGIASMSTVRASSL 62

Query: 167 SHLIHKSEKYPDLDFCSVEIQFQYV--VDEPDGTTRVLSGKPELSVMRKAFKNNTSKYYL 224
             LI+K  +   +   SV I F      + P G     +  P++SV R+     TSKY +
Sbjct: 63  QDLIYKRGQ-AGVTKASVTIVFDNTDKSNSPIG----FANSPQISVTRQVVLGGTSKYLI 117

Query: 225 NGKESTYTEVTRLLRDEGIDLDHKRFLILQGEVESIAQMKPKAEHEGDDGLLEYLEDIIG 284
           NG  +    V +L +   +++++  FLI+QG++  +  MKP         +L  +E+  G
Sbjct: 118 NGHRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMKPSE-------ILSLIEEAAG 170

Query: 285 TTKYKAQIEQALVEVDSLNDICMEK------ENRFDLVEKEKLSLEPGKDEALAFLK--- 335
           T  ++ + E+A        +  M K      ENR  L E+ +  LE  ++E   FL+   
Sbjct: 171 TKMFEDRKEKA--------ERTMSKKETKLQENRTLLTEEIEPKLEKLRNEKRMFLEFQS 222

Query: 336 ----KEKDLTLLMSKKYQYHLFHNGSKLAKTLSN 365
                EK   +++S  Y Y+L H  + + +TL N
Sbjct: 223 TQTDLEKTERIVVSYDY-YNLKHKHTSIRETLEN 255

 Score = 82.4 bits (202), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 57/79 (72%), Gaps = 1/79 (1%)

Query: 1269 WR-NISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1327
            W+ ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLIELSGGQRSLVALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1328 AQFIVISLRNNMFELAQRL 1346
            +QFIV+SL+  MF  A R+
Sbjct: 1137 SQFIVVSLKEGMFSNANRV 1155

>YFR031C Chr6 complement(216594..220106) [3513 bp, 1170 aa] {ON}
           SMC2Subunit of the condensin complex; essential SMC
           chromosomal ATPase family member that forms a complex
           with Smc4p to form the active ATPase; Smc2p/Smc4p
           complex binds DNA; required for clustering of tRNA genes
           at the nucleolus
          Length = 1170

 Score =  101 bits (252), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 80/273 (29%), Positives = 137/273 (50%), Gaps = 25/273 (9%)

Query: 108 IRTLVLENFKSYAGRQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFAFGFRA-NKMRQGKL 166
           +  L+++ FKSYA R V+  +   F+A+ G NGSGKSN++D++ F  G  + + +R   L
Sbjct: 3   VEELIIDGFKSYATRTVITDWDPQFNAITGLNGSGKSNILDAICFVLGIASMSTVRASSL 62

Query: 167 SHLIHKSEKYPDLDFCSVEIQFQYV--VDEPDGTTRVLSGKPELSVMRKAFKNNTSKYYL 224
             LI+K  +   +   SV I F      + P G T      P++SV R+     TSKY +
Sbjct: 63  QDLIYKRGQ-AGVTKASVTIVFDNTDKSNSPIGFT----NSPQISVTRQVVLGGTSKYLI 117

Query: 225 NGKESTYTEVTRLLRDEGIDLDHKRFLILQGEVESIAQMKPKAEHEGDDGLLEYLEDIIG 284
           NG  +    V +L +   +++++  FLI+QG++  +  MKP         +L  +E+  G
Sbjct: 118 NGHRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMKPSE-------ILSLIEEAAG 170

Query: 285 TTKYKAQIEQALVEVDSLNDICMEKENRFDLVEKEKLSLEPGKDEALAFLK-------KE 337
           T  ++ + E+A  E          +ENR  L E+ +  LE  ++E   FL+        E
Sbjct: 171 TKMFEDRREKA--ERTMSKKETKLQENRTLLTEEIEPKLEKLRNEKRMFLEFQSTQTDLE 228

Query: 338 KDLTLLMSKKYQYHLFHNGSKLAKTLSNVSNTM 370
           K   +++S +Y Y++ H  + + +TL N    M
Sbjct: 229 KTERIVVSYEY-YNIKHKHTSIRETLENGETRM 260

 Score = 82.0 bits (201), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 57/79 (72%), Gaps = 1/79 (1%)

Query: 1269 WR-NISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1327
            W+ ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLIELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1328 AQFIVISLRNNMFELAQRL 1346
            +QFIV+SL+  MF  A R+
Sbjct: 1137 SQFIVVSLKEGMFANANRV 1155

 Score = 50.8 bits (120), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 48/197 (24%), Positives = 90/197 (45%), Gaps = 16/197 (8%)

Query: 641 HGRLGDLGTIDD---KYDIAIST-ACPRLDDIVVDTVECGQQCIEHLRKNKLGYARFILL 696
           HG +G L  ID+   +Y  A+ T A  RL ++VV   +   Q +E  R  K      I L
Sbjct: 524 HGVVGQLFQIDNDNIRYATALQTCAGGRLFNVVVQDSQTATQLLERGRLRK--RVTIIPL 581

Query: 697 DKL-------RKFNLQPAHTPENVPRLFDLVKPKEPKFAPAFYSVLRDTLVTTDLSQANR 749
           DK+       +  +L     P  V    +L++  E     A   +  ++L+  D   A +
Sbjct: 582 DKIYTRPISSQVLDLAKKIAPGKVELAINLIRFDES-ITKAMEFIFGNSLICEDPETAKK 640

Query: 750 VAYGKK-RYRVVTLDGKLIDISGTMTGGGDRAASGLMKSTQQSSLYTPEEVQRMEEELNE 808
           + +  K R R +TL G + D  GT++GG    +  L+   Q+ +    ++++ ++ +LN 
Sbjct: 641 ITFHPKIRARSITLQGDVYDPEGTLSGGSRNTSESLLVDIQKYN-QIQKQIETIQADLNH 699

Query: 809 REKNFKVAFETFQEMES 825
             +  +  + T Q+ ++
Sbjct: 700 VTEELQTQYATSQKTKT 716

>ZYRO0D15642g Chr4 complement(1307703..1311215) [3513 bp, 1170 aa]
           {ON} similar to uniprot|P38989 Saccharomyces cerevisiae
           YFR031C SMC2 Component of the condensin complex
           essential SMC chromosomal ATPase family member that
           forms a complex with Smc4p to form the active ATPase
           Smc2p/Smc4p complex binds DNA possibly in the cleft
           formed by the coiled-coil of the folded dimer
          Length = 1170

 Score =  100 bits (248), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 76/253 (30%), Positives = 128/253 (50%), Gaps = 24/253 (9%)

Query: 108 IRTLVLENFKSYAGRQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFAFGFRA-NKMRQGKL 166
           I  L+++ FKSYA R V+  +   F+A+ G NGSGKSNV+D++ F  G  + + +R   L
Sbjct: 3   IEELIIDGFKSYATRTVISDWDPQFNAITGLNGSGKSNVLDAICFVLGIASMSTVRASSL 62

Query: 167 SHLIHKSEKYPDLDFCSVEIQFQYVVDEPDGTTRVLSGKPELSVMRKAFKNNTSKYYLNG 226
             LI+K  +   +   SV I F  +  +P  +       P+LSV R+     TSKY +NG
Sbjct: 63  QDLIYKRGQ-AGVTKASVTIVFSNL--DPKCSPIGFENSPKLSVTRQIILGGTSKYLING 119

Query: 227 KESTYTEVTRLLRDEGIDLDHKRFLILQGEVESIAQMKPKAEHEGDDGLLEYLEDIIGTT 286
             +    V +L +   +++++  FLI+QG++  +  MKP         +L  +E+  GT 
Sbjct: 120 HRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMKPSE-------ILSLIEEAAGTK 172

Query: 287 KY---KAQIEQALVEVDSLNDICMEKENRFDLVEKEKLSLEPGKDEALAFLKKEKDLTLL 343
            +   K + E+ + + +        KENR  L E+ +  LE  ++E   FL+ ++  T L
Sbjct: 173 MFEDRKGKAERTMGKKE-----LKLKENRTLLQEEIEPQLEKLRNEKRIFLEFQEIQTDL 227

Query: 344 -----MSKKYQYH 351
                +   Y+YH
Sbjct: 228 EKIQRIVLAYEYH 240

 Score = 82.4 bits (202), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 57/79 (72%), Gaps = 1/79 (1%)

Query: 1269 WR-NISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1327
            W+ ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLVELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1328 AQFIVISLRNNMFELAQRL 1346
            +QFIV+SL+  MF  A R+
Sbjct: 1137 SQFIVVSLKEGMFSNANRV 1155

>AGR236W Chr7 (1189845..1193357) [3513 bp, 1170 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YFR031C (SMC2)
          Length = 1170

 Score =  100 bits (248), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 59/189 (31%), Positives = 99/189 (52%), Gaps = 11/189 (5%)

Query: 108 IRTLVLENFKSYAGRQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFAFGFRA-NKMRQGKL 166
           +  L+++ FKSYA R V+  +   F+A+ G NGSGKSN++DS+ F  G  +   +R   L
Sbjct: 3   VEELIIDGFKSYATRTVISGWDPQFNAITGLNGSGKSNILDSICFVLGISSMATVRAQNL 62

Query: 167 SHLIHKSEKYPDLDFCSVEIQFQYVVDEPDGTTRVLSGKPELSVMRKAFKNNTSKYYLNG 226
             LI+K  +   +   SV I F     +P  +       P++SV R+     TSKY +NG
Sbjct: 63  QDLIYKRGQAGVIK-ASVTIVFDN--SDPSSSPFGFETYPKISVTRQIILGGTSKYLING 119

Query: 227 KESTYTEVTRLLRDEGIDLDHKRFLILQGEVESIAQMKPKAEHEGDDGLLEYLEDIIGTT 286
             +    V  L +   +++++  FLI+QG++  +  MKP       D +L  +E+  GT 
Sbjct: 120 HRAQQLTVLHLFQSVQLNINNPNFLIMQGKITKVLNMKP-------DEILALIEEAAGTR 172

Query: 287 KYKAQIEQA 295
            ++ + E+A
Sbjct: 173 MFEDRREKA 181

 Score = 69.3 bits (168), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 57/79 (72%), Gaps = 1/79 (1%)

Query: 1269 WR-NISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1327
            W+ ++  LSGG+++L +L+L+ AL ++KP P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLVELSGGQRSLIALSLILALLQFKPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1328 AQFIVISLRNNMFELAQRL 1346
            +QFIV+SL+  MF  A R+
Sbjct: 1137 SQFIVVSLKEGMFTNANRV 1155

>Skud_6.119 Chr6 complement(211918..215430) [3513 bp, 1170 aa] {ON}
           YFR031C (REAL)
          Length = 1170

 Score = 99.4 bits (246), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 59/191 (30%), Positives = 102/191 (53%), Gaps = 15/191 (7%)

Query: 108 IRTLVLENFKSYAGRQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFAFGFRA-NKMRQGKL 166
           +  L+++ FKSYA R V+  +   F+A+ G NGSGKSN++D++ F  G  + + +R   L
Sbjct: 3   VEELIIDGFKSYATRTVITDWDPQFNAITGLNGSGKSNILDAICFVLGIASMSTVRASSL 62

Query: 167 SHLIHKSEKYPDLDFCSVEIQFQYV--VDEPDGTTRVLSGKPELSVMRKAFKNNTSKYYL 224
             LI+K  +   +   SV I F     ++ P G T      P++SV R+     TSKY +
Sbjct: 63  QDLIYKRGQ-AGVTKASVTIVFNNTDKLNSPIGFT----NSPQISVTRQVVLGGTSKYLI 117

Query: 225 NGKESTYTEVTRLLRDEGIDLDHKRFLILQGEVESIAQMKPKAEHEGDDGLLEYLEDIIG 284
           NG  +    V +L +   +++++  FLI+QG++  +  MKP         +L  +E+  G
Sbjct: 118 NGHRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMKPSE-------ILSLIEEAAG 170

Query: 285 TTKYKAQIEQA 295
           T  ++ + E+A
Sbjct: 171 TKMFEDRREKA 181

 Score = 82.0 bits (201), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 57/79 (72%), Gaps = 1/79 (1%)

Query: 1269 WRN-ISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1327
            W++ +  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKDSLIELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1328 AQFIVISLRNNMFELAQRL 1346
            +QFIV+SL+  MF  A R+
Sbjct: 1137 SQFIVVSLKEGMFSNANRV 1155

>YFL008W Chr6 (119429..123106) [3678 bp, 1225 aa] {ON}  SMC1Subunit
           of the multiprotein cohesin complex, essential protein
           involved in chromosome segregation and in double-strand
           DNA break repair; SMC chromosomal ATPase family member,
           binds DNA with a preference for DNA with secondary
           structure
          Length = 1225

 Score = 99.4 bits (246), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 57/162 (35%), Positives = 85/162 (52%), Gaps = 13/162 (8%)

Query: 111 LVLENFKSYAGRQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFAFGFRANKMRQGKLSHLI 170
           L L NFKSY G   VG   S+F++++GPNGSGKSN++D++ F  G R+N +R   L  LI
Sbjct: 7   LELSNFKSYRGVTKVGFGESNFTSIIGPNGSGKSNMMDAISFVLGVRSNHLRSNILKDLI 66

Query: 171 HK-------SEKYPDLDFCSVEIQFQYVVDEPDGTTRVLSGKPELSVMRKAFKNNTSKYY 223
           ++       S+ Y +    S   Q  YV            G   + +MR   +N  + Y 
Sbjct: 67  YRGVLNDENSDDYDNEGAASSNPQSAYV------KAFYQKGNKLVELMRIISRNGDTSYK 120

Query: 224 LNGKESTYTEVTRLLRDEGIDLDHKRFLILQGEVESIAQMKP 265
           ++GK  +Y + +  L +E I +  K FL+ QG+VE IA   P
Sbjct: 121 IDGKTVSYKDYSIFLENENILIKAKNFLVFQGDVEQIAAQSP 162

>NDAI0G02070 Chr7 (461697..465212) [3516 bp, 1171 aa] {ON} Anc_7.186
           YFR031C
          Length = 1171

 Score = 97.8 bits (242), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 59/191 (30%), Positives = 101/191 (52%), Gaps = 15/191 (7%)

Query: 108 IRTLVLENFKSYAGRQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFAFGFRA-NKMRQGKL 166
           +  L+++ FKSYA R V+  +   F+A+ G NGSGKSN++D++ F  G  +   +R   L
Sbjct: 3   VEELIIDGFKSYATRTVISDWDPQFNAITGLNGSGKSNILDAICFVLGITSMTTVRASNL 62

Query: 167 SHLIHKSEKYPDLDFCSVEIQFQYVVDEPDGTTRVL--SGKPELSVMRKAFKNNTSKYYL 224
             LI+K  +   +   SV I F    D  D T   +  +   ++SV R+     TSKY +
Sbjct: 63  QDLIYKRGQ-AGITKASVTIVF----DNTDKTNSPIGFNNSAKISVTRQVVLGGTSKYLI 117

Query: 225 NGKESTYTEVTRLLRDEGIDLDHKRFLILQGEVESIAQMKPKAEHEGDDGLLEYLEDIIG 284
           NG  +    V +L +   +++++  FLI+QG++  +  MKPK        +L  +E+  G
Sbjct: 118 NGHRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMKPKE-------ILSLIEEAAG 170

Query: 285 TTKYKAQIEQA 295
           T  ++ + E+A
Sbjct: 171 TKMFEDRREKA 181

 Score = 82.4 bits (202), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 57/79 (72%), Gaps = 1/79 (1%)

Query: 1269 WR-NISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1327
            W+ ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1078 WKESLVELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1137

Query: 1328 AQFIVISLRNNMFELAQRL 1346
            +QFIV+SL+  MF  A R+
Sbjct: 1138 SQFIVVSLKEGMFSNANRV 1156

>TDEL0D01620 Chr4 complement(321963..325634) [3672 bp, 1223 aa] {ON}
            Anc_1.295 YJL074C
          Length = 1223

 Score = 97.4 bits (241), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 184/788 (23%), Positives = 335/788 (42%), Gaps = 158/788 (20%)

Query: 635  GRIDGYHGRLGDLGTIDDKYDI-AISTACPRLDDIVVDTVECGQQCIEHLRKNKLGYARF 693
            GR+    G LG+L  +++KY + A       L  IVVDT E     I+ L + + G   F
Sbjct: 533  GRV---FGTLGELIKVNEKYKMCAEVVGGNSLFHIVVDTDETASLMIQELYRMRGGRVTF 589

Query: 694  ILLDKLRKFNLQPAHTPENVPRLFDLVKP--KEPKFAPAFYSVLRD----TLVTTDLSQA 747
            + L+++  +N      P   P       P  K+ KF   F SV+++    T+V  DL+  
Sbjct: 590  MPLNRI--YNDPNITYP---PNAQSSCTPLIKKIKFDAQFESVVKNVFGKTIVVRDLAAG 644

Query: 748  NRVAYGKKRYRV--VTLDGKLIDISGTMTGGGDRAASGLMKSTQQSSLYTPEEVQRMEEE 805
            +++A   K Y++  +TLDG   D SG +T GG                            
Sbjct: 645  SKIA---KHYKLDAITLDGDRADKSGLLT-GG---------------------------- 672

Query: 806  LNEREKNFKVAFETFQEMESALQNYLDRQPEIEVELSKQKMDIETISAELESKIERKLEL 865
                E + K   E+ +++++A   Y  ++   E+E  +QK  I T  AE++S        
Sbjct: 673  --YHEHHKKTRLESLKDLKNARTQY--KKTSDELEQIRQK--IHTADAEIDSM------- 719

Query: 866  ERSNKTSIEDSSELRTAEEKLAALNADLNSFMSASESK--NQRIKELRAKIMEI----GG 919
                      + ++R A  K   +  +++ F +   +K   +   E  AK +E+      
Sbjct: 720  ----------NGQIRVASNKRETILTNVDGFRTKLNNKLSEKLFLEESAKSLELKREKAE 769

Query: 920  LELQTLNSKVDSLNXXXXXXXXXXXXXXXXXXXXELELKRARKQQITAKDDIEHCDIEI- 978
              ++ + +K+DS                       L+L    + QI+A+   E  D+EI 
Sbjct: 770  TSIKVVQAKIDSYT---------------------LDLTSEFETQISAQKQKELNDLEIT 808

Query: 979  -QKMKSSYDTISTGMQELQKQLSDLQEEIGT----LTDEHAVTKHELDQKNEKIDSYSSI 1033
             QK++ + +T +  +Q +  ++  L  E+ +       E   +KH+ D      D  S +
Sbjct: 809  LQKVQKNLNTTTEALQGITTKIDSLTAELNSKLLPQKSELQASKHQ-DGDVLVADLKSDL 867

Query: 1034 EIELTEQLQKLQNLANYLKKEMNEYDSKLSHLKLRDLGQVMLDLEENKSLQSFSHSPTPD 1093
            E+ ++++ Q L+       KE++E  ++L  LK  + G+    LE+  S Q+        
Sbjct: 868  ELMISDK-QGLEKQFESSGKEVDELQTELEGLKA-EKGKNESLLEKANSQQAQLLKKLET 925

Query: 1094 TKRENIQSSMLETHLASPSPN-ERKISIAENNLSMEVDEQASVLENGLPKLPDSELARVD 1152
             +++  +S + +T LAS     +RKI         EV   A    N    L   EL R  
Sbjct: 926  FQKDAEKSMVKKTTLASRREELQRKIR--------EVGLLAEEALNSFSNLSSEELLR-K 976

Query: 1153 LEDLERDIVQLQDYIDNSTVDIEILDEYAKRLAEYRRRRIDLNEAIMKRDETRMHCE--- 1209
            L  +  DI  L++      V+ +  + + K    +  ++++L +   + DE++   +   
Sbjct: 977  LNAVNEDISGLKN------VNKKAFENFKK----FHEKKLELEDRSKELDESKTSIQNLI 1026

Query: 1210 -VLKKRRLDEFMEGFGIISITLKEMYQMITMGGNAELELVDSLDPFSE------------ 1256
              LK++++      F  +S    E+++ +   G A+L +  S D   +            
Sbjct: 1027 VKLKQQKVAAVDSTFENVSRNFTEVFEQLVPRGKAKLVIHRSSDARDDDVDAENDTAMTG 1086

Query: 1257 ------------GVLFSVMPPKKSWR--NISNLSGGEKTLSSLALVFALHKYKPTPLYVM 1302
                        GV  SV    K  R  ++  LSGG+KT+ ++AL+ A+    P P Y+ 
Sbjct: 1087 DDDGTQTESMYTGVSISVSFNSKKTRQLHVEQLSGGQKTVCAVALILAIQMVDPAPFYLF 1146

Query: 1303 DEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQRLVGIYKNSNMTRSTTLQ 1362
            DEIDAALD +  + VA  IK  + NAQFI  + R +M ++A +   +   + ++    + 
Sbjct: 1147 DEIDAALDKQYRTAVAGIIKALSANAQFICTTFRTDMLQVADKFFRVKYENKISTVVEVD 1206

Query: 1363 NRDIINVL 1370
             ++ IN +
Sbjct: 1207 RQEAINFI 1214

>SAKL0F07282g Chr6 complement(554459..557971) [3513 bp, 1170 aa]
           {ON} similar to uniprot|P38989 Saccharomyces cerevisiae
           YFR031C SMC2 Component of the condensin complex
           essential SMC chromosomal ATPase family member that
           forms a complex with Smc4p to form the active ATPase
           Smc2p/Smc4p complex binds DNA possibly in the cleft
           formed by the coiled-coil of the folded dimer
          Length = 1170

 Score = 96.7 bits (239), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 59/191 (30%), Positives = 100/191 (52%), Gaps = 15/191 (7%)

Query: 108 IRTLVLENFKSYAGRQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFAFGFRAN-KMRQGKL 166
           +  L+++ FKSYA R V+  +   F+A+ G NGSGKSN++DS+ F  G  +   +R   L
Sbjct: 3   VEELIIDGFKSYATRTVISNWDPQFNAITGLNGSGKSNILDSICFVLGISSMVTVRASNL 62

Query: 167 SHLIHKSEKYPDLDFCSVEIQFQYVVDEPDGTTRVLS--GKPELSVMRKAFKNNTSKYYL 224
             LI+K  +   +   SV I F    D  D ++  +     P++SV R+     TSKY +
Sbjct: 63  QDLIYKRGQ-AGVTKASVTIVF----DNTDKSSSPIGFESYPKISVTRQIILGGTSKYLI 117

Query: 225 NGKESTYTEVTRLLRDEGIDLDHKRFLILQGEVESIAQMKPKAEHEGDDGLLEYLEDIIG 284
           NG  +    V  L +   +++++  FLI+QG++  +  MKP         +L  +E+  G
Sbjct: 118 NGHRAQQQTVLHLFQSVQLNINNPNFLIMQGKITKVLNMKPTE-------ILSLIEEAAG 170

Query: 285 TTKYKAQIEQA 295
           T  ++ + E+A
Sbjct: 171 TRMFEDRREKA 181

 Score = 69.3 bits (168), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 57/79 (72%), Gaps = 1/79 (1%)

Query: 1269 WR-NISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1327
            W+ ++  LSGG+++L +L+L+ AL ++KP P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLVELSGGQRSLIALSLILALLQFKPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1328 AQFIVISLRNNMFELAQRL 1346
            +QFIV+SL+  MF  A R+
Sbjct: 1137 SQFIVVSLKEGMFTNANRV 1155

 Score = 48.5 bits (114), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 52/181 (28%), Positives = 83/181 (45%), Gaps = 15/181 (8%)

Query: 661 ACPRLDDIVVDTVECGQQCIEHLRKNKLGYARFILLDKL--RKFN-----LQPAHTPENV 713
           A  RL ++VVD      Q +E  R  K      I L+K+  R  N     L  +  P NV
Sbjct: 548 AGGRLFNVVVDNEVTASQLLERGRLRK--RVTIIPLNKIASRTLNENALKLAKSVAPGNV 605

Query: 714 PRLFDLVKPKEPKFAPAFYSVLRDTLVTTDLSQANRVAYGKK-RYRVVTLDGKLIDISGT 772
               +L+   E + + A   +   +L+  D   A RV +  + R R +TLDG + D  GT
Sbjct: 606 ELALNLI-GYEDEVSRAMEFIFGTSLICKDAETAKRVTFHPQIRARSITLDGDIYDPEGT 664

Query: 773 MTGGGDRAASGLMKSTQQSSLYTPEEVQRMEEELNEREKNFKVA-FETFQEMESALQNYL 831
           ++GG     + L+   Q  +    + +  ME EL  ++ N K+A +E   +   +LQN L
Sbjct: 665 LSGGSRNTKNSLLIDIQTFN-AASKRLNEMELEL--KQINSKIAEYEQTSQKTKSLQNEL 721

Query: 832 D 832
           +
Sbjct: 722 N 722

>KLTH0E04774g Chr5 (426535..430047) [3513 bp, 1170 aa] {ON} similar
           to uniprot|P38989 Saccharomyces cerevisiae YFR031C SMC2
           Component of the condensin complex essential SMC
           chromosomal ATPase family member that forms a complex
           with Smc4p to form the active ATPase Smc2p/Smc4p complex
           binds DNA possibly in the cleft formed by the
           coiled-coil of the folded dimer
          Length = 1170

 Score = 95.9 bits (237), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 57/189 (30%), Positives = 98/189 (51%), Gaps = 11/189 (5%)

Query: 108 IRTLVLENFKSYAGRQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFAFGFRA-NKMRQGKL 166
           +  L+++ FKSYA R V+  +   F+A+ G NGSGKSN++D++ F  G  +   +R   L
Sbjct: 3   VEELIIDGFKSYATRTVISDWDPQFNAITGLNGSGKSNILDAICFVLGISSMATVRASNL 62

Query: 167 SHLIHKSEKYPDLDFCSVEIQFQYVVDEPDGTTRVLSGKPELSVMRKAFKNNTSKYYLNG 226
             LI+K  +   +   SV I F    D+   +       P++SV R+     TSKY +NG
Sbjct: 63  QDLIYKRGQ-AGVTKASVTIVFTN--DDKANSPIGFESYPKISVTRQIVLGGTSKYLING 119

Query: 227 KESTYTEVTRLLRDEGIDLDHKRFLILQGEVESIAQMKPKAEHEGDDGLLEYLEDIIGTT 286
             +    V  L +   +++++  FLI+QG++  +  MKP         +L  +E+  GT 
Sbjct: 120 HRAQQQTVLHLFQSVQLNINNPNFLIMQGKITKVLNMKPSE-------ILSLIEEAAGTK 172

Query: 287 KYKAQIEQA 295
            ++ + E+A
Sbjct: 173 MFEDRREKA 181

 Score = 69.3 bits (168), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 57/79 (72%), Gaps = 1/79 (1%)

Query: 1269 WR-NISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1327
            W+ ++  LSGG+++L +L+L+ AL ++KP P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLVELSGGQRSLIALSLILALLQFKPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1328 AQFIVISLRNNMFELAQRL 1346
            +QFIV+SL+  MF  A R+
Sbjct: 1137 SQFIVVSLKEGMFTNANRV 1155

>NCAS0E01920 Chr5 (368382..371894) [3513 bp, 1170 aa] {ON} Anc_7.186
          Length = 1170

 Score = 95.5 bits (236), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 58/191 (30%), Positives = 101/191 (52%), Gaps = 15/191 (7%)

Query: 108 IRTLVLENFKSYAGRQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFAFGFRANKM-RQGKL 166
           +  L+++ FKSYA R V+  +   F+A+ G NGSGKSN++D++ F  G  +  + R   L
Sbjct: 3   VEELIIDGFKSYATRTVIADWDPQFNAITGLNGSGKSNILDAICFVLGISSMTIVRASNL 62

Query: 167 SHLIHKSEKYPDLDFCSVEIQFQYVVDEPDGTTRVL--SGKPELSVMRKAFKNNTSKYYL 224
             LI+K  +   +   SV I F    D  D T   +  +   ++SV R+     TSKY +
Sbjct: 63  QDLIYKRGQ-AGVTKASVTIVF----DNSDKTNSPIGFNNSSKISVTRQIILGGTSKYLI 117

Query: 225 NGKESTYTEVTRLLRDEGIDLDHKRFLILQGEVESIAQMKPKAEHEGDDGLLEYLEDIIG 284
           NG  +    V +L +   +++++  FLI+QG++  +  MKP       + +L  +E+  G
Sbjct: 118 NGHRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMKP-------NEILSLIEEAAG 170

Query: 285 TTKYKAQIEQA 295
           T  ++ + E+A
Sbjct: 171 TKMFENRREKA 181

 Score = 82.8 bits (203), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 57/79 (72%), Gaps = 1/79 (1%)

Query: 1269 WRN-ISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1327
            W++ +  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKDSLVELSGGQRSLVALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1328 AQFIVISLRNNMFELAQRL 1346
            +QFIV+SL+  MF  A R+
Sbjct: 1137 SQFIVVSLKEGMFSNANRV 1155

>Kwal_55.20421 s55 (391382..394894) [3513 bp, 1170 aa] {ON} YFR031C
           (SMC2) - SMC chromosomal ATPase family member [contig
           149] FULL
          Length = 1170

 Score = 95.1 bits (235), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 56/189 (29%), Positives = 99/189 (52%), Gaps = 11/189 (5%)

Query: 108 IRTLVLENFKSYAGRQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFAFGFRA-NKMRQGKL 166
           +  L+++ FKSYA R V+  +   F+A+ G NGSGKSN++D++ F  G  + + +R   L
Sbjct: 3   VEELIIDGFKSYATRTVISNWDPQFNAITGLNGSGKSNILDAICFVLGISSMSTVRASNL 62

Query: 167 SHLIHKSEKYPDLDFCSVEIQFQYVVDEPDGTTRVLSGKPELSVMRKAFKNNTSKYYLNG 226
             LI+K  +   +   SV I F     + + +       P++SV R+     TSKY +NG
Sbjct: 63  QDLIYKRGQ-AGVTKASVTIVFAN--SDKNNSPIGFESYPKISVTRQIVLGGTSKYLING 119

Query: 227 KESTYTEVTRLLRDEGIDLDHKRFLILQGEVESIAQMKPKAEHEGDDGLLEYLEDIIGTT 286
             +    V  L +   +++++  FLI+QG++  +  MKP         +L  +E+  GT 
Sbjct: 120 HRAQQQTVLHLFQSVQLNINNPNFLIMQGKITKVLNMKPTE-------ILSLIEEAAGTK 172

Query: 287 KYKAQIEQA 295
            ++ + E+A
Sbjct: 173 MFEDRREKA 181

 Score = 69.3 bits (168), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 57/79 (72%), Gaps = 1/79 (1%)

Query: 1269 WR-NISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1327
            W+ ++  LSGG+++L +L+L+ AL ++KP P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLVELSGGQRSLIALSLILALLQFKPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1328 AQFIVISLRNNMFELAQRL 1346
            +QFIV+SL+  MF  A R+
Sbjct: 1137 SQFIVVSLKEGMFTNANRV 1155

>TDEL0H02610 Chr8 (434116..437628) [3513 bp, 1170 aa] {ON} Anc_7.186
           YFR031C
          Length = 1170

 Score = 95.1 bits (235), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 57/191 (29%), Positives = 101/191 (52%), Gaps = 15/191 (7%)

Query: 108 IRTLVLENFKSYAGRQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFAFGFRA-NKMRQGKL 166
           I  L+++ FKSYA R V+  +   F+A+ G NGSGKSN++D++ F  G  A   +R   L
Sbjct: 3   IEELIIDGFKSYATRTVISDWDPQFNAITGLNGSGKSNILDAICFVLGISAMTTVRASSL 62

Query: 167 SHLIHKSEKYPDLDFCSVEIQFQYVVDEPDGTTRVL--SGKPELSVMRKAFKNNTSKYYL 224
             LI+K  +   +   SV + F    D  D +   +  +   ++SV R+     +SKY +
Sbjct: 63  QDLIYKRGQ-AGVTKASVTVVF----DNSDKSNSPIGFTNSAKISVTRQVMLGGSSKYLI 117

Query: 225 NGKESTYTEVTRLLRDEGIDLDHKRFLILQGEVESIAQMKPKAEHEGDDGLLEYLEDIIG 284
           NG  +    V +L +   +++++  FLI+QG++  +  MKPK        +L  +E+  G
Sbjct: 118 NGHRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMKPKE-------ILSLIEEAAG 170

Query: 285 TTKYKAQIEQA 295
           T  ++ + ++A
Sbjct: 171 TKMFEDRKDKA 181

 Score = 86.3 bits (212), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 108/430 (25%), Positives = 203/430 (47%), Gaps = 66/430 (15%)

Query: 956  ELKRARKQQITAKDDIEHCDIEIQKMKSSYDTISTG----MQELQKQLSDLQEEIGTLTD 1011
            E+  ++K+  + +  I  C+ EIQ++++     ST     +++L+ ++S L +EIG L  
Sbjct: 753  EIDESQKEIASKRSSISDCEKEIQRIQTDIQEFSTDKGSKLKQLKDEVSKLFKEIGILE- 811

Query: 1012 EHAVTKHELDQKNEKIDSYSSIEIELTEQL-----------QKLQNLANYLKKE------ 1054
                TK E      K DSY + +++ TEQL           ++L  L   L+ E      
Sbjct: 812  ----TKVE-----SKYDSYQTFQLD-TEQLAGEIASGNDTVKQLSELQQTLEGERRSLEE 861

Query: 1055 ---MNEYDSKLSHLKLRDLGQVMLDL-EENKSLQSFSHSPTPDTKRENIQSSMLETHLAS 1110
               MN+ +     ++L+     ++D+ EE K L +        TK E   +  LE    S
Sbjct: 862  NLGMNQTELDNVQVELKAEQSRLVDINEELKELDT-----VIKTKTEAKNNYELELQKLS 916

Query: 1111 PSPNERKISIAENNLSMEVDEQASVLENGLPKLPDSEL--------ARVDLEDLERDI-- 1160
               N+ K      N S  + E+ S LE     L D  L          V+LE +++ +  
Sbjct: 917  NDLNKFK------NNSSSIYEKISSLEQEHDWLKDGALVAGIIQQSGEVNLEQMKKRVEH 970

Query: 1161 --VQLQDYIDNSTVDIEILDEYAKRLAEYRRRRIDLNEAIMKRDETRMHCEV--LKKRRL 1216
               Q QD       +I  + E  ++     +  ID     +++D+ ++   +  L + + 
Sbjct: 971  LQKQFQDMRRKVNPNIMSMIESVEKKEAALKAMID----TIEKDKVKIQETIHKLNEYKK 1026

Query: 1217 DEFMEGFGIISITLKEMYQMITMGGNAELELVDSLDPFSEGVLFSVMPPKKSWRNISNLS 1276
            D  ++ +  +++   +++  +     A+L  ++  +  +EG+ F V        ++  LS
Sbjct: 1027 DTLIKTWKKVTVDFGQVFADLLPNSFAKLVPLEGKE-VTEGLEFKVRLGSIWKESLVELS 1085

Query: 1277 GGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLR 1336
            GG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K +QFIV+SL+
Sbjct: 1086 GGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKGSQFIVVSLK 1145

Query: 1337 NNMFELAQRL 1346
              MF  A R+
Sbjct: 1146 EGMFTNANRV 1155

 Score = 33.1 bits (74), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 40/155 (25%), Positives = 70/155 (45%), Gaps = 8/155 (5%)

Query: 482  QAELEKMKLALSDKTGDITKEVAVLEKELEPWTNKVEEKKSEIKLVESEISIIKEADLKL 541
            Q  LE  + +L +  G    E+  ++ EL+   +++ +   E+K +++ I    EA    
Sbjct: 849  QQTLEGERRSLEENLGMNQTELDNVQVELKAEQSRLVDINEELKELDTVIKTKTEAKNNY 908

Query: 542  ESEIANLSQEIEQLRGNISHREESIETLNVESSSIRDYILVGERECTSARSKLEEMKKVL 601
            E E+  LS ++ + + N S   E I +L  E   ++D  LV      S    LE+MKK +
Sbjct: 909  ELELQKLSNDLNKFKNNSSSIYEKISSLEQEHDWLKDGALVAGIIQQSGEVNLEQMKKRV 968

Query: 602  VTHRQRVNDAR--------SAVSSAENKNKVLTAL 628
               +++  D R        S + S E K   L A+
Sbjct: 969  EHLQKQFQDMRRKVNPNIMSMIESVEKKEAALKAM 1003

>Kpol_1063.20 s1063 (46233..49748) [3516 bp, 1171 aa] {ON}
           (46233..49748) [3516 nt, 1172 aa]
          Length = 1171

 Score = 95.1 bits (235), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 58/191 (30%), Positives = 98/191 (51%), Gaps = 15/191 (7%)

Query: 108 IRTLVLENFKSYAGRQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFAFGFRA-NKMRQGKL 166
           +  L+++ FKSYA R V+  +   F+A+ G NGSGKSN++D++ F  G  +   +R   L
Sbjct: 3   VEELIIDGFKSYATRTVISDWDPQFNAITGLNGSGKSNILDAICFVLGISSMATVRASNL 62

Query: 167 SHLIHKSEKYPDLDFCSVEIQFQYVVDEPDGTTRVLS--GKPELSVMRKAFKNNTSKYYL 224
             LI+K  +   +   SV I F    D  D +   +     P +SV R+     TSKY +
Sbjct: 63  QDLIYKRGQ-AGVTKASVTIVF----DNSDKSNAPIGFESSPTISVTRQVALGGTSKYLI 117

Query: 225 NGKESTYTEVTRLLRDEGIDLDHKRFLILQGEVESIAQMKPKAEHEGDDGLLEYLEDIIG 284
           NG  +    V  L +   +++++  FLI+QG++  +  MKP         +L  +E+  G
Sbjct: 118 NGHRAPQQSVLHLFQSVQLNINNPNFLIMQGKITKVLNMKPTE-------ILSLIEEAAG 170

Query: 285 TTKYKAQIEQA 295
           T  ++ + E+A
Sbjct: 171 TKMFEDRREKA 181

 Score = 82.4 bits (202), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 57/79 (72%), Gaps = 1/79 (1%)

Query: 1269 WR-NISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1327
            W+ ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLVELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1328 AQFIVISLRNNMFELAQRL 1346
            +QFIV+SL+  MF  A R+
Sbjct: 1137 SQFIVVSLKEGMFTNANRV 1155

 Score = 48.1 bits (113), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 53/204 (25%), Positives = 90/204 (44%), Gaps = 18/204 (8%)

Query: 637 IDGYHGRLGDLGTIDDKYDIAIS---TACPRLDDIVVDTVECGQQCIEHLRKNKLGYARF 693
           + G   RL  L   ++ Y  A +    A  RL ++VVD  +   Q ++  R  K      
Sbjct: 523 VKGVAARLFHLN--ENNYSSATALQVCAGGRLYNVVVDNEKTASQLLQRGRLRK--RVTI 578

Query: 694 ILLDKL-------RKFNLQPAHTPENVPRLFDLVKPKEPKFAPAFYSVLRDTLVTTDLSQ 746
           I L+K+       +  N+    +P NV    +L+  +E   A A   +   +L+  D   
Sbjct: 579 IPLNKIMARKLNDKTLNIAKEISPGNVELALNLIGYEED-VAKAMEFIFGSSLICKDAET 637

Query: 747 ANRVAYGKK-RYRVVTLDGKLIDISGTMTGGGDRAASGLMKSTQQSSLYTPEEVQRMEEE 805
           A +V +  + R R +TL G + D  GT++GG     S L+   Q+ +    ++   ++EE
Sbjct: 638 AKKVTFHPQVRTRSITLQGDVYDPEGTLSGGSRNMNSSLLVDIQKYN-EASKQTYVLQEE 696

Query: 806 LNEREKNFKVAFETFQEMESALQN 829
           L+  ++   VA E   E    LQN
Sbjct: 697 LSVIQERL-VALERVYEGTRVLQN 719

>TBLA0G03530 Chr7 complement(941941..945639) [3699 bp, 1232 aa] {ON}
           Anc_8.68 YFL008W
          Length = 1232

 Score = 95.1 bits (235), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 58/184 (31%), Positives = 95/184 (51%), Gaps = 19/184 (10%)

Query: 111 LVLENFKSYAGRQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFAFGFRANKMRQGKLSHLI 170
           L L NFKSY G   +G   S+F++++GPNGSGKSN++D++ F  G R+N +R   +  LI
Sbjct: 7   LELSNFKSYKGTVKIGFGDSNFTSIIGPNGSGKSNMMDAISFVLGVRSNDLRSSGMKDLI 66

Query: 171 HKS---EKYPDLDFCSVEIQFQYVVDEPDGTTRVLSGKPELSVMRKAFKNNTSKYYLNGK 227
           H+S    +  + D  S  ++  Y V +    T          +MR    +  + Y +NGK
Sbjct: 67  HRSVRDSQSSNDDPTSAYVKAFYKVTDASEITE---------LMRIVNLSGETIYKINGK 117

Query: 228 ESTYTEVTRLLRDEGIDLDHKRFLILQGEVESIAQMKPKAEHEGDDGLLEYLEDIIGTTK 287
            +++   +  L  E I +  K FL+ QG+VE+IA        +    L +  E + G+ +
Sbjct: 118 TTSFKNYSDWLAKENILIKAKNFLVFQGDVETIAS-------QSSLELTKLFEQVSGSIQ 170

Query: 288 YKAQ 291
           YK +
Sbjct: 171 YKKE 174

>Suva_6.52 Chr6 (91156..94950) [3795 bp, 1264 aa] {ON} YFL008W
           (REAL)
          Length = 1264

 Score = 94.0 bits (232), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 60/202 (29%), Positives = 100/202 (49%), Gaps = 11/202 (5%)

Query: 111 LVLENFKSYAGRQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFAFGFRANKMRQGKLSHLI 170
           L L NFKSY G   VG   S+F++++GPNGSGKSN++D++ F  G R+N +R   L  LI
Sbjct: 43  LELSNFKSYRGITKVGFGESNFTSIIGPNGSGKSNMMDAISFVLGVRSNHLRSNILKDLI 102

Query: 171 HKS--EKYPDLDFCSVEIQFQYVVDEPDGTTRVL--SGKPELSVMRKAFKNNTSKYYLNG 226
           ++   +   D +  S         +      +     G   + + R   +N  + Y ++G
Sbjct: 103 YRGVLDDGNDENIDSGADDNAITSNPNSAYVKAFYQKGNKLVELTRLISRNGDTTYKIDG 162

Query: 227 KESTYTEVTRLLRDEGIDLDHKRFLILQGEVESIAQMKPKAEHEGDDGLLEYLEDIIGTT 286
           K  TY + +  L +E I +  K FL+ QG+VE IA   P         L    E++ G+ 
Sbjct: 163 KTVTYKDYSIFLENENILIKAKNFLVFQGDVEQIAAQSPT-------DLSRMFEEVSGSI 215

Query: 287 KYKAQIEQALVEVDSLNDICME 308
           +YK + ++   +++ L+    E
Sbjct: 216 QYKKEYDELKEKIEKLSKSATE 237

>TPHA0C04440 Chr3 complement(958279..961791) [3513 bp, 1170 aa] {ON}
           Anc_7.186 YFR031C
          Length = 1170

 Score = 93.6 bits (231), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 83/271 (30%), Positives = 134/271 (49%), Gaps = 27/271 (9%)

Query: 111 LVLENFKSYAGRQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFAFGFRA-NKMRQGKLSHL 169
           L+++ FKSYA R V+  +   F+A+ G NGSGKSN++D++ F  G  + + +R   L  L
Sbjct: 6   LIIDGFKSYATRTVISEWDPQFNAITGLNGSGKSNILDAICFVLGISSMSTVRASNLQDL 65

Query: 170 IHKSEKYPDLDFCSVEIQFQYVVDEPDGTTRVLSGKPEL--SVMRKAFKNNTSKYYLNGK 227
           I+K  +   +   SV I F    D  D +   +  +  L  SV R+     TSKY +NG 
Sbjct: 66  IYKRGQ-AGVTKASVTIVF----DNSDKSKAPIGFETSLTISVTRQIVLGGTSKYLINGH 120

Query: 228 ESTYTEVTRLLRDEGIDLDHKRFLILQGEVESIAQMKPKAEHEGDDGLLEYLEDIIGTTK 287
            +    V  L +   +++++  FLI+QG++  +  MKP         +L  +E+  GT  
Sbjct: 121 RAPQQSVLHLFQSVQLNINNPNFLIMQGKITKVLNMKPTE-------ILALIEEAAGTKM 173

Query: 288 YKAQIEQALVEVDSLNDICMEKENRFDLVEK-----EKLSLEPGKDEALAFLKKEKDL-- 340
           ++ + E+A+  +         +ENR  L E+     EKL LE  K   L F + + DL  
Sbjct: 174 FEDRREKAIRTMAKKETKL--QENRTLLKEEIEPKLEKLRLE--KRTFLDFQETQTDLEE 229

Query: 341 TLLMSKKYQYHLFHNGSKLAK-TLSNVSNTM 370
           T  +   Y YH   +  +L K TLS+  N +
Sbjct: 230 TDRVVNAYDYHRLKSQKELFKETLSSKENKI 260

 Score = 82.4 bits (202), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 35/81 (43%), Positives = 58/81 (71%), Gaps = 1/81 (1%)

Query: 1267 KSWR-NISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT 1325
            K W+ ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R 
Sbjct: 1075 KLWKESLVELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRF 1134

Query: 1326 KNAQFIVISLRNNMFELAQRL 1346
            K +QFIV+SL+  MF  A R+
Sbjct: 1135 KGSQFIVVSLKEGMFNNANRV 1155

>TBLA0D04610 Chr4 complement(1139885..1143409) [3525 bp, 1174 aa]
           {ON} Anc_7.186 YFR031C
          Length = 1174

 Score = 93.2 bits (230), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 57/191 (29%), Positives = 98/191 (51%), Gaps = 15/191 (7%)

Query: 108 IRTLVLENFKSYAGRQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFAFGFRA-NKMRQGKL 166
           +  L+++ FKSYA R V+  +   F+A+ G NGSGKSN++D++ F  G  +   +R   L
Sbjct: 3   VEELIIDGFKSYATRTVISDWDPQFNAITGLNGSGKSNILDAICFVLGISSMTTVRASNL 62

Query: 167 SHLIHKSEKYPDLDFCSVEIQFQYV--VDEPDGTTRVLSGKPELSVMRKAFKNNTSKYYL 224
             LI+K  +   +   SV I F      + P G     +  P +SV R+     TSKY +
Sbjct: 63  QDLIYKRGQ-AGVTKASVTIVFDNTDKSNSPIG----FNTSPRISVTRQIVIGGTSKYLI 117

Query: 225 NGKESTYTEVTRLLRDEGIDLDHKRFLILQGEVESIAQMKPKAEHEGDDGLLEYLEDIIG 284
           NG  +    V +L +   +++++  FLI+QG++  +  MK          +L  +E+  G
Sbjct: 118 NGHRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMKSTE-------ILSLIEEAAG 170

Query: 285 TTKYKAQIEQA 295
           T  ++ + E+A
Sbjct: 171 TKMFEDRKEKA 181

 Score = 83.2 bits (204), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 57/79 (72%), Gaps = 1/79 (1%)

Query: 1269 WR-NISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1327
            W+ ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1081 WKESLVELSGGQRSLVALSLILALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1140

Query: 1328 AQFIVISLRNNMFELAQRL 1346
            AQFIV+SL+  MF  A R+
Sbjct: 1141 AQFIVVSLKEGMFTNANRV 1159

>Smik_6.71 Chr6 (132627..136313) [3687 bp, 1228 aa] {ON} YFL008W
           (REAL)
          Length = 1228

 Score = 92.4 bits (228), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 61/202 (30%), Positives = 101/202 (50%), Gaps = 11/202 (5%)

Query: 111 LVLENFKSYAGRQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFAFGFRANKMRQGKLSHLI 170
           L L NFKSY G   VG   S+F++++GPNGSGKSN++D++ F  G R+N +R   L  LI
Sbjct: 7   LELSNFKSYRGITKVGFGESNFTSIIGPNGSGKSNMMDAISFVLGVRSNHLRSNILKDLI 66

Query: 171 HKSEKYPDLDFCSVEIQFQYVVDEPDGTTRVLS----GKPELSVMRKAFKNNTSKYYLNG 226
           ++     D D    +     V      +  V +    G   + +MR   +N  + Y ++ 
Sbjct: 67  YRGVLNDDNDDNYNDTSDDDVASSNPKSAYVKAFYQKGNKMVELMRIISRNGDTSYKIDE 126

Query: 227 KESTYTEVTRLLRDEGIDLDHKRFLILQGEVESIAQMKPKAEHEGDDGLLEYLEDIIGTT 286
           K  +Y + +  L +E I +  K FL+ QG+VE IA   P         L    E++ G+ 
Sbjct: 127 KTVSYKDYSIFLENENILIKAKNFLVFQGDVEQIAAQSPIE-------LSRMFEEVSGSI 179

Query: 287 KYKAQIEQALVEVDSLNDICME 308
           +YK + ++   +++ L+    E
Sbjct: 180 QYKKEYDELKEKIEKLSKSATE 201

>KNAG0L01160 Chr12 complement(206434..209946) [3513 bp, 1170 aa]
           {ON} Anc_7.186 YFR031C
          Length = 1170

 Score = 92.0 bits (227), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 56/191 (29%), Positives = 100/191 (52%), Gaps = 15/191 (7%)

Query: 108 IRTLVLENFKSYAGRQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFAFGFRA-NKMRQGKL 166
           +  L+++ FKSYA R V+  + + F+A+ G NGSGKSN++D++ F  G  + + +R   +
Sbjct: 3   VEELIIDGFKSYATRTVISGWDAQFNAITGLNGSGKSNILDAICFVLGISSMSTVRASNM 62

Query: 167 SHLIHKSEKYPDLDFCSVEIQFQYVVDEPDGTTRVLSGKPEL--SVMRKAFKNNTSKYYL 224
             LI+K  +   +   SV I F    D  D +   +     L  SV R+     TSKY +
Sbjct: 63  QDLIYKRGQ-AGVTKASVTIVF----DNSDKSNSPIGFNDSLKISVTRQIVLGGTSKYLI 117

Query: 225 NGKESTYTEVTRLLRDEGIDLDHKRFLILQGEVESIAQMKPKAEHEGDDGLLEYLEDIIG 284
           NG  +    V +L +   +++++  FLI+QG++  +  M+P         +L  +E+  G
Sbjct: 118 NGHRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMRPSE-------ILSLIEEAAG 170

Query: 285 TTKYKAQIEQA 295
           T  ++ + E+A
Sbjct: 171 TKMFEDRREKA 181

 Score = 81.6 bits (200), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 57/79 (72%), Gaps = 1/79 (1%)

Query: 1269 WR-NISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1327
            W+ ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLIELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1328 AQFIVISLRNNMFELAQRL 1346
            +QFIV+SL+  MF  A R+
Sbjct: 1137 SQFIVVSLKEGMFTNANRV 1155

>KLLA0D16005g Chr4 complement(1346492..1350004) [3513 bp, 1170 aa]
           {ON} similar to uniprot|P38989 Saccharomyces cerevisiae
           YFR031C SMC2 Component of the condensin complex
           essential SMC chromosomal ATPase family member that
           forms a complex with Smc4p to form the active ATPase
           Smc2p/Smc4p complex binds DNA possibly in the cleft
           formed by the coiled-coil of the folded dimer
          Length = 1170

 Score = 89.7 bits (221), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 55/191 (28%), Positives = 98/191 (51%), Gaps = 15/191 (7%)

Query: 108 IRTLVLENFKSYAGRQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFAFGFRA-NKMRQGKL 166
           +  L+++ FKSYA R V+  +   F+A+ G NGSGKSN++D++ F  G  +   +R   L
Sbjct: 3   VEELIIDGFKSYATRTVITDWDPQFNAITGLNGSGKSNILDAICFVLGISSMATVRAQNL 62

Query: 167 SHLIHKSEKYPDLDFCSVEIQFQY--VVDEPDGTTRVLSGKPELSVMRKAFKNNTSKYYL 224
             LI+K  +   +   SV I F      + P G         ++S+ R+      SKY +
Sbjct: 63  QDLIYKRGQ-AGVTKASVTIVFNNSDTSNSPIG----FESHAKISITRQIILGGVSKYLI 117

Query: 225 NGKESTYTEVTRLLRDEGIDLDHKRFLILQGEVESIAQMKPKAEHEGDDGLLEYLEDIIG 284
           NG  +    V +L +   +++++  FLI+QG++  +  MKP+        +L  +E+  G
Sbjct: 118 NGHRAQQQTVLQLFQSVQLNINNPNFLIMQGKITKVLNMKPQE-------ILSLIEEAAG 170

Query: 285 TTKYKAQIEQA 295
           T  ++ + E+A
Sbjct: 171 TRMFEDRREKA 181

 Score = 69.7 bits (169), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 36/81 (44%), Positives = 58/81 (71%), Gaps = 1/81 (1%)

Query: 1267 KSWR-NISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT 1325
            K W+ ++  LSGG+++L +L+L+ AL ++KP P+Y++DE+DAALD  +   + + IK R 
Sbjct: 1075 KIWKESLVELSGGQRSLIALSLILALLQFKPAPMYILDEVDAALDLSHTQNIGHLIKTRF 1134

Query: 1326 KNAQFIVISLRNNMFELAQRL 1346
            K +QFIV+SL+  MF  A R+
Sbjct: 1135 KGSQFIVVSLKEGMFTNANRV 1155

>SAKL0B02288g Chr2 (215750..219436) [3687 bp, 1228 aa] {ON} similar
           to uniprot|P32908 Saccharomyces cerevisiae YFL008W SMC1
           Subunit of the multiprotein cohesin complex essential
           protein involved in chromosome segregation and in
           double-strand DNA break repair SMC chromosomal ATPase
           family member binds DNA with a preference for DNA with
           secondary structure
          Length = 1228

 Score = 87.8 bits (216), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 62/206 (30%), Positives = 101/206 (49%), Gaps = 20/206 (9%)

Query: 111 LVLENFKSYAGRQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFAFGFRANKMRQGKLSHLI 170
           L L NFKSY G   VG   ++F++++GPNGSGKSN++D++ F  G R++ +R   L  L+
Sbjct: 7   LELSNFKSYKGTVKVGFGDANFTSIIGPNGSGKSNMMDAISFVLGVRSSHLRSHLLMDLV 66

Query: 171 HKSEKYPD-LDFCSVEIQFQYVVDEPDGTTRVLSGK----PELSVMRKAFKNNTSKYYLN 225
           ++  +  D  +    E     +        +    K      +  MR   ++  S Y +N
Sbjct: 67  YRGRRTGDEEESMEEEPSSSKISSTRSAYVKAFYLKEGEESPIEFMRTISRSGESAYKVN 126

Query: 226 GKESTYTEVTRLLRDEGIDLDHKRFLILQGEVESIAQMKPKAEHEGDDGLLEYLEDIIGT 285
           GK   Y + T +L  E I +  + FL+ QG+VE IA     ++  G+  L +  E I G+
Sbjct: 127 GKTVGYKDYTDILEKENILIKARNFLVFQGDVEQIA-----SQSAGE--LTKLFEQISGS 179

Query: 286 TKYKAQIE--------QALVEVDSLN 303
            +YK + E         A+   DSL+
Sbjct: 180 VQYKREYEILNDEYKAAAMATADSLS 205

>KLTH0A02706g Chr1 complement(234723..238409) [3687 bp, 1228 aa]
           {ON} similar to uniprot|P32908 Saccharomyces cerevisiae
           YFL008W SMC1 Subunit of the multiprotein cohesin complex
           essential protein involved in chromosome segregation and
           in double-strand DNA break repair SMC chromosomal ATPase
           family member binds DNA with a preference for DNA with
           secondary structure
          Length = 1228

 Score = 85.5 bits (210), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 55/192 (28%), Positives = 93/192 (48%), Gaps = 22/192 (11%)

Query: 113 LENFKSYAGRQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFAFGFRANKMRQGKLSHLIHK 172
           L NFKSY G+  +G   S+F++V+GPNGSGKSN++D++ F  G ++  +R   L+ LI++
Sbjct: 9   LYNFKSYKGKVSIGFGESNFTSVIGPNGSGKSNLMDAISFVLGMKSIHLRSHTLADLIYR 68

Query: 173 SE-KYPDLDFCSVEIQ---------FQYVVDEPDGTTRVLSGKPELSVMRKAFKNNTSKY 222
              +  D D    E           +      P G    ++      + R    +  S Y
Sbjct: 69  GTLQDGDADSGYSETHDNENNPSSAYVKAFYSPSGQENDVA-----ELTRTITLSQESTY 123

Query: 223 YLNGKESTYTEVTRLLRDEGIDLDHKRFLILQGEVESIAQMKPKAEHEGDDGLLEYLEDI 282
            LNG+  ++ +    L  E I +  + FL+ QG+VE +A  KP+        L    E +
Sbjct: 124 KLNGETVSHKKYCDFLESENILIKARNFLVFQGDVEQVASQKPRE-------LTTLFEQV 176

Query: 283 IGTTKYKAQIEQ 294
            G+ +YK + ++
Sbjct: 177 SGSIQYKQEYDR 188

>SAKL0D06116g Chr4 complement(503196..506885) [3690 bp, 1229 aa] {ON}
            similar to uniprot|P47037 Saccharomyces cerevisiae
            YJL074C SMC3 Subunit of the multiprotein cohesin complex
            required for sister chromatid cohesion in mitotic cells
            also required with Rec8p for cohesion and recombination
            during meiosis phylogenetically conserved SMC chromosomal
            ATPase family member
          Length = 1229

 Score = 84.0 bits (206), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 39/100 (39%), Positives = 61/100 (61%)

Query: 1271 NISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQF 1330
            ++  LSGG+KT+ ++AL+ A+ K  P P Y+ DEIDAALD +  + VAN IKE + NAQF
Sbjct: 1119 HVEQLSGGQKTVCAIALILAIQKVDPAPFYLFDEIDAALDKQYRTSVANTIKELSANAQF 1178

Query: 1331 IVISLRNNMFELAQRLVGIYKNSNMTRSTTLQNRDIINVL 1370
            I  + R++M  +A     +   + ++    +  RD IN +
Sbjct: 1179 ICTTFRSDMLRVADVFYRVKYENKISTVAEVSQRDAINFI 1218

 Score = 68.9 bits (167), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 49/203 (24%), Positives = 94/203 (46%), Gaps = 20/203 (9%)

Query: 106 LCIRTLVLENFKSYAGRQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFAFGFRANKMRQGK 165
           + I+ + ++ FK+Y    ++  F    + V+G NGSGKSN   ++ F      N +++ +
Sbjct: 1   MYIKRVTIQGFKTYKNTTLIDNFSPHHNVVIGSNGSGKSNFFAAIRFVLSDDYNNLKREE 60

Query: 166 LSHLIHKSEKYPDLDFCSVEIQFQYVVDEPDGTTRVLSG-----KPELSVMRKAFKNNTS 220
              LIH+      +    VEI F    D  DG  R+L+       P+  V+R+       
Sbjct: 61  RQGLIHQGS--GSVMSAYVEIVF----DNSDG--RLLNAAASPSSPDEVVIRRTIGLKKD 112

Query: 221 KYYLNGKESTYTEVTRLLRDEGIDLDHKRFLILQGEVESIAQMKPKAEHEGDDGLLEYLE 280
           +Y LN K  +  E+  LL   G    +  +++ QG + ++   K       D   L+ L+
Sbjct: 113 EYSLNSKSCSKIEIKNLLESAGFSTANPYYIVPQGRIVALTNAK-------DYERLQLLK 165

Query: 281 DIIGTTKYKAQIEQALVEVDSLN 303
           ++ G   ++ ++  +L ++D+ N
Sbjct: 166 EVTGANSFEKKLRDSLNKMDATN 188

>CAGL0D05258g Chr4 (500858..504370) [3513 bp, 1170 aa] {ON} similar to
            uniprot|P38989 Saccharomyces cerevisiae YFR031c SMC2
            chromosome segregation protein
          Length = 1170

 Score = 82.4 bits (202), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 57/79 (72%), Gaps = 1/79 (1%)

Query: 1269 WR-NISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1327
            W+ ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLVELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1328 AQFIVISLRNNMFELAQRL 1346
            +QFIV+SL+  MF  A R+
Sbjct: 1137 SQFIVVSLKEGMFTNANRV 1155

 Score = 52.0 bits (123), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 78/298 (26%), Positives = 136/298 (45%), Gaps = 35/298 (11%)

Query: 653 KYDIAIS-TACPRLDDIVVDTVECGQQCIEHLRKNKLGYARFILLDKL-------RKFNL 704
           KY I +   A  RL +++VD  + G   ++  R  K      I LDK+        K  L
Sbjct: 539 KYVIGLQICAGGRLYNVIVDNEKTGSALLQKGRLRK--RVTIIPLDKVISRPLNQNKLKL 596

Query: 705 QPAHTPENVPRLFDLVKPKEPKFAPAFYSVLRDTLVTTDLSQANRVAYGKK-RYRVVTLD 763
                P  V    +L+   + +   A   +  ++L+  D   A ++ +    R R +TL+
Sbjct: 597 AKQLAPGKVELALNLIGYSD-EVVKAMEFIFGNSLICDDAETAKKITFNPGIRTRSITLE 655

Query: 764 GKLIDISGTMTGGGDRAASGLMKSTQQSSLYTPEEVQRMEEELNEREKNFKVAFETFQEM 823
           G + D  GT++GG     + L+   QQ +    +E+  M EE     K  K+  E     
Sbjct: 656 GDIYDPEGTLSGGTRNNTNTLLVDIQQYNTL-KKELLAMNEEKQNIHKQLKI-LEAKSNE 713

Query: 824 ESALQNYLDRQPEIEVELSKQKMDI--ETISAELESKIE-RKLELERSNKTSIEDSS--- 877
            S LQ         E+ L K ++DI   T+++E    ++ R  E+E   KT +EDS+   
Sbjct: 714 TSNLQK--------ELSLKKHRLDILERTMNSEPSLMMQNRNGEIENEVKT-LEDSTKQK 764

Query: 878 --ELRTAEEKLAALNADLNSFMSASESKNQRIKELRAKIMEIGGLELQTLNSKVDSLN 933
             E  + E ++  L  D+  F   S++K  ++KEL+A++ E+   +++ L S+ + LN
Sbjct: 765 MLENSSLEAEIEKLRKDMVDF---SKNKGAKLKELKAEVHELNE-QIKDLESESEKLN 818

>ZYRO0G21296g Chr7 (1747217..1750900) [3684 bp, 1227 aa] {ON} similar
            to uniprot|P47037 Saccharomyces cerevisiae YJL074C SMC3
            Subunit of the multiprotein cohesin complex required for
            sister chromatid cohesion in mitotic cells also required
            with Rec8p for cohesion and recombination during meiosis
            phylogenetically conserved SMC chromosomal ATPase family
            member
          Length = 1227

 Score = 82.4 bits (202), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 42/106 (39%), Positives = 67/106 (63%), Gaps = 3/106 (2%)

Query: 1250 SLDPFSEGVLFSVM--PPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDA 1307
            S++    GV  SV     K   +++  LSGG+KT+ ++AL+ A+   +P P Y+ DEIDA
Sbjct: 1096 SVEAMYSGVSISVSFNSKKNEQQHVEQLSGGQKTVCAVALILAIQMVEPAPFYLFDEIDA 1155

Query: 1308 ALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQRLVGI-YKN 1352
            ALD +  + VA+ IKE ++NAQFI  + R++M E+A +   + Y+N
Sbjct: 1156 ALDKQYRTAVASTIKELSENAQFICTTFRSDMLEVADKFYRVKYEN 1201

 Score = 67.4 bits (163), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 49/201 (24%), Positives = 93/201 (46%), Gaps = 21/201 (10%)

Query: 106 LCIRTLVLENFKSYAGRQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFAFGFRANKMRQGK 165
           + IR +V++ FK+Y    ++  F    + V+G NGSGKSN   ++ F        +++ +
Sbjct: 1   MYIRRVVIKGFKTYRNETIIDNFSPHHNIVIGSNGSGKSNFFAAIRFVLSNDYANLKREE 60

Query: 166 LSHLIHKSEKYPDLDFCSVEIQFQYVVDEPDGTTRVL--SGKP----ELSVMRKAFKNNT 219
              LIH+      +   SVEI F       D + R++  SG P    +   +R+      
Sbjct: 61  RQGLIHQGS--GSVMSASVEIVFH------DPSHRIILPSGIPPRENDEVFVRRTVGLKK 112

Query: 220 SKYYLNGKESTYTEVTRLLRDEGIDLDHKRFLILQGEVESIAQMKPKAEHEGDDGLLEYL 279
             Y LN +  T ++V R+L   G  + +   ++ QG + ++   K       D   L  L
Sbjct: 113 DDYQLNDRNVTKSDVVRMLESAGFSMSNPYNIVPQGRIVALTNAK-------DRERLHLL 165

Query: 280 EDIIGTTKYKAQIEQALVEVD 300
           E+++G   ++ ++  +L ++D
Sbjct: 166 EEVVGAKSFEVKLRASLKKMD 186

>Kpol_1018.2 s1018 complement(5901..9536) [3636 bp, 1211 aa] {ON}
            complement(5901..9536) [3636 nt, 1212 aa]
          Length = 1211

 Score = 82.0 bits (201), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 52/202 (25%), Positives = 102/202 (50%), Gaps = 18/202 (8%)

Query: 1187 YRRRRIDLNEAIMKRDETRMHC----EVLKKRRLDEFMEGFGIISITLKEMYQMITMGGN 1242
            +  ++I+LNE   + D++++      E LK++++      F  +S     +++ +   G 
Sbjct: 1001 FNEKKIELNERAAELDDSKVSIQNLIEKLKQQKVTAVDSTFKKVSENFSTVFEKLVPRGT 1060

Query: 1243 AELEL------------VDSLDPFSEGVLFSVM--PPKKSWRNISNLSGGEKTLSSLALV 1288
            A+L +             +S +    G+  SV     K    ++  LSGG+KT+ ++AL+
Sbjct: 1061 AKLIIHRQEENKTRSKDKNSTESIYSGISISVSFNSKKNEQLHVEQLSGGQKTVCAIALI 1120

Query: 1289 FALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQRLVG 1348
             A+    P P Y+ DEIDAALD +  + VA+ IK  + NAQFI  + R +M ++A +   
Sbjct: 1121 LAIQMVDPAPFYLFDEIDAALDKQYRAAVADVIKSLSGNAQFICTTFRTDMLQVADKFFR 1180

Query: 1349 IYKNSNMTRSTTLQNRDIINVL 1370
            +   + ++    ++ ++ IN +
Sbjct: 1181 VKYENKISTVVEVERQEAINFI 1202

 Score = 48.5 bits (114), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 40/142 (28%), Positives = 63/142 (44%), Gaps = 5/142 (3%)

Query: 638 DGYHGRLGDLGTIDDKYD-IAISTACPRLDDIVVDTVECGQQCIEHLRKNKLGYARFILL 696
           D   G LG+L  + +KY   A       L ++VVDT E     +  L   K G   F+ L
Sbjct: 533 DAVFGTLGELIKVSEKYKRCAEVIGGNSLFNVVVDTEETATIIMNELYHMKGGRVTFMPL 592

Query: 697 DKLRKFNLQPAHTPENVPRLFDLVKP--KEPKFAPAFYSVLRDTLVTTDLSQANRVAYGK 754
           +++   N    + P        L+K    + ++  A   +   T+V  DL + +++A  K
Sbjct: 593 NRIHVDN-NITYPPNEQASCTPLIKKIKYDVRYEKAVKHIFGRTIVVKDLLEGSKIA-KK 650

Query: 755 KRYRVVTLDGKLIDISGTMTGG 776
            +   VTLDG   D  G +TGG
Sbjct: 651 LKLNAVTLDGDRADKMGVLTGG 672

>KAFR0A01610 Chr1 complement(326620..330303) [3684 bp, 1227 aa] {ON}
            Anc_1.295 YJL074C
          Length = 1227

 Score = 81.6 bits (200), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 42/103 (40%), Positives = 63/103 (61%), Gaps = 3/103 (2%)

Query: 1253 PFSEGVLFSVMPPKKS--WRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALD 1310
            P   GV  SV    K+    ++  LSGG+KT+ ++AL+ A+    P P Y+ DEIDAALD
Sbjct: 1099 PMYTGVSISVSFNSKNDEQLHVEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALD 1158

Query: 1311 FRNVSIVANYIKERTKNAQFIVISLRNNMFELAQRLVGI-YKN 1352
             +  + VAN +KE +KNAQFI  + R +M ++A +   + Y+N
Sbjct: 1159 KQYRTAVANTLKELSKNAQFICTTFRTDMLQVADKFFRVKYEN 1201

 Score = 72.0 bits (175), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 53/233 (22%), Positives = 112/233 (48%), Gaps = 25/233 (10%)

Query: 106 LCIRTLVLENFKSYAGRQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFAFGFRANKMRQGK 165
           + I+ ++++ FK+Y    ++  F    + ++G NGSGKSN+  ++ F      + +++ +
Sbjct: 1   MYIKRVIIKGFKTYRNETIIDNFSPHHNIIIGSNGSGKSNLFAAIRFVLSDDYSNLKREE 60

Query: 166 LSHLIHK-SEKYPDLDFCSVEIQFQYVVDEPDGTTRVLSG-----KPELSV-MRKAFKNN 218
              LIH+ +     +  CSVEI F     +PD    + S      +P   V +R+     
Sbjct: 61  RQGLIHQGTSGGSSVMSCSVEIVFH----DPDNRMILASNASIVPRPNNEVFIRRTVGLK 116

Query: 219 TSKYYLNGKESTYTEVTRLLRDEGIDLDHKRFLILQGEVESIAQMKPKAEHEGDDGLLEY 278
              Y +N +  T +++ R+L   G  + +   ++ QG++ ++   K K         L+ 
Sbjct: 117 KDDYQINDRNVTKSDIVRILETAGFSMSNPYNIVPQGKIIALTNAKDKER-------LQL 169

Query: 279 LEDIIGTTKYKAQIEQALVEV-------DSLNDICMEKENRFDLVEKEKLSLE 324
           LED++G   ++ ++  +L ++        +++    E +N+ + +E EKL LE
Sbjct: 170 LEDVVGAKSFEIKLNDSLKKIKETEFKKSTIDKELSELKNKLNEMEWEKLELE 222

>NCAS0A09330 Chr1 (1844122..1847805) [3684 bp, 1227 aa] {ON} Anc_1.295
            YJL074C
          Length = 1227

 Score = 81.6 bits (200), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 43/127 (33%), Positives = 72/127 (56%), Gaps = 2/127 (1%)

Query: 1246 ELVDSLDPFSEGVLFSVMPPKKSWR--NISNLSGGEKTLSSLALVFALHKYKPTPLYVMD 1303
            E++++ +    GV  SV    K     ++  LSGG+KT+ ++AL+ A+    P P Y+ D
Sbjct: 1092 EVINNNESIYTGVSISVSFNSKENEQLHVEQLSGGQKTVCAIALILAIQMVDPAPFYLFD 1151

Query: 1304 EIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQRLVGIYKNSNMTRSTTLQN 1363
            EIDAALD +  + VAN IK+ + NAQFI  + R +M ++A R   +   + ++    +  
Sbjct: 1152 EIDAALDKQYRTAVANIIKQLSVNAQFICTTFRTDMLQVADRFFRVKYENKISTVIEVDK 1211

Query: 1364 RDIINVL 1370
            +D IN +
Sbjct: 1212 QDAINFI 1218

 Score = 68.9 bits (167), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 49/197 (24%), Positives = 93/197 (47%), Gaps = 19/197 (9%)

Query: 106 LCIRTLVLENFKSYAGRQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFAFGFRANKMRQGK 165
           + I+ +V++ FK+Y  + V+  F    + V+G NGSGKSN   ++ F      + +++ +
Sbjct: 1   MYIKRVVIKGFKTYRNQTVIDDFSPHHNIVIGSNGSGKSNFFSAIRFVLSDDYSNLKREE 60

Query: 166 LSHLIHKSEKYPDLDFCSVEIQFQYVVDEPDGTTRVLSG------KPELSVMRKAFKNNT 219
              LIH+      +   SVEI F     +P+    + SG        E+ + R+      
Sbjct: 61  RQGLIHQGSGGSVMS-ASVEIVFH----DPEHKMILPSGVVPRENNDEICI-RRTVGLKK 114

Query: 220 SKYYLNGKESTYTEVTRLLRDEGIDLDHKRFLILQGEVESIAQMKPKAEHEGDDGLLEYL 279
             Y LN +  T  +V R+L   G  + +   ++ QG++ S+   K K         L+ L
Sbjct: 115 DDYQLNDRNVTKGDVVRMLESTGFSMSNPYNIVPQGKIISLTNAKDKER-------LQLL 167

Query: 280 EDIIGTTKYKAQIEQAL 296
           ED++G   ++ +++ +L
Sbjct: 168 EDVVGAKSFEVKLKASL 184

>Kwal_14.2435 s14 complement(756213..759956) [3744 bp, 1247 aa] {ON}
            YJL074C (SMC3) - SMC chromosomal ATPase family member
            [contig 224] FULL
          Length = 1247

 Score = 80.9 bits (198), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 43/125 (34%), Positives = 69/125 (55%), Gaps = 2/125 (1%)

Query: 1248 VDSLDPFSEGVLFSVMPPKKSWRN--ISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEI 1305
             D+LD    GV  SV    K+     +  LSGG+KT+ ++AL+ A+    P P Y+ DEI
Sbjct: 1114 ADTLDSMYSGVSISVSFNSKNNEQLYVEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEI 1173

Query: 1306 DAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQRLVGIYKNSNMTRSTTLQNRD 1365
            DAALD +  + VAN IKE + +AQFI  + R +M ++A     +   + ++   T+  ++
Sbjct: 1174 DAALDKQYRTSVANTIKELSAHAQFICTTFRTDMLQVADSFYRVKFENKISEIATVSKQE 1233

Query: 1366 IINVL 1370
             I  +
Sbjct: 1234 AIKFI 1238

 Score = 65.5 bits (158), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 45/209 (21%), Positives = 98/209 (46%), Gaps = 17/209 (8%)

Query: 99  KQKKVERLCIRTLVLENFKSYAGRQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFAFGFRA 158
           + +++  + I++++++ FK+Y     V  F   F+ V+G NGSGKSN   ++ F      
Sbjct: 18  RAREIVEMYIQSVLIQGFKTYRNITAVEDFSPHFNVVIGGNGSGKSNFFAAVRFVLSDDY 77

Query: 159 NKMRQGKLSHLIHKSEKYPDLDFCSVEIQFQYVVDEPDGTTRVLSGKP----ELSVMRKA 214
           + +++ +   LIH+      +    VEI F     +P     + SG P     +  +R+ 
Sbjct: 78  SSLKREERQGLIHQG--TGSIMSAYVEIVFH----DPSDQMMMTSGIPVTEEHIVRVRRT 131

Query: 215 FKNNTSKYYLNGKESTYTEVTRLLRDEGIDLDHKRFLILQGEVESIAQMKPKAEHEGDDG 274
                 +Y +NGK    ++++R+    G    +   ++ QG + ++   K K        
Sbjct: 132 IGLKKDEYSVNGKTCHKSDISRMFESVGFSASNPYNIVPQGRIVAVTNAKDKER------ 185

Query: 275 LLEYLEDIIGTTKYKAQIEQALVEVDSLN 303
            L  LED++G   ++ ++ ++  ++++ N
Sbjct: 186 -LLLLEDVVGARSFEIKLRESSKKMEATN 213

>KLTH0H09966g Chr8 complement(859362..863036) [3675 bp, 1224 aa] {ON}
            similar to uniprot|P47037 Saccharomyces cerevisiae
            YJL074C SMC3 Subunit of the multiprotein cohesin complex
            required for sister chromatid cohesion in mitotic cells
            also required with Rec8p for cohesion and recombination
            during meiosis phylogenetically conserved SMC chromosomal
            ATPase family member
          Length = 1224

 Score = 80.5 bits (197), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 42/124 (33%), Positives = 71/124 (57%), Gaps = 2/124 (1%)

Query: 1249 DSLDPFSEGVLFSVMPPKKSWRN--ISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEID 1306
            DS++    GV  SV    K+     +  LSGG+KT+ ++AL+ A+    P P Y+ DEID
Sbjct: 1092 DSIETMYSGVSISVSFNSKNNEQLYVEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEID 1151

Query: 1307 AALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQRLVGIYKNSNMTRSTTLQNRDI 1366
            AALD +  + VAN IKE + +AQFI  + R++M ++A     +  ++ ++  + +  +D 
Sbjct: 1152 AALDKQYRTSVANVIKELSVHAQFICTTFRSDMLQVADSFYRVRFDNKISEISAVSQQDA 1211

Query: 1367 INVL 1370
            I  +
Sbjct: 1212 IRFI 1215

 Score = 65.5 bits (158), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 44/202 (21%), Positives = 94/202 (46%), Gaps = 17/202 (8%)

Query: 106 LCIRTLVLENFKSYAGRQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFAFGFRANKMRQGK 165
           + I+++V++ FK+Y     V      F+ ++G NGSGKSN   ++ F      + +++ +
Sbjct: 1   MYIKSVVIQGFKTYKNTTSVEGLSPRFNVIIGGNGSGKSNFFAAVRFVLSDDYSNLKREE 60

Query: 166 LSHLIHKSEKYPDLDFCSVEIQFQYVVDEPDGTTRVLSGKP----ELSVMRKAFKNNTSK 221
              LIH+      +    VEI F     +P G   + SG P     +  +R+       +
Sbjct: 61  RQGLIHQG--TGSVMSAYVEIIFH----DPSGQMMITSGIPMTEEHIVRVRRTIGLKKDE 114

Query: 222 YYLNGKESTYTEVTRLLRDEGIDLDHKRFLILQGEVESIAQMKPKAEHEGDDGLLEYLED 281
           Y +NGK    ++++R+    G    +   ++ QG + ++   K       D   L  LE+
Sbjct: 115 YSVNGKTCHKSDISRMFESVGFSAVNPYNIVPQGRIVAVTNAK-------DRERLALLEE 167

Query: 282 IIGTTKYKAQIEQALVEVDSLN 303
           ++G   ++ ++ ++  ++++ N
Sbjct: 168 VVGAKSFEIKLRESAKKMEATN 189

>KNAG0B05230 Chr2 complement(1005244..1008921) [3678 bp, 1225 aa] {ON}
            Anc_1.295 YJL074C
          Length = 1225

 Score = 80.1 bits (196), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 44/105 (41%), Positives = 64/105 (60%), Gaps = 3/105 (2%)

Query: 1251 LDPFSEGVLFSV-MPPKKSWR-NISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAA 1308
            L+    GV  SV    KK+ +  +  LSGG+KT+ ++AL+ A+    P P Y+ DEIDAA
Sbjct: 1095 LESVYTGVSISVSFSSKKNEQLRVEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAA 1154

Query: 1309 LDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQRLVGI-YKN 1352
            LD +  + VAN IK+ +KNAQFI  + R +M  +A R   + Y+N
Sbjct: 1155 LDKQYRTSVANAIKKLSKNAQFICTTFRTDMLAVADRFYRVKYEN 1199

 Score = 65.1 bits (157), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 48/195 (24%), Positives = 90/195 (46%), Gaps = 17/195 (8%)

Query: 106 LCIRTLVLENFKSYAGRQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFAFGFRANKMRQGK 165
           + I+ +V++ FK+Y    ++  F    + V+G NGSGKSN   ++ F      + +++ +
Sbjct: 1   MYIKRVVIKGFKTYRNETIIDNFSPHHNIVIGSNGSGKSNFFAAIRFVLSDDYSNLKREE 60

Query: 166 LSHLIHKSEKYPDLDFCSVEIQFQYVVDEPDGTTRVLSG---KPELSV-MRKAFKNNTSK 221
              LIH+      +   SVEI F     +PD    + SG   +P   V +R+        
Sbjct: 61  RQGLIHQGS--GSVMSASVEIVFH----DPDHRIILSSGVIPRPNDEVFVRRTVGLKKDD 114

Query: 222 YYLNGKESTYTEVTRLLRDEGIDLDHKRFLILQGEVESIAQMKPKAEHEGDDGLLEYLED 281
           Y +N +  T +++ R+L   G  +     ++ QG + ++   K K         L  LED
Sbjct: 115 YQINDRNVTKSDLVRMLESAGFSMGSPYNIVPQGRIIALTNAKDKER-------LLLLED 167

Query: 282 IIGTTKYKAQIEQAL 296
           +IG   ++ ++  +L
Sbjct: 168 VIGAKSFETKLRASL 182

>NDAI0G05630 Chr7 complement(1393671..1397360) [3690 bp, 1229 aa] {ON}
            Anc_1.295 YJL074C
          Length = 1229

 Score = 75.9 bits (185), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 40/122 (32%), Positives = 67/122 (54%), Gaps = 2/122 (1%)

Query: 1251 LDPFSEGVLFSVMPPKKSWR--NISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAA 1308
            ++P   GV  SV    K     ++  LSGG+KT+ ++AL+ A+    P P Y+ DEIDAA
Sbjct: 1099 IEPIYTGVSISVSFNSKENEQLHVEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAA 1158

Query: 1309 LDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQRLVGIYKNSNMTRSTTLQNRDIIN 1368
            LD +  + VA  I++ + NAQFI  + R +M E+A     +   + ++    +  ++ IN
Sbjct: 1159 LDKQYRTSVAKLIEKLSANAQFICTTFRTDMLEVADTFFRVKYENKISTVIEIDRQEAIN 1218

Query: 1369 VL 1370
             +
Sbjct: 1219 FI 1220

 Score = 68.9 bits (167), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 50/213 (23%), Positives = 101/213 (47%), Gaps = 18/213 (8%)

Query: 106 LCIRTLVLENFKSYAGRQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFAFGFRANKMRQGK 165
           + I+ +V++ FK+Y    ++  F    + V+G NGSGKSN   ++ F      + +++ +
Sbjct: 1   MYIKRVVIKGFKTYRNETIIDNFSPHHNIVIGSNGSGKSNFFSAIRFVLSDDYSNLKREE 60

Query: 166 LSHLIHKSEKYPDLDFCSVEIQFQ---YVVDEPDGTTRVLSGKPELSVMRKAFKNNTSKY 222
              LIH+      +   SVEI F    + +  P G   V+  + +   +R+        Y
Sbjct: 61  RQGLIHQGSGGAVMS-ASVEIVFHDPNHKIILPSG---VVPRENDEVYIRRTVGLKKDDY 116

Query: 223 YLNGKESTYTEVTRLLRDEGIDLDHKRFLILQGEVESIAQMKPKAEHEGDDGLLEYLEDI 282
            LN +  T  +V R+L   G  +++   ++ QG++ ++   K K         L  LED+
Sbjct: 117 QLNDRNVTKGDVVRMLESTGFSMNNPYNIVPQGKIIALTNAKDKER-------LNLLEDV 169

Query: 283 IGTTKYKAQIEQALVEVDSLNDICMEKENRFDL 315
           +G   ++ +++ +L ++D       +K N+ D+
Sbjct: 170 VGAKSFELKLKASLKKMDE----TEQKRNQIDM 198

>YJL074C Chr10 complement(299157..302849) [3693 bp, 1230 aa] {ON}
            SMC3Subunit of the multiprotein cohesin complex required
            for sister chromatid cohesion in mitotic cells; also
            required, with Rec8p, for cohesion and recombination
            during meiosis; phylogenetically conserved SMC
            chromosomal ATPase family member
          Length = 1230

 Score = 75.9 bits (185), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 74/259 (28%), Positives = 120/259 (46%), Gaps = 43/259 (16%)

Query: 1132 QASVLENGLPKLPDSELARVDLEDLERDIVQLQDYIDNSTVDIEILDEYAKRLAE----Y 1187
            Q  + E GL  LP+  L   D  D+  D  QL   +++   +I  L    KR  E    +
Sbjct: 951  QQRIREIGL--LPEDALVN-DFSDITSD--QLLQRLNDMNTEISGLKNVNKRAFENFKKF 1005

Query: 1188 RRRRIDLNEAIMKRDETRMHCE----VLKKRRLDEFMEGFGIISITLKEMYQMITMGGNA 1243
              RR DL E   + DE++   +     LK+++++     F  +S   + +++ +   G A
Sbjct: 1006 NERRKDLAERASELDESKDSIQDLIVKLKQQKVNAVDSTFQKVSENFEAVFERLVPRGTA 1065

Query: 1244 EL-------------ELVD-SLDPFSE-------------GVLFSVMPPKKSWR--NISN 1274
            +L             E +D  +D  S              GV  SV    K     ++  
Sbjct: 1066 KLIIHRKNDNANDHDESIDVDMDAESNESQNGKDSEIMYTGVSISVSFNSKQNEQLHVEQ 1125

Query: 1275 LSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVIS 1334
            LSGG+KT+ ++AL+ A+    P   Y+ DEIDAALD +  + VA  +KE +KNAQFI  +
Sbjct: 1126 LSGGQKTVCAIALILAIQMVDPASFYLFDEIDAALDKQYRTAVATLLKELSKNAQFICTT 1185

Query: 1335 LRNNMFELAQRLVGI-YKN 1352
             R +M ++A +   + Y+N
Sbjct: 1186 FRTDMLQVADKFFRVKYEN 1204

>TPHA0I01090 Chr9 complement(252902..256552) [3651 bp, 1216 aa] {ON}
            Anc_1.295 YJL074C
          Length = 1216

 Score = 75.1 bits (183), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 36/95 (37%), Positives = 57/95 (60%), Gaps = 1/95 (1%)

Query: 1271 NISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQF 1330
            ++  LSGG+KT+ ++A++ A+    P P Y+ DEIDAALD +  + VA+ IK  + NAQF
Sbjct: 1108 HVEQLSGGQKTVCAIAMILAIQMVDPAPFYLFDEIDAALDKQYRTAVADVIKSLSSNAQF 1167

Query: 1331 IVISLRNNMFELAQRLVGIYKNSNMTRSTTLQNRD 1365
            I  + R +M ++A +   + K  N   +    NRD
Sbjct: 1168 ICTTFRTDMLQVADKFFRV-KYENKISTVVEINRD 1201

 Score = 72.0 bits (175), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 45/195 (23%), Positives = 96/195 (49%), Gaps = 17/195 (8%)

Query: 106 LCIRTLVLENFKSYAGRQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFAFGFRANKMRQGK 165
           + I+ ++++ FK+Y    ++  F   ++ ++G NGSGKSN   ++ F      + +++ +
Sbjct: 1   MYIQKVIIKGFKTYRNETIIDDFSPHYNIIIGSNGSGKSNFFAAIRFVLSDDYSNLKREE 60

Query: 166 LSHLIHKSEKYPDLDFCSVEIQFQYVVDEPDGTTRVLSG---KPELSV-MRKAFKNNTSK 221
              LIH+      +   SVEIQF     +P  +  + SG    P+ +V +R+        
Sbjct: 61  RQGLIHQGS--GSVMSASVEIQFY----DPGNSMILPSGVAVNPDSTVSIRRTVGLKKDD 114

Query: 222 YYLNGKESTYTEVTRLLRDEGIDLDHKRFLILQGEVESIAQMKPKAEHEGDDGLLEYLED 281
           Y +N +  T +++ R++   G  + +   ++ QG + ++   K K         L+ LED
Sbjct: 115 YQINDRNVTKSDIVRMMESTGFSMSNPYNIVPQGRIVALTNAKDKER-------LQILED 167

Query: 282 IIGTTKYKAQIEQAL 296
           ++G   ++A++  +L
Sbjct: 168 VVGAKSFEAKLTASL 182

>Suva_6.149 Chr6 (248275..251967) [3693 bp, 1230 aa] {ON} YJL074C
            (REAL)
          Length = 1230

 Score = 74.7 bits (182), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 72/259 (27%), Positives = 119/259 (45%), Gaps = 43/259 (16%)

Query: 1132 QASVLENGLPKLPDSELARVDLEDLERDIVQLQDYIDNSTVDIEILDEYAKRLAE----Y 1187
            Q  + E GL  LP+  L   D  D+  D  QL   +++   +I  L    KR  E    +
Sbjct: 951  QQRIREIGL--LPEDALVN-DFSDITSD--QLLQKLNDMNTEISSLKNVNKRAFENFKKF 1005

Query: 1188 RRRRIDLNEAIMKRDETRMHCE----VLKKRRLDEFMEGFGIISITLKEMYQMITMGGNA 1243
              +R DL+    + DE++   +     LK++++      F  +S   K +++ +   G A
Sbjct: 1006 NEKRKDLSGRASELDESKDSIQDLIVKLKQQKVSAVDSTFQKVSENFKTVFERLVPRGTA 1065

Query: 1244 ELEL----VDSLDPFSE-----------------------GVLFSVMPPKKSWR--NISN 1274
            +L +     DS+D  ++                       GV  SV    K     ++  
Sbjct: 1066 KLVIHRRNEDSIDQANDVDVDMDTGNNEDTINKEGETVYTGVSISVSFNSKQNEQLHVEQ 1125

Query: 1275 LSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVIS 1334
            LSGG+KT+ ++AL+ A+    P   Y+ DEIDAALD +  + VA  IKE + NAQFI  +
Sbjct: 1126 LSGGQKTVCAIALILAIQMVDPASFYLFDEIDAALDKQYRTAVATMIKELSTNAQFICTT 1185

Query: 1335 LRNNMFELAQRLVGI-YKN 1352
             R +M ++A +   + Y+N
Sbjct: 1186 FRTDMLQVADKFFRVKYEN 1204

 Score = 70.1 bits (170), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 46/195 (23%), Positives = 94/195 (48%), Gaps = 16/195 (8%)

Query: 106 LCIRTLVLENFKSYAGRQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFAFGFRANKMRQGK 165
           + I+ +V++ FK+Y    ++  F    + ++G NGSGKSN   ++ F      + +++ +
Sbjct: 1   MYIKRVVIKGFKTYRNETIIDNFSPHQNVIIGSNGSGKSNFFAAIRFVLSDDYSNLKREE 60

Query: 166 LSHLIHKSEKYPDLDFCSVEIQFQYVVDEPDGT----TRVLSGKPELSVMRKAFKNNTSK 221
              LIH+      +   SVEI F     +PD +    + VLS   +   +R+        
Sbjct: 61  RQGLIHQGSGGSVMS-ASVEIVFH----DPDHSMILPSGVLSRGDDEVTIRRTVGLKKDD 115

Query: 222 YYLNGKESTYTEVTRLLRDEGIDLDHKRFLILQGEVESIAQMKPKAEHEGDDGLLEYLED 281
           Y LN +  T  ++ R+L   G  +++   ++ QG++ ++   K K         L+ LED
Sbjct: 116 YQLNDRNVTKGDIVRMLETAGFSMNNPYNIVPQGKIVALTNAKDKER-------LQLLED 168

Query: 282 IIGTTKYKAQIEQAL 296
           ++G   ++ +++ +L
Sbjct: 169 VVGAKSFEVKLKASL 183

>Ecym_6322 Chr6 (611978..615676) [3699 bp, 1232 aa] {ON} similar to
            Ashbya gossypii AAL182W
          Length = 1232

 Score = 73.6 bits (179), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 40/107 (37%), Positives = 60/107 (56%), Gaps = 3/107 (2%)

Query: 1249 DSLDPFSEGVLFSVM--PPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEID 1306
            D+ D    GV   V     K    ++  LSGG+KT+ ++AL+ A+    P P Y+ DEID
Sbjct: 1093 DNEDSVYSGVSIGVSFNSKKDEQLHVEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEID 1152

Query: 1307 AALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQRLVGI-YKN 1352
            AALD +  + VA  IKE +  AQFI  + R++M  +A +   + Y+N
Sbjct: 1153 AALDKQYRTAVAATIKELSSEAQFICTTFRSDMIGIADKFYRVKYEN 1199

>CAGL0H02805g Chr8 complement(256682..260341) [3660 bp, 1219 aa] {ON}
            similar to uniprot|P47037 Saccharomyces cerevisiae
            YJL074c SMC3 required for structural maintenance of
            chromosomes
          Length = 1219

 Score = 73.2 bits (178), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 40/103 (38%), Positives = 60/103 (58%), Gaps = 4/103 (3%)

Query: 1253 PFSEGVLFSVMPPKKS--WRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALD 1310
            P+ EGV  SV    K      +  LSGG+KT+ ++AL+ A+   +P P Y+ DEIDAALD
Sbjct: 1092 PY-EGVSISVSFNSKQDEQLKVEQLSGGQKTVCAIALILAIQMVEPAPFYLFDEIDAALD 1150

Query: 1311 FRNVSIVANYIKERTKNAQFIVISLRNNMFELAQRLVGI-YKN 1352
             +    VA  I + + NAQFI  + R++M + A +   + Y+N
Sbjct: 1151 KQYRRAVAQTISQLSNNAQFICTTFRSDMVDAANKFYRVKYEN 1193

 Score = 69.7 bits (169), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 44/198 (22%), Positives = 95/198 (47%), Gaps = 13/198 (6%)

Query: 106 LCIRTLVLENFKSYAGRQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFAFGFRANKMRQGK 165
           + I+ ++++ FK+Y    ++G F    + V+G NGSGKSN   ++ F      + +++ +
Sbjct: 1   MYIKRVIIKGFKTYRNETIIGDFSPHHNVVIGANGSGKSNFFAAVRFVLSDDYSNLKREE 60

Query: 166 LSHLIHKSEKYPDLDFCSVEIQF---QYVVDEPDGTTRVLSGKPELSVMRKAFKNNTSKY 222
              LIH+      +   SVEI F   ++ +  P G     +G  +   +R+        Y
Sbjct: 61  RQGLIHQGAGASVMS-ASVEIVFHDPEHSIIAPTGINS--NGSSDEVRIRRTVGLKKDDY 117

Query: 223 YLNGKESTYTEVTRLLRDEGIDLDHKRFLILQGEVESIAQMKPKAEHEGDDGLLEYLEDI 282
            +N +  T  ++ R+L   G  + +   ++ QG + S+   K K         L+ LE++
Sbjct: 118 QVNDRNVTKGDLVRMLESAGFYMSNPYNIVPQGRIVSLTNAKDKER-------LQLLEEV 170

Query: 283 IGTTKYKAQIEQALVEVD 300
           +G   ++ +++ ++ ++D
Sbjct: 171 VGAKSFEVKLKASMKQMD 188

>AAL182W Chr1 (16155..19850) [3696 bp, 1231 aa] {ON} Syntenic homolog
            of Saccharomyces cerevisiae YJL074C (SMC3)
          Length = 1231

 Score = 72.8 bits (177), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 49/79 (62%)

Query: 1271 NISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQF 1330
            ++  LSGG+KT+ ++AL+ A+    P P Y+ DEIDAALD +  + VA  +K+ +  AQF
Sbjct: 1122 HVEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQYRTAVAATVKQLSSQAQF 1181

Query: 1331 IVISLRNNMFELAQRLVGI 1349
            I  + R +M  +A R   +
Sbjct: 1182 ICTTFRGDMIAVADRFYRV 1200

>TBLA0C02740 Chr3 (656941..660300) [3360 bp, 1119 aa] {ON} Anc_1.295
            YJL074C
          Length = 1119

 Score = 72.4 bits (176), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 49/159 (30%), Positives = 83/159 (52%), Gaps = 5/159 (3%)

Query: 1211 LKKRRLDEFMEGFGIISITLKEMYQMITMGGNAELELVDSLDPFSEGVLFSVMPPKKS-- 1268
            LK+++++     F  +S    ++++ +   G  EL +      +S GV   V    K+  
Sbjct: 955  LKEQKVNAVERTFNQVSENFSDIFEQLVPRGTGELVIGRQGQEYS-GVSIQVSFNSKNDE 1013

Query: 1269 WRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNA 1328
               I  LSGG+KT+ ++AL+ A+ +  P P Y+ DEIDAALD      V+  IK  ++N 
Sbjct: 1014 QLQIEQLSGGQKTVCAIALILAIQQVDPAPFYLFDEIDAALDKEYRKSVSQVIKRLSQNG 1073

Query: 1329 -QFIVISLRNNMFELAQRLVGIYKNSNMTRSTTLQNRDI 1366
             QFI+ + R++M E+A  ++ + K  N   S    N+ I
Sbjct: 1074 TQFILTTFRSDMIEIAD-MIYMVKYHNKVSSVYETNKTI 1111

 Score = 34.7 bits (78), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 36/154 (23%), Positives = 72/154 (46%), Gaps = 22/154 (14%)

Query: 182 CSVEIQFQYVVDEPDGTTRVLSG---KPELSV-MRKAFKNNTSKYYLNGKESTYTEVTRL 237
            SVE+ F    D  D    + +G   KP   V +R+        Y +N +  T  ++ R+
Sbjct: 3   ASVEVIF----DNNDEQMSLPTGVKPKPNNEVSIRRTIGLKKDDYQINDRNITRGDMIRM 58

Query: 238 LRDEGIDLDHKRFLILQGEVESIAQMKPKAEHEGDDGLLEYLEDIIGTTKYKAQIEQALV 297
           L   G  + +   ++ QG++ ++   K K         L  LE+++G   ++ +++ +L+
Sbjct: 59  LESVGFSMSNPYNIVPQGKIIALTNAKDKER-------LLLLEEVVGAKSFENKLQASLL 111

Query: 298 EVD-------SLNDICMEKENRFDLVEKEKLSLE 324
           ++D        +N    E EN+ + +E+EK+ LE
Sbjct: 112 KMDETEQKRFQINKEMKELENKLNEMEQEKIELE 145

>Skud_10.170 Chr10 (316063..319755) [3693 bp, 1230 aa] {ON} YJL074C
            (REAL)
          Length = 1230

 Score = 71.6 bits (174), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 71/259 (27%), Positives = 117/259 (45%), Gaps = 43/259 (16%)

Query: 1132 QASVLENGLPKLPDSELARVDLEDLERDIVQLQDYIDNSTVDIEILDEYAKRLAE----Y 1187
            Q  + E GL  LP+  L   D  D+  D  QL   +++   +I  L    KR  E    +
Sbjct: 951  QQRIREIGL--LPEDALIN-DFSDITSD--QLLQKLNDMNTEISGLKNVNKRAFENFKKF 1005

Query: 1188 RRRRIDLNEAIMKRDETRMHCE----VLKKRRLDEFMEGFGIISITLKEMYQMITMGGNA 1243
              +R DL+E   + DE++   +     LK++++      F  +S   + +++ +   G A
Sbjct: 1006 NEKRKDLSERASELDESKNSIQDLIVRLKQQKVSAVDSTFQKVSENFETVFERLVPRGTA 1065

Query: 1244 ELEL----------VDSLD-----------------PFSEGVLFSVMPPKKSWR--NISN 1274
            +L +           DS D                     GV  SV    K     ++  
Sbjct: 1066 KLVIHRRNENVGDQTDSADVEMDADASKVTSSRDGETVYTGVSISVSFNSKQNEQLHVEQ 1125

Query: 1275 LSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVIS 1334
            LSGG+KT+ ++AL+ A+    P   Y+ DEIDAALD +  + VA  IKE + +AQFI  +
Sbjct: 1126 LSGGQKTVCAIALILAIQMVDPASFYLFDEIDAALDKQYRTAVATLIKELSNDAQFICTT 1185

Query: 1335 LRNNMFELAQRLVGI-YKN 1352
             R +M ++A +   + Y+N
Sbjct: 1186 FRTDMLQVADKFFRVKYEN 1204

 Score = 68.9 bits (167), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 46/195 (23%), Positives = 93/195 (47%), Gaps = 16/195 (8%)

Query: 106 LCIRTLVLENFKSYAGRQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFAFGFRANKMRQGK 165
           + I+ +V++ FK+Y    ++  F    + ++G NGSGKSN   ++ F      + +++ +
Sbjct: 1   MYIKRVVIKGFKTYRNETIIDNFSPHQNVIIGSNGSGKSNFFAAIRFVLSDDYSNLKREE 60

Query: 166 LSHLIHKSEKYPDLDFCSVEIQFQYVVDEPDGT----TRVLSGKPELSVMRKAFKNNTSK 221
              LIH+      +   SVEI F     +PD +    + VLS   +   +R+        
Sbjct: 61  RQGLIHQGSGGSVMS-ASVEIVFH----DPDHSMILPSGVLSRGDDEVTIRRTVGLKKDD 115

Query: 222 YYLNGKESTYTEVTRLLRDEGIDLDHKRFLILQGEVESIAQMKPKAEHEGDDGLLEYLED 281
           Y LN +  T  ++ R+L   G  + +   ++ QG++ ++   K K         L+ LED
Sbjct: 116 YQLNDRNVTKGDIVRMLETAGFSMTNPYNIVPQGKIVALTNAKDKER-------LQLLED 168

Query: 282 IIGTTKYKAQIEQAL 296
           ++G   ++ +++ +L
Sbjct: 169 VVGAKSFEVKLKASL 183

>KLLA0A00286g Chr1 complement(22024..25698) [3675 bp, 1224 aa] {ON}
            similar to uniprot|P47037 Saccharomyces cerevisiae
            YJL074C SMC3 Subunit of the multiprotein cohesin complex
            required for sister chromatid cohesion in mitotic cells
          Length = 1224

 Score = 70.5 bits (171), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 34/97 (35%), Positives = 54/97 (55%)

Query: 1272 ISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFI 1331
            +  LSGG+KT+ ++AL+ A+    P P Y+ DEIDAALD +    VA  IK  +  AQFI
Sbjct: 1117 VEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQYRIAVARTIKNLSDTAQFI 1176

Query: 1332 VISLRNNMFELAQRLVGIYKNSNMTRSTTLQNRDIIN 1368
              + R +M  +A     +   + ++  T +  +D +N
Sbjct: 1177 CTTFRTDMINVADTFFRVKFENKVSTVTEVSRQDAVN 1213

 Score = 65.1 bits (157), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 51/193 (26%), Positives = 90/193 (46%), Gaps = 20/193 (10%)

Query: 108 IRTLVLENFKSYAGRQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFAFGFRANKMRQGKLS 167
           I+T+++  FK+Y  R VV  F    + VVG NGSGKSN   ++ F      + +++    
Sbjct: 4   IKTVIISGFKTYKNRTVVENFSPHHNVVVGSNGSGKSNFFAAIRFVLSEENSNLKREDRK 63

Query: 168 HLIHKSEKYPDLDFCSVEIQFQYVVDEPD----GTTRVLSGKPELSVMRKAFKNNTSKYY 223
             I++        F  VEI F    D+P+       R  +G+  +   R+       +Y 
Sbjct: 64  GFIYQGAGQVMSAF--VEIIF----DDPENLMLAPLRNDTGEVRI---RRTVGLKKDEYM 114

Query: 224 LNGKESTYTEVTRLLRDEGIDLDHKRFLILQGEVESIAQMKPKAEHEGDDGLLEYLEDII 283
           +N K ST  +V R+L + G    +   ++ QG + S+   K       D   L  LED++
Sbjct: 115 INDKNSTRQDVRRVLENVGFSTSNPYNIVPQGRIISLTNAK-------DLERLHLLEDVV 167

Query: 284 GTTKYKAQIEQAL 296
           G   ++ +++++L
Sbjct: 168 GAKSFENKLKESL 180

>KLTH0D02816g Chr4 complement(272310..275594) [3285 bp, 1094 aa]
           {ON} similar to uniprot|Q08204 Saccharomyces cerevisiae
           YOL034W SMC5 Structural maintenance of chromosomes (SMC)
           protein interacts with Rhc18p and Nse1p to form a large
           complex S. pombe homolog forms a heterodimer with S.
           pombe Rad18p that is involved in DNA repair
          Length = 1094

 Score = 60.8 bits (146), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 48/161 (29%), Positives = 77/161 (47%), Gaps = 16/161 (9%)

Query: 108 IRTLVLENFKSYAGRQVVGPFH--SSFSAVVGPNGSGKSNVIDSMLFAFGFRANKM-RQG 164
           I TL LENF +YA    +  FH   S + ++GPNGSGKS  + ++      +   + R  
Sbjct: 47  IVTLRLENFVTYA----LTEFHMSPSLNMIIGPNGSGKSTFVCAVCLGLAGKPEYIGRST 102

Query: 165 KLSHLIHKSEKYPDLDFCSVEIQFQYVVDEPDGTTRVLSGKPELSVMRKAFKN-NTSKYY 223
           K+   I   E     D   +E+  +    +P+   R ++      V R   +N   S+Y+
Sbjct: 103 KIEDYIKNGE-----DRSVIEVTLKR---DPEAEDRYVASDGTTKVTRVLHRNRKASEYF 154

Query: 224 LNGKESTYTEVTRLLRDEGIDLDHKRFLILQGEVESIAQMK 264
           LNG+  T + V RL+ +  I LD+    + Q  VE  A++K
Sbjct: 155 LNGQSVTESAVKRLVSELNIQLDNLCQFLSQERVEEFARLK 195

 Score = 41.6 bits (96), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 35/62 (56%), Gaps = 3/62 (4%)

Query: 1276 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1332
            SGGE+ +S++  + AL      P  V+DEI+  +D RN  IV   + E      N+Q+I+
Sbjct: 989  SGGERAVSTVLYMIALQDVTSAPFRVVDEINQGMDSRNERIVHKSMVESACSQNNSQYIL 1048

Query: 1333 IS 1334
            ++
Sbjct: 1049 VT 1050

>TDEL0E01340 Chr5 complement(265681..269001) [3321 bp, 1106 aa] {ON}
            Anc_4.237 YLR383W
          Length = 1106

 Score = 51.2 bits (121), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 81/382 (21%), Positives = 170/382 (44%), Gaps = 42/382 (10%)

Query: 968  KDDIEHCDIEIQKMKSSYDTISTGMQELQKQLSDLQEEIGTLTDEHAVTKHELDQKN--E 1025
            + ++   +IEI+K++S        + E   Q   L+ ++ T+ D  ++   E+++K   +
Sbjct: 717  RSELNMTEIEIRKIRSK-------LAENDSQAERLKRKLNTVVDTGSLESTEIEKKRALD 769

Query: 1026 KIDSYSSIEIELTEQLQKLQNLANYLKKEMNEYDSKLSHLKLRDLGQVMLDLEENKS--L 1083
             I +Y S   E+  +++K++     LKK  +E  +K++  + R+  +   D   N+S  +
Sbjct: 770  MIATYESAANEIIAKIKKVEQTIEPLKKRFDE--TKIALTQAREKLRQSKDDVSNRSAKI 827

Query: 1084 QSFSHSPTPDTKRENIQSSMLETHLASPSPNERKISIAENNLSMEV---DEQASVLENGL 1140
            Q +    T D +R+      +ET  AS     R I    + + +++    E  S  +   
Sbjct: 828  QKWGDDIT-DLERK------IETCDASTRFKRRNIEQLAHGIEVQIANAQEFCSREQASD 880

Query: 1141 PKLPDSELARVDLEDLERDIVQLQDYIDNSTVDIEILDEYAKRLAEYRRRRIDLNEAIMK 1200
            P LP+      D + ++R++ ++ + I  +  ++ +  E A  L E  R + +      K
Sbjct: 881  PHLPE------DQDGIKREVERVSNMILRAERNVGVSKESASELLETSRAKYEAGYGTYK 934

Query: 1201 RDETRM----HCEVLKKRRLDEFMEGFGI-ISITLKEMYQMITMGGNAELELVDSLDPFS 1255
              +  +    H   ++ + L    +   +   +  +   ++    GN    +     P  
Sbjct: 935  EIDGALKILTHSIDVRVQNLQAAQKSTCLDADLDFRSSLKVRGFSGNLAFSI-----PAK 989

Query: 1256 EGVLFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVS 1315
            + +++++ P     RN+  LSGGEK+ S +AL+ A  K   + +  +DE D  +D  N  
Sbjct: 990  QLMIYTLTPNDNRPRNVDTLSGGEKSFSQMALLLATWKPMRSRIIALDEFDVFMDQVNRK 1049

Query: 1316 IVANYIKERTKN---AQFIVIS 1334
            +    I E+ KN    Q I+I+
Sbjct: 1050 MGTRLILEKLKNNSRTQTIIIT 1071

>KNAG0L00630 Chr12 complement(93928..97254) [3327 bp, 1108 aa] {ON}
           Anc_7.101 YOL034W
          Length = 1108

 Score = 49.7 bits (117), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 44/158 (27%), Positives = 75/158 (47%), Gaps = 20/158 (12%)

Query: 111 LVLENFKSYAGRQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFAFGFRANKMRQGKLSHLI 170
           L L NF +Y+  +    F  S + VVGPNGSGKS ++ ++      R   + + K S   
Sbjct: 60  LRLHNFVTYSLAEF--EFSPSLNMVVGPNGSGKSTLVCALCLGLAGRTEYLGRMKRSDSF 117

Query: 171 HKSEKYPDLDFCSVEIQFQYVVDEPDGTTRVLSGKPELSVMRKAFKNN--TSKYYLNGKE 228
            K+      D   +++   ++  E  GTT        L V R   +N+   S YY++G E
Sbjct: 118 IKN----GADSARIDV---WLAGEDPGTT--------LKVSRVLTRNHKKASLYYVDGVE 162

Query: 229 STYTEVTRLLRDE-GIDLDHKRFLILQGEVESIAQMKP 265
           ++   V +L+  +  I LD+    + Q  V+  A+++P
Sbjct: 163 TSEQRVRQLVATQHNIQLDNLCQFLSQERVQEFARLRP 200

 Score = 42.0 bits (97), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 44/177 (24%), Positives = 72/177 (40%), Gaps = 54/177 (30%)

Query: 1167 IDNSTVDIEILDEYAKRLAEYRRR------RIDLNEAIMKRDETRMHCEVLKKRRLDEFM 1220
            I++    I IL E  ++LA+ + R      ++D   A M    + M  E+  + RLD  +
Sbjct: 896  INHDESSIAILQEVERKLADVKARLPAMVRKLDAATASM----STMQAEL--EPRLDTIV 949

Query: 1221 EGF--------------GIISITLKEMYQ------MITMGGNAELELVDSLDPFSEGVLF 1260
            E                G I ++   +YQ      M+    NA L+ +DS          
Sbjct: 950  EKISERFTNLFTNVGSAGAIQLSKPHLYQEWEMKIMVKFRDNAPLKRLDS---------- 999

Query: 1261 SVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIV 1317
                           SGGE+ +S++  + AL ++   P  V+DEI+  +D RN  IV
Sbjct: 1000 ------------HTQSGGERAVSTVLYIIALQEFTSAPFRVVDEINQGMDQRNERIV 1044

>Kwal_26.7204 s26 complement(263266..266619) [3354 bp, 1117 aa] {ON}
            YOL034W - Protein required for cell viability [contig 47]
            FULL
          Length = 1117

 Score = 48.1 bits (113), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 32/123 (26%), Positives = 61/123 (49%), Gaps = 7/123 (5%)

Query: 1216 LDEFMEGFGIISITLKEMYQMITMGGNAELELVDSLDPFSEGVLFSVMPPKKSWRNISNL 1275
            +D  +EG   ISI    ++Q +  GG+  LE  +    +   ++          +  S +
Sbjct: 954  VDGIVEG---ISINFSRLFQNVGSGGSVVLEKNELFSNWKINIMVRFRDSALMKKLDSQI 1010

Query: 1276 -SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFI 1331
             SGGE+ +S++  + AL ++   P  ++DEI+  +D RN  IV   + E     K +Q+I
Sbjct: 1011 QSGGERAVSTVLYMIALQEFTSAPFRIVDEINQGMDTRNERIVHKAMVENACAEKTSQYI 1070

Query: 1332 VIS 1334
            +++
Sbjct: 1071 LVT 1073

 Score = 47.0 bits (110), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 42/159 (26%), Positives = 72/159 (45%), Gaps = 13/159 (8%)

Query: 108 IRTLVLENFKSYAGRQVVGPFH--SSFSAVVGPNGSGKSNVIDSMLFAFGFRANKMRQGK 165
           I  L LENF +Y+    +  FH   S + ++GPNGSGKS  + ++      +   + +GK
Sbjct: 69  IVKLRLENFVTYS----LTEFHLSPSLNMIIGPNGSGKSTFVCAVCLGLAGKPEYIGRGK 124

Query: 166 LSHLIHKSEKYPDLDFCSVEIQFQYVVDEPDGTTRVLSGKPELSVMRKAFKNNTSKYYLN 225
                 K+ +   L    +E+  +    +P  T   ++      V R  +    S+YYLN
Sbjct: 125 RVDSFIKNGENRGL----IEVTLK---RDPGRTGSFVAVDGTTKVSRVLWVGKKSEYYLN 177

Query: 226 GKESTYTEVTRLLRDEGIDLDHKRFLILQGEVESIAQMK 264
            +  +   V  L+ +  I LD+    + Q  VE  A++K
Sbjct: 178 DEPVSELTVKNLMGELNIQLDNLCQFLSQERVEEFARLK 216

>SAKL0B09526g Chr2 (805816..809115) [3300 bp, 1099 aa] {ON} similar
           to uniprot|Q08204 Saccharomyces cerevisiae YOL034W SMC5
           Structural maintenance of chromosomes (SMC) protein
           interacts with Rhc18p and Nse1p to form a large complex
           S. pombe homolog forms a heterodimer with S. pombe
           Rad18p that is involved in DNA repair
          Length = 1099

 Score = 47.8 bits (112), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 41/156 (26%), Positives = 71/156 (45%), Gaps = 14/156 (8%)

Query: 113 LENFKSYAGRQVVGPFH--SSFSAVVGPNGSGKSNVIDSMLFAFGFRANKM-RQGKLSHL 169
           L+NF +YA    +  FH   S + ++GPNGSGKS  + ++      R   + R  ++   
Sbjct: 53  LKNFVTYA----LTEFHLSPSLNMIIGPNGSGKSTFVCAICLGLAGRPEYIGRSKRVEDF 108

Query: 170 IHKSEKYPDLDFCSVEIQFQYVVDEPDGTTRVLSGKPELSVMRKAFKN-NTSKYYLNGKE 228
           I   E     D C +EI  +    +  G   VLS    + + R   ++   S Y++N + 
Sbjct: 109 IKNGE-----DECEIEITLKN-NSKIQGIANVLSSDDVIKITRVLIRHRKKSDYFINDRP 162

Query: 229 STYTEVTRLLRDEGIDLDHKRFLILQGEVESIAQMK 264
           ++   V  ++    I LD+    + Q  VE  A++K
Sbjct: 163 ASEGVVKSMILQLNIQLDNLCQFLSQERVEEFARLK 198

 Score = 42.4 bits (98), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 42/83 (50%), Gaps = 11/83 (13%)

Query: 1276 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1332
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN  IV   + E       +Q+ +
Sbjct: 994  SGGERAVSTVLYMIALQEFTTAPFRVVDEINQGMDTRNERIVHKAMVENACAENTSQYFL 1053

Query: 1333 ISLRNNMFELAQRLVGIYKNSNM 1355
            I+         + L G+Y +  M
Sbjct: 1054 IT--------PKLLTGLYYHEKM 1068

>ZYRO0G01584g Chr7 (120582..123848) [3267 bp, 1088 aa] {ON} similar
           to uniprot|Q08204 Saccharomyces cerevisiae YOL034W SMC5
           Structural maintenance of chromosomes (SMC) protein
           interacts with Rhc18p and Nse1p to form a large complex
           S. pombe homolog forms a heterodimer with S. pombe
           Rad18p that is involved in DNA repair
          Length = 1088

 Score = 47.0 bits (110), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 106/438 (24%), Positives = 188/438 (42%), Gaps = 58/438 (13%)

Query: 107 CIRTLVLENFKSYAGRQV-VGPFHSSFSAVVGPNGSGKSNVIDSMLFAFGFRANKMRQGK 165
            I  + LENF +Y   +  + P   S + ++GPNGSGKS  + ++      +   +++ K
Sbjct: 35  AIVKMRLENFVTYTLTEFDLSP---SLNMIIGPNGSGKSTFVCAVCLGLAGKPEFIKRSK 91

Query: 166 -LSHLIHKSEKYPDLDFCSVEIQFQYVVDEP--DGTTRVLSGKPELSVMRKAFKNNT-SK 221
            +   I   E     D  S+EI  +   + P  +G   V S    + + R+  K+ + S+
Sbjct: 92  RVEDFIKNGE-----DRGSIEITLK---NSPKVEGMPGVDSEADTIKITRELIKSKSKSR 143

Query: 222 YYLNGKESTYTEVTRLLRDEGIDLDHKRFLILQGEVESIAQMK-----PKAEHEGDDGLL 276
           Y +N +  +  +V  L+    I LD+    + Q  VE  A++K      +     D  LL
Sbjct: 144 YMINDRVVSEEDVRLLVSKLNIQLDNLCQFLSQERVEEFARLKSDKLLAETTRSIDAKLL 203

Query: 277 EYLEDIIGTTKYKAQIEQALVEVDSLNDICMEKENRFD--LVEKEKLS--------LEPG 326
           + LE ++   + K        E+ S  ++ + K+ ++D  LV+KEKLS        LE  
Sbjct: 204 DVLE-LLKDLQAK--------EISSQRELDLNKQ-KYDELLVQKEKLSESVKAFKELESK 253

Query: 327 KDEALAFLKKEKDLTLLMSKKYQYHLFHNGSKLAKTLSNVSNTMNXXXXXXXXXXXXXXX 386
           K E       E  L LL   K + H      KLA    ++                    
Sbjct: 254 KSEL------ELHLQLLPYAKLKDH----KEKLADYKRDLDQAKANLKSLRKDKKPFSNA 303

Query: 387 XXXLTDASEQLANRLVSMNNTNKESLAKMRQLERELVS----NEEKQKSLLQKRSKAEKT 442
              L +  E L+N+    +   KE  A  R++E+EL S     E+K++ +   R++ +K 
Sbjct: 304 KQNLEERLEILSNKRDLKDKQLKEDQASYRRVEQELESIREEIEKKEQQIEYYRNRTKKL 363

Query: 443 LNTVEKSIKQCENK---IEEYISQNQEYETSLTTLNHTIVDAQAELEKMKLALSDKTGDI 499
             T  K+ ++ ENK   +E     +Q     +T+  H ++  +A L +  L L ++   I
Sbjct: 364 EETAAKTREELENKYKLLETIELPSQSVFDEITSQRHDLILREANLNESILELDNRASGI 423

Query: 500 TKEVAVLEKELEPWTNKV 517
              +  LEK+++   N +
Sbjct: 424 NHNMRHLEKQMDNRLNSL 441

>KLLA0F07997g Chr6 complement(748561..751920) [3360 bp, 1119 aa]
           {ON} similar to uniprot|Q08204 YOL034W Saccharomyces
           cerevisiae YOL034W SMC5 Structural maintenance of
           chromosomes (SMC) protein, interacts with Rhc18p and
           Nse1p to form a large complex
          Length = 1119

 Score = 45.4 bits (106), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 48/169 (28%), Positives = 74/169 (43%), Gaps = 32/169 (18%)

Query: 111 LVLENFKSYAGRQVVGPFH--SSFSAVVGPNGSGKSNVIDSMLFAFGFRANKMRQGKLSH 168
           L L NF +YA    +  FH   S + ++GPNGSGKS  + ++      +   + + K   
Sbjct: 63  LKLTNFVTYA----LTEFHLSPSLNMIIGPNGSGKSTFVCAICLGLAGKPEYIGRSK--- 115

Query: 169 LIHKSEKY--PDLDFCSVEIQFQY----------VVDEPDGTTRVLSGKPELSVMRKAFK 216
              K E+Y     D   +EI  +           +++  D    V   K  LS+ +K   
Sbjct: 116 ---KVEEYIKNGTDEGVIEITLKNSSALLHSDFNMINTDDDVVHV---KRVLSMEKKK-- 167

Query: 217 NNTSKYYLNGKESTYTEVTRLLRDEGIDLDHKRFLILQGEVESIAQMKP 265
              SKYY+N K  T   V  ++R   I LD+    + Q  VE  A++KP
Sbjct: 168 ---SKYYINNKVVTEEVVKSMVRVLNIQLDNLCQFLSQERVEEFARLKP 213

 Score = 44.3 bits (103), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 37/139 (26%), Positives = 61/139 (43%), Gaps = 23/139 (16%)

Query: 1215 RLDEFMEGFGIISITLKEMYQMITMGGNAELELVDSLDPFSEGVLFSVMPPKKSWRNISN 1274
            RLD+ ++    IS     ++  +   G  EL+  DS + +        +  K  +R+ S 
Sbjct: 955  RLDDIVKQ---ISKKFSHLFAYVGSAGQVELKKPDSFNDW-------CIEIKVKFRDNSE 1004

Query: 1275 L--------SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVA-----NYI 1321
            L        SGGE+ +S++  + AL ++  +P  V+DEI+  +D  N  IV      N  
Sbjct: 1005 LQQLNPHVQSGGERAVSTVLYMIALQQFTSSPFRVVDEINQGMDQTNERIVHRIMVENAC 1064

Query: 1322 KERTKNAQFIVISLRNNMF 1340
             E T     I   L  N+F
Sbjct: 1065 AENTSQYFLITPKLLTNLF 1083

>ZYRO0B12122g Chr2 (972611..975940) [3330 bp, 1109 aa] {ON} similar to
            uniprot|Q12749 Saccharomyces cerevisiae YLR383W RHC18
            Protein involved in structural maintenance of chromosomes
            required for interchromosomal and sister chromatid
            recombination
          Length = 1109

 Score = 45.1 bits (105), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/79 (32%), Positives = 41/79 (51%), Gaps = 3/79 (3%)

Query: 1259 LFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVA 1318
            +F + P  +  RN+  LSGGEK+ S +AL+ A  K   + +  +DE D  +D  N  I  
Sbjct: 996  IFILTPNDEKARNVDTLSGGEKSFSQMALLLATWKPMRSRIIALDEFDVFMDQVNRQIGT 1055

Query: 1319 NYIKERTKN---AQFIVIS 1334
              I  + K+    Q I+I+
Sbjct: 1056 KLILNKLKDIARTQTIIIT 1074

>AER045C Chr5 complement(717771..721649) [3879 bp, 1292 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YDL058W
            (USO1)
          Length = 1292

 Score = 45.1 bits (105), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 46/175 (26%), Positives = 90/175 (51%), Gaps = 6/175 (3%)

Query: 391  TDASEQLANRLVSMNNTNKESLAKMRQLERELVSNEEKQKSLLQKRSKAEKTLNTVEKSI 450
            T A E+  + +  +N    E  AK+ + E+ELV+ + K + L Q+R++ +  LNT EK +
Sbjct: 995  TAAGEKQTSDIALLNTQKSELSAKLSRAEKELVNQKAKAEGLFQERAELKDKLNTSEKQL 1054

Query: 451  KQCENKIEEYISQNQEYETSLTTLNHTIVDAQAELEKMKLALSDKTG--DITKEVAVLEK 508
            ++   K+    S+  E  + L    H ++ ++ E EK+K     ++   DI K +  L K
Sbjct: 1055 QESSQKLSNAQSELNEIRSRLKANEHDLITSRQEAEKLKKQNQQQSSKKDIHK-LDELSK 1113

Query: 509  ELEPWTNKVEEKKSEIKLVESEISIIKEADLKLESEIANLSQEIEQLRGNISHRE 563
            E + +  +V +  +E+   ES +  ++++ ++    I NL +E + L   I+  E
Sbjct: 1114 EADSYKAQVSKLSAEL---ESTMGQLQKSSVEQTDRIENLIKENKDLNTTIATLE 1165

>Ecym_2625 Chr2 (1208550..1211843) [3294 bp, 1097 aa] {ON} similar to
            Ashbya gossypii AEL337
          Length = 1097

 Score = 45.1 bits (105), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 38/131 (29%), Positives = 68/131 (51%), Gaps = 21/131 (16%)

Query: 1215 RLDEFMEGFGIISITLKEMYQMITMGGNAELELVDSLDPFSEGVLFSVMPPKKSWRNISN 1274
            RLDE +E    IS   ++++  + +G   E+ LV   D +SE  +      K  +R+++ 
Sbjct: 933  RLDEIVEN---ISTRFRKLF--LNVGSAGEVCLVKP-DLYSEWKI----EIKVKFRDVAE 982

Query: 1275 L--------SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKER-- 1324
            L        SGGE+ +S++  + +L ++   P  V+DEI+  +D RN  IV   + E   
Sbjct: 983  LKKLDSHIQSGGERAVSTVLYMISLQEFTNAPFRVVDEINQGMDARNERIVHKAMVENAC 1042

Query: 1325 TKN-AQFIVIS 1334
             KN +Q+ +I+
Sbjct: 1043 AKNTSQYFLIT 1053

 Score = 37.4 bits (85), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 44/170 (25%), Positives = 75/170 (44%), Gaps = 30/170 (17%)

Query: 107 CIRTLVLENFKSYAGRQVVGPFH--SSFSAVVGPNGSGKSNVIDSMLFAFGFRANKMRQG 164
            I  L L NF +Y+    +  FH   S + ++GPNGSGKS+ + ++             G
Sbjct: 45  AIIKLRLVNFVTYS----LTEFHLSPSLNMIIGPNGSGKSSFVCAICLGLA--------G 92

Query: 165 KLSHLIHKSEKYPDLDFCSVEIQFQYVVDEPDGTTRVLSGKPEL----------SVMRKA 214
           K  + I +++K  D      E   + V++     ++ +SG   +          +V+ KA
Sbjct: 93  KPEY-IGRAKKVEDFIKNGTE---ESVIELTVKNSKAVSGYSMIGGSDEVINIKTVIMKA 148

Query: 215 FKNNTSKYYLNGKESTYTEVTRLLRDEGIDLDHKRFLILQGEVESIAQMK 264
            K     YY+NG+     +V  L+    I LD+    + Q  VE  A++K
Sbjct: 149 KKKCI--YYINGQSVGENQVKALVCLLNIQLDNLCQFLSQERVEEFARLK 196

>AEL337C Chr5 complement(14613..17906) [3294 bp, 1097 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL034W
           (SMC5)
          Length = 1097

 Score = 43.5 bits (101), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 43/173 (24%), Positives = 76/173 (43%), Gaps = 36/173 (20%)

Query: 107 CIRTLVLENFKSYAGRQVVGPFH--SSFSAVVGPNGSGKSNVIDSMLFAFGFRANKMRQG 164
            I ++ L NF +Y+    +  FH   S + ++GPNGSGKS  + ++             G
Sbjct: 45  AIVSIRLTNFVTYS----LAEFHMSPSLNMIIGPNGSGKSTFVCAICLGLA--------G 92

Query: 165 KLSHLIHKSEKYPDL-----DFCSVEIQFQYVVDEPDGTTRVLSGKPELSVMRKAFKNNT 219
           K  + I ++++  D         ++EIQ +         +R +SG P +S   +A    T
Sbjct: 93  KPEY-IGRAKRVEDFIKNGTAESTIEIQLR--------NSRNVSGLPMISAEDEAINVRT 143

Query: 220 --------SKYYLNGKESTYTEVTRLLRDEGIDLDHKRFLILQGEVESIAQMK 264
                     YY+NG+  +  ++  L+    I LD+    + Q  VE  A++K
Sbjct: 144 VLMKARRKCAYYINGEPVSENQMRALVSMLNIQLDNLCQFLSQERVEEFARLK 196

 Score = 39.3 bits (90), Expect = 0.081,   Method: Compositional matrix adjust.
 Identities = 34/131 (25%), Positives = 63/131 (48%), Gaps = 21/131 (16%)

Query: 1215 RLDEFMEGFGIISITLKEMYQMITMGGNAELELVDSLDPFSEGVLFSVMPPKKSWRNISN 1274
            RLDE +E    IS   ++++    +G   E+ L+   D +SE  +      +  +R+++ 
Sbjct: 933  RLDELVEN---ISQRFRKLFS--NVGSAGEICLLKP-DLYSEWKI----EIRVKFRDVAE 982

Query: 1275 L--------SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT- 1325
            L        SGGE+ +S++  + AL  +   P  V+DEI+  +D R   IV   + E   
Sbjct: 983  LKKLDSHTQSGGERAVSTVLYMIALQHFTNAPFRVVDEINQGMDTRYERIVHKAMVENAC 1042

Query: 1326 --KNAQFIVIS 1334
                +Q+ +I+
Sbjct: 1043 AENTSQYFLIT 1053

>Kwal_26.9380 s26 (1189521..1192829) [3309 bp, 1102 aa] {ON} YLR383W
            (RHC18) - involved in recombination repair [contig 72]
            FULL
          Length = 1102

 Score = 43.1 bits (100), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 50/222 (22%), Positives = 83/222 (37%), Gaps = 57/222 (25%)

Query: 1117 KISIAENNLSMEVDEQASVLENGLPKLPDSELARVDLEDLERDIVQLQDYIDNSTVDIEI 1176
            +I +AEN + +  DE  ++ EN   K  D+E                             
Sbjct: 898  RIQMAENRVGLSQDEAVALFENAKTKYRDAE----------------------------- 928

Query: 1177 LDEYAKRLAEYRRRRIDLNEAIMKRDETRMHCEVLKKRRLDEFMEGFGIISITLKEMYQM 1236
                 K+ A+  R  I LNE++ KR       + L   + D  +          KE  + 
Sbjct: 929  -----KKYADVDRAIIQLNESLRKR------LQSLNYAKTDTCVTA----DTDFKESLRF 973

Query: 1237 ITMGGNAELELVDSLDPFSEGVLFSVM--PPKKSWRNISNLSGGEKTLSSLALVFALHKY 1294
                G    +       FS+G L  ++  P     RN+  LSGGEK+ S  +L+ A  + 
Sbjct: 974  RNFSGGLNFD-------FSKGALTMLVKTPNDDQPRNVDTLSGGEKSFSQTSLLLATWRP 1026

Query: 1295 KPTPLYVMDEIDAALDFRNVSI----VANYIKERTKNAQFIV 1332
              + +  +DE D  +D  N  I    + N + + T+    I+
Sbjct: 1027 MRSRIIALDEFDVFMDQVNRQIGTKLIMNKLSKETRTQTIII 1068

>NCAS0J01390 Chr10 (242118..245408) [3291 bp, 1096 aa] {ON} Anc_4.237
          Length = 1096

 Score = 42.7 bits (99), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 25/79 (31%), Positives = 41/79 (51%), Gaps = 3/79 (3%)

Query: 1259 LFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVA 1318
            +F +    +  RN+  LSGGEK+ S LAL+ A  K   + +  +DE D  +D  N  I  
Sbjct: 981  MFVLTANDEKPRNVDTLSGGEKSFSQLALLLATWKPMRSRIIALDEFDVFMDQVNRRIGT 1040

Query: 1319 NYIKERTKN---AQFIVIS 1334
              + ++ K+    Q I+I+
Sbjct: 1041 TLVVKKLKDLARTQTIIIT 1059

 Score = 35.8 bits (81), Expect = 0.95,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 33/58 (56%), Gaps = 4/58 (6%)

Query: 108 IRTLVLENFKSYAGRQV-VGPFHSSFSAVVGPNGSGKSNVIDSMLFAFGFRANKMRQG 164
           I+ + L NF  +   ++ +GP     + +VG NGSGKS ++ ++  A G +A+   +G
Sbjct: 64  IKKVSLRNFMCHENFELELGP---KLNFIVGSNGSGKSAILTAITIALGAKASDTNRG 118

>CAGL0H05071g Chr8 (486899..490231) [3333 bp, 1110 aa] {ON} similar to
            uniprot|Q12749 Saccharomyces cerevisiae YLR383w RHC18
          Length = 1110

 Score = 42.4 bits (98), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 40/76 (52%), Gaps = 3/76 (3%)

Query: 1262 VMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI 1321
            + P    +R +S  SGGEK+ S +AL+ A  +   + +  +DE D  +D  N  I +  I
Sbjct: 1007 LTPNDDRYREVSTFSGGEKSYSQMALLLATWRPMRSRIIALDEFDVFMDQVNRKIGSKLI 1066

Query: 1322 KERTK---NAQFIVIS 1334
             ++ K   N Q I+I+
Sbjct: 1067 VKKLKDIPNTQTIIIT 1082

 Score = 39.3 bits (90), Expect = 0.089,   Method: Compositional matrix adjust.
 Identities = 27/98 (27%), Positives = 47/98 (47%), Gaps = 15/98 (15%)

Query: 79  LIQLSPIKNSRLE------LQRLYDTKQKKVERLC-----IRTLVLENFKSYAGRQV-VG 126
           + Q S + NSR++      L R  D   + +  +      I+ L L NF  +    V +G
Sbjct: 40  MTQYSSMPNSRVDTEADAALGRRVDCAHRDIGLISPPPGYIKKLTLHNFMCHRNFDVELG 99

Query: 127 PFHSSFSAVVGPNGSGKSNVIDSMLFAFGFRANKMRQG 164
           P     + +VG NGSGKS ++ ++    G +A++  +G
Sbjct: 100 P---GLNFIVGKNGSGKSAILTAITIGLGAKASETNRG 134

>Kpol_1044.13 s1044 complement(23616..26927) [3312 bp, 1103 aa] {ON}
            complement(23616..26927) [3312 nt, 1104 aa]
          Length = 1103

 Score = 42.0 bits (97), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 29/125 (23%), Positives = 61/125 (48%), Gaps = 9/125 (7%)

Query: 1215 RLDEFMEGFGIISITLKEMYQMITMGGNAELELVDSLDPFSEGVLFSVMPPKKSWRNISN 1274
            ++D  ++G   IS    +++  +   G  +LE  ++   +   +L       +S R +++
Sbjct: 936  KIDNLIKG---ISNKYSQLFTSVGSAGEIKLEKPNNFSNWQVKILVK-FRDNESVRELTS 991

Query: 1275 LS--GGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQ 1329
             S  GGEK +S+   + +L  +   P  V+DEI+  +D RN  I+   + E       +Q
Sbjct: 992  QSQSGGEKAVSTALYIISLQNFTKAPFRVVDEINQGMDSRNEKIIHRIMVENACEDNTSQ 1051

Query: 1330 FIVIS 1334
            +I+++
Sbjct: 1052 YILVT 1056

 Score = 36.6 bits (83), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 31/109 (28%), Positives = 47/109 (43%), Gaps = 25/109 (22%)

Query: 80  IQLSPIKNSRLELQRLYDTKQKKVERLCIRTLVLENFKSYAGRQVVGPFHSSFSAVVGPN 139
           I+LSPI+         YD  Q       I  + ++NF +Y    V      SF+ ++GPN
Sbjct: 36  IKLSPIQ---------YDDYQAG----SIIKIKMKNFMTYG--LVEYQLCPSFNMIIGPN 80

Query: 140 GSGKSNVIDSMLFAFGFR----------ANKMRQGKLSHLIHKSEKYPD 178
           GSGKS V+ ++      +             ++ GK S  I  + KY D
Sbjct: 81  GSGKSTVVCALGLGLASKLDITGRGDIVTQYIQNGKTSGKIEITLKYSD 129

>Skud_15.121 Chr15 (218825..222106) [3282 bp, 1093 aa] {ON} YOL034W
            (REAL)
          Length = 1093

 Score = 42.0 bits (97), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 42/83 (50%), Gaps = 11/83 (13%)

Query: 1276 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1332
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN  IV   + E       +Q+ +
Sbjct: 987  SGGERAVSTVLYMIALQEFTSAPFRVVDEINQGMDSRNERIVHKAMVENACAENTSQYFL 1046

Query: 1333 ISLRNNMFELAQRLVGIYKNSNM 1355
            I+         + L G+Y +  M
Sbjct: 1047 IT--------PKLLTGLYYHEKM 1061

 Score = 33.9 bits (76), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 15/50 (30%), Positives = 27/50 (54%), Gaps = 4/50 (8%)

Query: 107 CIRTLVLENFKSYAGRQV-VGPFHSSFSAVVGPNGSGKSNVIDSMLFAFG 155
           CI  + L++F +Y   +  + P   S + ++GPNGSGKS  + ++     
Sbjct: 41  CITKIRLQDFVTYTLTEFNLSP---SLNMIIGPNGSGKSTFVCAVCLGLA 87

>KAFR0D01330 Chr4 complement(263879..267121) [3243 bp, 1080 aa] {ON}
           Anc_7.101 YOL034W
          Length = 1080

 Score = 41.6 bits (96), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 46/182 (25%), Positives = 80/182 (43%), Gaps = 25/182 (13%)

Query: 108 IRTLVLENFKSYAGRQV-VGPFHSSFSAVVGPNGSGKSNVIDSMLFAFGFRANKM-RQGK 165
           I  L L+N  +Y+  +  + P   S + +VGPNGSGKS  + ++      +   + R  K
Sbjct: 37  IVKLRLQNVMTYSITEFNLSP---SLNMLVGPNGSGKSTFVCAVCLGLAGKPEYIGRSKK 93

Query: 166 LSHLIHKSEKYPDLDFCSVEIQFQYVVDEPDGTTRVLSGKPELSVMRKAFKNNTSKYYLN 225
           + + I   E    +D         ++ +E    TR+++   +            S+YY++
Sbjct: 94  IDNFIKNGENTAQID----TFLRGHMPNEVIKITRIMTRNKK-----------KSEYYID 138

Query: 226 GKESTYTEVTRLLRDEGIDLDHKRFLILQGEVESIAQMKP-----KAEHEGDDGLLEYLE 280
              ST T V +L  +  I LD+    + Q  VE  A++K      +     +  LLE LE
Sbjct: 139 DSPSTETAVRKLASELNIQLDNLCQFLSQEHVEDFAKLKSDKLLIETIRSINPSLLETLE 198

Query: 281 DI 282
           D+
Sbjct: 199 DL 200

 Score = 40.4 bits (93), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 35/62 (56%), Gaps = 3/62 (4%)

Query: 1276 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1332
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN  IV   + E       +Q+ +
Sbjct: 975  SGGERAVSTVLYMIALQEFTAAPFRVVDEINQGMDQRNERIVHRAMVENACAENTSQYFL 1034

Query: 1333 IS 1334
            I+
Sbjct: 1035 IT 1036

>KNAG0B06010 Chr2 (1178430..1181783) [3354 bp, 1117 aa] {ON} Anc_4.237
            YLR383W
          Length = 1117

 Score = 41.6 bits (96), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 31/101 (30%), Positives = 50/101 (49%), Gaps = 5/101 (4%)

Query: 1270 RNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN-- 1327
            R++  LSGGEK+ S +AL+ A  K   + +  +DE D  +D  N  I    I ++ KN  
Sbjct: 1014 RDVDTLSGGEKSFSQMALLLATWKPMRSRIIALDEFDVFMDQVNRKIGTALIVKKLKNES 1073

Query: 1328 -AQFIVISLRN--NMFELAQRLVGIYKNSNMTRSTTLQNRD 1365
              Q I+I+ ++   + E+    V I+K  +  R     N D
Sbjct: 1074 RTQTIIITPQDIGKITEIDSTGVKIHKMKDPQRQNNSNNTD 1114

>TPHA0B00840 Chr2 complement(194812..198171) [3360 bp, 1119 aa] {ON}
            Anc_4.237 YLR383W
          Length = 1119

 Score = 41.6 bits (96), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 37/68 (54%), Gaps = 3/68 (4%)

Query: 1270 RNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN-- 1327
            R I NLSGGEK+ + +AL+ A  K   + +  +DE D  +D  N  I    + ++ KN  
Sbjct: 1019 RTIDNLSGGEKSFAQMALLLATWKPMRSRIIALDEFDVFMDQVNRKIGTGLLVKKLKNQT 1078

Query: 1328 -AQFIVIS 1334
              Q I+I+
Sbjct: 1079 RTQTIIIT 1086

>YLR383W Chr12 (885288..888632) [3345 bp, 1114 aa] {ON}  SMC6Component
            of the SMC5-SMC6 complex; this complex plays a key role
            in the removal of X-shaped DNA structures that arise
            between sister chromatids during DNA replication and
            repair; homologous to S. pombe rad18
          Length = 1114

 Score = 41.6 bits (96), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 37/68 (54%), Gaps = 3/68 (4%)

Query: 1270 RNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN-- 1327
            RN+  LSGGEK+ S +AL+ A  K   + +  +DE D  +D  N  I    I ++ K+  
Sbjct: 1014 RNVDTLSGGEKSFSQMALLLATWKPMRSRIIALDEFDVFMDQVNRKIGTTLIVKKLKDIA 1073

Query: 1328 -AQFIVIS 1334
              Q I+I+
Sbjct: 1074 RTQTIIIT 1081

>Skud_12.468 Chr12 (825378..828740) [3363 bp, 1120 aa] {ON} YLR383W
            (REAL)
          Length = 1120

 Score = 41.6 bits (96), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 37/68 (54%), Gaps = 3/68 (4%)

Query: 1270 RNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN-- 1327
            RN+  LSGGEK+ S +AL+ A  K   + +  +DE D  +D  N  I    I ++ K+  
Sbjct: 1020 RNVDTLSGGEKSFSQMALLLATWKPMRSRIIALDEFDVFMDQVNRKIGTTLIVKKLKDIA 1079

Query: 1328 -AQFIVIS 1334
              Q I+I+
Sbjct: 1080 RTQTIIIT 1087

>Suva_10.500 Chr10 (850833..854180) [3348 bp, 1115 aa] {ON} YLR383W
            (REAL)
          Length = 1115

 Score = 41.6 bits (96), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 37/68 (54%), Gaps = 3/68 (4%)

Query: 1270 RNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN-- 1327
            RN+  LSGGEK+ S +AL+ A  K   + +  +DE D  +D  N  I    I ++ K+  
Sbjct: 1015 RNVDTLSGGEKSFSQMALLLATWKPMRSRIIALDEFDVFMDQVNRKIGTTLIVKKLKDIA 1074

Query: 1328 -AQFIVIS 1334
              Q I+I+
Sbjct: 1075 RTQTIIIT 1082

>Smik_12.470 Chr12 (824001..827345) [3345 bp, 1114 aa] {ON} YLR383W
            (REAL)
          Length = 1114

 Score = 41.2 bits (95), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 37/68 (54%), Gaps = 3/68 (4%)

Query: 1270 RNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN-- 1327
            RN+  LSGGEK+ S +AL+ A  K   + +  +DE D  +D  N  I    I ++ K+  
Sbjct: 1014 RNVDTLSGGEKSFSQMALLLATWKPMRSRIIALDEFDVFMDQVNRKIGTTLIVKKLKDIA 1073

Query: 1328 -AQFIVIS 1334
              Q I+I+
Sbjct: 1074 RTQTIIIT 1081

>TDEL0H03490 Chr8 (578645..581956) [3312 bp, 1103 aa] {ON} Anc_7.101
            YOL034W
          Length = 1103

 Score = 41.2 bits (95), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 25/85 (29%), Positives = 43/85 (50%), Gaps = 15/85 (17%)

Query: 1276 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRN-----VSIVANYIKERTKNAQF 1330
            SGGE+ +S++  + AL +Y   P  ++DEI+  +D  N      S+V N   E T  +Q+
Sbjct: 998  SGGERAVSTVLYMIALQQYTTAPFRIVDEINQGMDSHNERIVHKSMVINACAENT--SQY 1055

Query: 1331 IVISLRNNMFELAQRLVGIYKNSNM 1355
             +I+         + L G+Y +  M
Sbjct: 1056 FLIT--------PKLLTGLYYHEKM 1072

 Score = 33.9 bits (76), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 31/67 (46%), Gaps = 7/67 (10%)

Query: 111 LVLENFKSYAGRQVVGPF--HSSFSAVVGPNGSGKSNVIDSMLFAFGFRANKM-RQGKLS 167
           L +ENF +Y     V  F    S + ++GPNGSGKS  + ++      +   + R  KL 
Sbjct: 49  LRMENFVTYK----VAEFDLSPSLNMIIGPNGSGKSTFVCAVCIGLAGKPRFIGRSSKLE 104

Query: 168 HLIHKSE 174
             I   E
Sbjct: 105 DFIKNGE 111

>NCAS0I00570 Chr9 complement(90806..94093) [3288 bp, 1095 aa] {ON}
            Anc_7.101 YOL034W
          Length = 1095

 Score = 41.2 bits (95), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 35/62 (56%), Gaps = 3/62 (4%)

Query: 1276 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1332
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN  IV   + E       +Q+ +
Sbjct: 990  SGGERAVSTVLYMIALQEFTSAPFRVVDEINQGMDARNERIVHKAMVENACAENTSQYFL 1049

Query: 1333 IS 1334
            I+
Sbjct: 1050 IT 1051

 Score = 41.2 bits (95), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 61/245 (24%), Positives = 103/245 (42%), Gaps = 35/245 (14%)

Query: 94  RLYDTKQKKVERLCIRTLVLENFKSYAGRQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFA 153
           R YD  Q       I  + L+NF +Y  R        S + ++GPNGSGKS  + ++   
Sbjct: 28  RTYDQFQPG----SIVKIKLQNFVTY--RLTEFNLSPSLNMIIGPNGSGKSTFVCAVCLG 81

Query: 154 FGFRANKM-RQGKLSHLIHKSEKYPDLDFCSVEIQFQYVVDEPDGTTRV-----LSGKPE 207
              +   + R  ++   I   E     D   +EI  +   D  +  + +     L+GK  
Sbjct: 82  LAGKPEFIGRAKRVDDFIKNGE-----DTSRIEIFLKNYEDPTELQSSLNLKFNLAGKDL 136

Query: 208 LSVMRKAFKNNT---SKYYLNGKESTYTEVTRLLRDEGIDLDHKRFLILQGEVESIAQMK 264
           L V R   ++     S Y++N K  T   +  L++   I LD+    + Q  VE  A++K
Sbjct: 137 LKVTRLIQRDGNKCKSDYFINDKPVTENVIKNLVKFLNIQLDNLCQFLSQERVEEFARLK 196

Query: 265 P-----KAEHEGDDGLLEYLEDIIGTTKYKAQIEQALVEVDSLNDICMEKENRFDLVEKE 319
                 +     D  LL+ L+D+  +   +  +E    EVD        K+ RF+ +E +
Sbjct: 197 SDKLLVETVRSIDAQLLQILDDLKSSQNDETTLEN---EVDI-------KQKRFNELETD 246

Query: 320 KLSLE 324
           +  LE
Sbjct: 247 RNKLE 251

>NDAI0J02180 Chr10 (529566..532892) [3327 bp, 1108 aa] {ON} Anc_4.237
            YLR383W
          Length = 1108

 Score = 41.2 bits (95), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 37/68 (54%), Gaps = 3/68 (4%)

Query: 1270 RNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN-- 1327
            RN+  LSGGEK+ S LAL+ A  K   + +  +DE D  +D  N  I    + ++ K+  
Sbjct: 1008 RNVDTLSGGEKSFSQLALLLATWKPMRSRIIALDEFDVFMDQVNRRIGTTLVVKKLKDLL 1067

Query: 1328 -AQFIVIS 1334
              Q I+I+
Sbjct: 1068 RTQTIIIT 1075

 Score = 35.8 bits (81), Expect = 0.88,   Method: Compositional matrix adjust.
 Identities = 21/71 (29%), Positives = 39/71 (54%), Gaps = 6/71 (8%)

Query: 97  DTKQKKVERLC--IRTLVLENFKSYAGRQV-VGPFHSSFSAVVGPNGSGKSNVIDSMLFA 153
           D+  +K +  C  I+ ++L NF  +   ++ +GP     + +VG NGSGKS V+ ++   
Sbjct: 63  DSNSRKDDLPCGYIKKVILRNFMCHEHFELDLGP---RLNFIVGNNGSGKSAVLTAITIG 119

Query: 154 FGFRANKMRQG 164
            G +A+   +G
Sbjct: 120 LGAKASDTNRG 130

>NDAI0A08450 Chr1 (1947452..1950811) [3360 bp, 1119 aa] {ON} Anc_7.101
            YOL034W
          Length = 1119

 Score = 41.2 bits (95), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 35/62 (56%), Gaps = 3/62 (4%)

Query: 1276 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1332
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN  IV   + E       +Q+ +
Sbjct: 1014 SGGERAVSTVLYMIALQEFTAAPFRVVDEINQGMDSRNERIVHKAMVENACAENTSQYFL 1073

Query: 1333 IS 1334
            I+
Sbjct: 1074 IT 1075

>KLLA0E05303g Chr5 complement(472583..475879) [3297 bp, 1098 aa] {ON}
            similar to uniprot|Q12749 Saccharomyces cerevisiae
            YLR383W RHC18 Protein involved in structural maintenance
            of chromosomes required for interchromosomal and sister
            chromatid recombination
          Length = 1098

 Score = 40.8 bits (94), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 29/95 (30%), Positives = 46/95 (48%), Gaps = 7/95 (7%)

Query: 1270 RNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI-----KER 1324
            RN+  LSGGEK+ S +AL+ A      + +  +DE D  +D  N  I  N I     K+ 
Sbjct: 997  RNVDTLSGGEKSFSQIALLLATWLTMRSRIIALDEFDVFMDQVNRKIGTNLIIRRLGKDV 1056

Query: 1325 TKNAQFIVISLRN--NMFELAQRLVGIYKNSNMTR 1357
              + Q I+I+ ++   M  +  +   I+K  N  R
Sbjct: 1057 KSDTQTIIITPQDIGKMANIDDKYFNIHKMKNPER 1091

>Suva_15.133 Chr15 (232441..235719) [3279 bp, 1092 aa] {ON} YOL034W
            (REAL)
          Length = 1092

 Score = 40.8 bits (94), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 35/62 (56%), Gaps = 3/62 (4%)

Query: 1276 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1332
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN  IV   + E       +Q+ +
Sbjct: 987  SGGERAVSTVLYMIALQEFTSAPFRVVDEINQGMDSRNERIVHKAMVENACAENTSQYFL 1046

Query: 1333 IS 1334
            I+
Sbjct: 1047 IT 1048

 Score = 33.1 bits (74), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 36/167 (21%), Positives = 65/167 (38%), Gaps = 36/167 (21%)

Query: 113 LENFKSYAGRQV-VGPFHSSFSAVVGPNGSGKSNVIDSMLFAFG--------------FR 157
           L++F +Y   +  + P   S + ++GPNGSGKS  + ++                   F 
Sbjct: 47  LQDFVTYTLTEFNLSP---SLNMIIGPNGSGKSTFVCAVCLGLAGKPEYIGRSKKVEDFI 103

Query: 158 ANKMRQGKLSHLIHKSEKYPDLDFCSVEIQFQYVVDEPDGTTRVLSGKPELSVMRKAFKN 217
            N     ++   +  S K  D++F +         DE    TR+++              
Sbjct: 104 KNGQDTSRIEITLKNSPKIHDIEFINTH-------DETIKVTRIITR-----------SK 145

Query: 218 NTSKYYLNGKESTYTEVTRLLRDEGIDLDHKRFLILQGEVESIAQMK 264
             S Y +N ++ +   V  L+    I LD+    + Q  VE  A++K
Sbjct: 146 RRSDYLINDEQVSENVVKTLVAQLNIQLDNLCQFLSQERVEEFARLK 192

>Smik_15.131 Chr15 (226115..229396) [3282 bp, 1093 aa] {ON} YOL034W
            (REAL)
          Length = 1093

 Score = 40.8 bits (94), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 35/62 (56%), Gaps = 3/62 (4%)

Query: 1276 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1332
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN  IV   + E       +Q+ +
Sbjct: 987  SGGERAVSTVLYMIALQEFTSAPFRVVDEINQGMDSRNERIVHKAMVENACAENTSQYFL 1046

Query: 1333 IS 1334
            I+
Sbjct: 1047 IT 1048

>YOL034W Chr15 (259923..263204) [3282 bp, 1093 aa] {ON}  SMC5Component
            of the SMC5-SMC6 complex; this complex plays a key role
            in the removal of X-shaped DNA structures that arise
            between sister chromatids during DNA replication and
            repair; binds single-stranded DNA and has ATPase
            activity; S. pombe homolog forms a heterodimer with S.
            pombe Rad18p that is involved in DNA repair
          Length = 1093

 Score = 40.8 bits (94), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 35/62 (56%), Gaps = 3/62 (4%)

Query: 1276 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1332
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN  IV   + E       +Q+ +
Sbjct: 987  SGGERAVSTVLYMIALQEFTSAPFRVVDEINQGMDSRNERIVHKAMVENACAENTSQYFL 1046

Query: 1333 IS 1334
            I+
Sbjct: 1047 IT 1048

>TPHA0L00600 Chr12 complement(102317..105670) [3354 bp, 1117 aa] {ON}
            Anc_7.101 YOL034W
          Length = 1117

 Score = 40.8 bits (94), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 35/62 (56%), Gaps = 3/62 (4%)

Query: 1276 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1332
            SGGEK +S++  + AL ++   P  V+DEI+  +D RN  IV   + E       +Q+ +
Sbjct: 1012 SGGEKAVSTVFYMIALQEFTIAPFRVVDEINQGMDPRNEKIVHQSMVENACADNTSQYFL 1071

Query: 1333 IS 1334
            I+
Sbjct: 1072 IT 1073

 Score = 35.0 bits (79), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 36/155 (23%), Positives = 71/155 (45%), Gaps = 12/155 (7%)

Query: 113 LENFKSYAGRQV-VGPFHSSFSAVVGPNGSGKSNVIDSMLFAFGFRANKM-RQGKLSHLI 170
           L NF +Y   +  + P   S + ++GPNGSGKS  + ++      +   + R   +   I
Sbjct: 71  LHNFVTYEFTEFDLSP---SLNMIIGPNGSGKSTFVCAVCLGLAGKPEYIGRSRNVDDYI 127

Query: 171 HKSEKYPDLDFCSVEIQFQYVVDEPDGTTRVLSGKPELSVMRKAFKN-NTSKYYLNGKES 229
              E++ +++   + ++    + + +G   VL G   +++ R   ++   S+Y +N    
Sbjct: 128 KNDEEHGEIE---ITLKNSEAIHDVEG---VLEGSDTITITRILTRSKKKSEYKINDSLV 181

Query: 230 TYTEVTRLLRDEGIDLDHKRFLILQGEVESIAQMK 264
           T   V  L+    I LD+    + Q  VE  A++K
Sbjct: 182 TEATVKELVSLLNIQLDNLCQFLSQERVEEFARLK 216

>TBLA0E02190 Chr5 complement(534078..537347) [3270 bp, 1089 aa] {ON}
            Anc_7.101 YOL034W
          Length = 1089

 Score = 40.4 bits (93), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 27/42 (64%)

Query: 1276 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIV 1317
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN  I+
Sbjct: 984  SGGERAVSTVLYMIALQEFTSAPFRVVDEINQGMDSRNERII 1025

>Kpol_483.10 s483 (21646..25002) [3357 bp, 1118 aa] {ON}
           (21646..25002) [3357 nt, 1119 aa]
          Length = 1118

 Score = 40.4 bits (93), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 37/66 (56%), Gaps = 3/66 (4%)

Query: 108 IRTLVLENFKSYAGRQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFAFGFRANKMRQG-KL 166
           IR ++L NF  +    V      + + +VG NGSGKS ++ +++ A G +A++  +G  L
Sbjct: 73  IRKVILRNFMCHENFSV--ELTPNLNFIVGNNGSGKSAILTAIIVALGVKASETSRGSSL 130

Query: 167 SHLIHK 172
             LI K
Sbjct: 131 KELIRK 136

 Score = 37.7 bits (86), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 28/47 (59%)

Query: 1270 RNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSI 1316
            R++  LSGGEK+ S +AL+ A  K   + +  +DE D  +D  N ++
Sbjct: 1018 RSVDTLSGGEKSFSQMALLLATWKPMKSRIIALDEFDVFMDQVNRTV 1064

>CAGL0F01155g Chr6 complement(116762..120079) [3318 bp, 1105 aa]
           {ON} similar to uniprot|Q08204 Saccharomyces cerevisiae
           YOL034w SMC5
          Length = 1105

 Score = 40.0 bits (92), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 40/170 (23%), Positives = 73/170 (42%), Gaps = 22/170 (12%)

Query: 113 LENFKSYAGRQV-VGPFHSSFSAVVGPNGSGKSNVIDSMLFAFGFRANKM-RQGKLSHLI 170
           LENF +Y   +  + P   S + ++GPNGSGKS  + ++      +   + R  ++   I
Sbjct: 43  LENFVTYNYTEFNLSP---SLNMIIGPNGSGKSTYVCAVCLGLAGKPEYIGRSKQVEDFI 99

Query: 171 HKSEKY----------PDLDFCSVEIQFQYVVDEPD-----GTTRVLSGKPELSVMRKAF 215
              +            P++D   +   F  + +  +       TR L  + ++   R   
Sbjct: 100 KNGQDTSKIEIVLKDDPNIDIEFLGSSFHRIRNNGNYKGLLTITRNLEKRTKIG--RNLE 157

Query: 216 KNNTSKYYLNGKESTYTEVTRLLRDEGIDLDHKRFLILQGEVESIAQMKP 265
           K  T +Y +NG  +T + V  L+    I LD+    + Q  VE  A+++P
Sbjct: 158 KRRTQEYSINGLPTTESNVRNLVSKFHIQLDNLCQFLSQERVEEFAKLRP 207

 Score = 38.5 bits (88), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 34/130 (26%), Positives = 61/130 (46%), Gaps = 18/130 (13%)

Query: 1215 RLDEFMEGFGIISITLKEMYQMITMGGNAELELVDSLDPFSEGVLFSVMPPKKSWRNISN 1274
            RL+  + G G       E+++ +   G   L     L  FS+  L  +M   +    +S 
Sbjct: 940  RLESIVSGIGR---KFSELFKDVGTAGGVTLNRKSKL--FSDWKL-EIMVQFRDEGKLSG 993

Query: 1275 L-----SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALD-----FRNVSIVANYIKER 1324
            L     SGGE+ +S++  + AL K+   P  V+DEI+  +D       + ++V N  +E 
Sbjct: 994  LDSHTQSGGERAVSTVLYMIALQKFTQAPFRVVDEINQGMDTNFERLVHKAMVQNACEEG 1053

Query: 1325 TKNAQFIVIS 1334
            T  +Q+ +I+
Sbjct: 1054 T--SQYFLIT 1061

>TBLA0I02890 Chr9 (683688..686984) [3297 bp, 1098 aa] {ON} Anc_4.237
            YLR383W
          Length = 1098

 Score = 38.9 bits (89), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 37/71 (52%), Gaps = 3/71 (4%)

Query: 1267 KSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTK 1326
            K  RN+  LSGGEK+ S +AL+ A  K   + +  +DE D  +D  N       I ++ K
Sbjct: 995  KEPRNVDTLSGGEKSFSQIALLLATWKPMRSRIIALDEYDVFMDQVNRKTSTQLIVQKLK 1054

Query: 1327 N---AQFIVIS 1334
            +    Q I+I+
Sbjct: 1055 DDSRTQTIIIT 1065

>NDAI0D04420 Chr4 (1033897..1039641) [5745 bp, 1914 aa] {ON} Anc_4.238
            YDL058W
          Length = 1914

 Score = 38.5 bits (88), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 62/254 (24%), Positives = 122/254 (48%), Gaps = 34/254 (13%)

Query: 396  QLANRLVSMNNTNKESLAKMRQLERELVSNEEKQKSLLQKR-----------SKAEKTLN 444
            +L ++L ++N+ ++  L ++  L+  ++  E K    L+K            SK +K ++
Sbjct: 1470 ELEDKLEAVNSAHQSKLEELDSLKTNMIELENKNSEQLKKEKASIVILEETISKQKKDID 1529

Query: 445  T----VEKSIKQCEN-------KIEEYISQNQEYETSLTTLNHTIVDAQAELEKMKLALS 493
                 VE S ++C+N       K+ E  S ++ Y+++L  +  TI +   E+EK     S
Sbjct: 1530 NLHSEVEDSQEKCKNINKDLTKKLREMQSASETYDSNLKRMEETIEEKNVEIEKS----S 1585

Query: 494  DKTGDITKEVAVLEKELEPWTNKVEE--KKSEIKLVE--SEISIIKEADLKLESEIANLS 549
                ++ KE+   + +L+   N+  E  KK++  L E  SEI  +KE +  L  E   LS
Sbjct: 1586 KSIEELEKELGSQQLKLKDLQNENTEVIKKNKDILDEKISEIGNLKEKNESLSEENETLS 1645

Query: 550  QEIEQLRGNISHREESIETLNVESSSIRDYILVGERECTSARSKLEEMKKVLVTHRQRVN 609
            +  +QL+  +S R+E+++     S  + D   V + + +  +S+L ++ K     +Q + 
Sbjct: 1646 KSADQLKSEVSKRDEALKI----SKKVIDEYKVKDEQLSKLQSQLAQVNKEYSDSKQAME 1701

Query: 610  DARSAVSSAENKNK 623
            D +  +  AE   K
Sbjct: 1702 DLQKRIGDAEENTK 1715

>TBLA0A05300 Chr1 (1297764..1299887) [2124 bp, 707 aa] {ON} Anc_1.67
            YLR188W
          Length = 707

 Score = 38.1 bits (87), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 31/76 (40%), Positives = 45/76 (59%), Gaps = 5/76 (6%)

Query: 1273 SNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT-KNAQFI 1331
            + LSGG+K   +LA  F L   +PT L V+DE  +ALD R+ SIVA  +K+R  K    I
Sbjct: 600  TQLSGGQKQRVALARAFLL---EPT-LLVLDEATSALDPRSESIVAQTLKQRCAKGFTTI 655

Query: 1332 VISLRNNMFELAQRLV 1347
             I+ R +  + + R+V
Sbjct: 656  SIAHRVSTIKHSSRVV 671

>SAKL0H03322g Chr8 complement(314365..317700) [3336 bp, 1111 aa] {ON}
            similar to uniprot|Q12749 Saccharomyces cerevisiae
            YLR383W RHC18 Protein involved in structural maintenance
            of chromosomes required for interchromosomal and sister
            chromatid recombination
          Length = 1111

 Score = 37.7 bits (86), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 28/47 (59%)

Query: 1270 RNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSI 1316
            RN+  LSGGEK+ S ++L+ A  +   + +  +DE D  +D  N +I
Sbjct: 1010 RNVDTLSGGEKSFSQISLLLATWRPMRSRIIALDEFDVFMDQVNRTI 1056

>Ecym_8397 Chr8 (818932..819999) [1068 bp, 355 aa] {ON} similar to
           Ashbya gossypii ACL051C
          Length = 355

 Score = 37.0 bits (84), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 39/159 (24%), Positives = 70/159 (44%), Gaps = 30/159 (18%)

Query: 776 GGDRAASGLMKSTQQSSLYTPEEVQRMEEELNEREKNFKVAFETFQEMESALQNYLDRQP 835
           GG+ + SG+ K  + S++  P +    E++ N +E   + +    Q ME  ++   D QP
Sbjct: 195 GGEESNSGVYKPPKISAMLPPAQNHHFEDKFNAQEHKNRSSKSRMQAMEEFIKENTD-QP 253

Query: 836 EIEVELSKQ-----KMDIETI-SAELESKIERKLELERSNKTSIEDSSELRTAEEKLAAL 889
           E+E  +        K  I+++  A+ ES I+   + E  N T                  
Sbjct: 254 ELETSIGANIVKHGKGGIKSLRDADRESSIK---QYEEDNFTR----------------- 293

Query: 890 NADLNSFMSASESKNQRIKELRAKIMEIGGLELQTLNSK 928
              LN+  + +E +  + KE+ A++  IGG +    NSK
Sbjct: 294 ---LNAVGNKAEKRKSKQKEIMARVNMIGGEDFSIFNSK 329

>Ecym_5344 Chr5 (696147..699455) [3309 bp, 1102 aa] {ON} similar to
           Ashbya gossypii AER044W
          Length = 1102

 Score = 37.0 bits (84), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 33/58 (56%), Gaps = 4/58 (6%)

Query: 108 IRTLVLENFKSYAGRQV-VGPFHSSFSAVVGPNGSGKSNVIDSMLFAFGFRANKMRQG 164
           I+ + L+NF  +   ++  GP     + +VG NGSGKS ++ ++   FG +A+   +G
Sbjct: 62  IKRITLKNFMCHEHFELEFGPM---LNFIVGSNGSGKSAILTAITIVFGAKASDTNRG 116

 Score = 34.7 bits (78), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 26/52 (50%)

Query: 1270 RNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI 1321
            RN+  LSGGEK+ S + L+ +        +  +DE D  +D  N +I    I
Sbjct: 1001 RNVDTLSGGEKSFSQITLLLSTWSTMRARVIALDEFDVFMDQVNRTIGTKMI 1052

>KAFR0A06040 Chr1 complement(1222239..1225547) [3309 bp, 1102 aa] {ON}
            Anc_4.237 YLR383W
          Length = 1102

 Score = 36.2 bits (82), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 35/68 (51%), Gaps = 3/68 (4%)

Query: 1270 RNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN-- 1327
            R++  LSGGEK+ S +AL+ A      + +  +DE D  +D  N  I    I +  K+  
Sbjct: 1002 RDVDTLSGGEKSFSQMALLLATWAPMRSRITALDEFDVFMDQVNRKIGTGLIVKTLKDNA 1061

Query: 1328 -AQFIVIS 1334
              Q I+I+
Sbjct: 1062 RTQTIIIT 1069

>Ecym_8321 Chr8 complement(652652..653986) [1335 bp, 444 aa] {ON}
           similar to Ashbya gossypii ACR101C
          Length = 444

 Score = 35.8 bits (81), Expect = 0.79,   Method: Compositional matrix adjust.
 Identities = 39/165 (23%), Positives = 84/165 (50%), Gaps = 36/165 (21%)

Query: 430 KSLLQKRSKAEKTLNTVEKSIKQCE-------NKIEEYISQNQEYETSLTTLNHTIVDAQ 482
           KSL  K  +++  L T ++ + + E       NKI+  + +N+EY++++ TLN  +    
Sbjct: 112 KSLFSKMKESQLELETTQEQLAEYESQNLKLKNKIDSLMRENEEYKSTVVTLNREVASLN 171

Query: 483 AELEKMKLALSDKTGDITKEVAVLEKELEPWTNKVE-----------EKKSEIKLVES-- 529
            E E           +++ E  + ++++E   +++E           EK  EIK+++S  
Sbjct: 172 TECE-----------NLSSECLLYKEQVERARDEIEMSSSLHSKDLYEKIQEIKVLQSKM 220

Query: 530 -EISIIKEADLK----LESEIANLSQEIEQLRGNISHREESIETL 569
            E++II E + +    +E ++ +  Q++EQL+ +IS ++  +  L
Sbjct: 221 QELNIIIETNKQDTSSMEEQLQDYEQQVEQLQEDISKQQNVVAQL 265

>KLTH0D14080g Chr4 (1149555..1152863) [3309 bp, 1102 aa] {ON} similar
            to uniprot|Q12749 Saccharomyces cerevisiae YLR383W RHC18
            Protein involved in structural maintenance of chromosomes
            required for interchromosomal and sister chromatid
            recombination
          Length = 1102

 Score = 36.2 bits (82), Expect = 0.83,   Method: Compositional matrix adjust.
 Identities = 29/110 (26%), Positives = 48/110 (43%), Gaps = 17/110 (15%)

Query: 1229 TLKEMYQMITMGGN-----AELELVDSLD--PFSEGVLFSV----------MPPKKSWRN 1271
            +LK  +Q +T         A+ +  +SL    FS G+ F+            P  +  RN
Sbjct: 944  SLKRRWQSLTYAKTDTCVTADTDFKESLRFRNFSGGLNFNFSKETLNMLVKTPNDEKPRN 1003

Query: 1272 ISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI 1321
            +   SGGEK+ S ++L+ A  +   + +  +DE D  +D  N  I    I
Sbjct: 1004 VDTFSGGEKSFSQISLLLATWRPMRSRIIALDEFDVFMDQVNRQIGTKLI 1053

>TDEL0F03120 Chr6 (570471..572192) [1722 bp, 573 aa] {ON} Anc_3.430
            YPR111W
          Length = 573

 Score = 35.4 bits (80), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 63/287 (21%), Positives = 118/287 (41%), Gaps = 42/287 (14%)

Query: 1069 DLGQVMLDLEENKS---LQSFSHSPTPDTKRENIQSSMLETHLASPSPNERKISIAENNL 1125
            D+     D   N S   L+S +   TP   +EN        +  +PSP +  + + + + 
Sbjct: 15   DINSFSFDASSNNSRNPLRSVALPATPSRNKEN-------GYAGTPSPTKSTVYVGDESS 67

Query: 1126 SMEVDEQASV---LENGLPKLPDSELARVDLEDLERDIVQLQDYIDNSTVDIEILDEYAK 1182
             M++DE       ++N   KLP     + +L   +R +   Q Y  +   D  + D    
Sbjct: 68   RMDIDEPTRNDIDIKNSPKKLPRDFHVKAELHKTQRVVSVCQMYFLDYYCD--MFDYVIS 125

Query: 1183 RLAEYRRRRIDLNE--AIMKRDETRMHCE----------VLKKRRLDEFMEGFGIISITL 1230
            R    R+    LN+   +    + R++ E          +L+KRRL    + F +I+   
Sbjct: 126  RRQRTRKVLEYLNQQKTLKSLPDDRLNSEWVGYLEKEHDILRKRRLKPKNKDFEMITQVG 185

Query: 1231 KEMYQMITMGGNAELELVDSLDPFSEGVLFSVMPPKKSWRNISNLSGGEK----TLSSLA 1286
            +  Y  + +    + + V +L   ++ +LF +        N +N    E+    T  S  
Sbjct: 186  QGGYGQVYLARKKDTKEVCALKILNKKLLFKL--------NETNHVLTERDILTTTRSEW 237

Query: 1287 LVFALHKYKPT-PLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIV 1332
            LV  L+ ++ +  LY+  E     DFR + I   Y+K  + +A+F +
Sbjct: 238  LVKLLYAFQDSESLYLAMEFVPGGDFRTLLINTRYLK--SAHARFYI 282

>TDEL0G02810 Chr7 (540540..543824) [3285 bp, 1094 aa] {ON} Anc_2.351
            YDL102W
          Length = 1094

 Score = 35.8 bits (81), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 37/71 (52%), Gaps = 9/71 (12%)

Query: 1298 PLYVMD---EIDAALDFRN------VSIVANYIKERTKNAQFIVISLRNNMFELAQRLVG 1348
            PLYV++   +ID+     N      +SI+A  I E+  NA F+V S++ N  E+   L+G
Sbjct: 939  PLYVLEHNIQIDSRYYLTNQLQNPLISIIAPIIGEKQANAMFVVKSIKINTGEMKGGLMG 998

Query: 1349 IYKNSNMTRST 1359
              K  +  +S 
Sbjct: 999  FIKKVDSCKSC 1009

>KLTH0D08558g Chr4 complement(715949..718741) [2793 bp, 930 aa] {ON}
           similar to uniprot|Q05050 Saccharomyces cerevisiae
           YMR031C Protein of unknown function green fluorescent
           protein (GFP)-fusion protein localizes to the cytoplasm
           in a punctate pattern
          Length = 930

 Score = 35.4 bits (80), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 31/97 (31%), Positives = 50/97 (51%), Gaps = 9/97 (9%)

Query: 822 EMESALQN----YLDRQPEIEVELSKQKMDIETISAELESKIERKLELERSNKTSIEDSS 877
           EME ALQN    Y   Q ++E +L K+++ +E   A L+ + E  L+  R     +E   
Sbjct: 414 EMEKALQNAKDSYAALQKQMEEDLEKERLRVEAEVAALKKEQEEDLKAAR-----VEQEQ 468

Query: 878 ELRTAEEKLAALNADLNSFMSASESKNQRIKELRAKI 914
           EL+   + + A  A+     +  +S N+ I+ELRA I
Sbjct: 469 ELKPYVDDVKAAEAEHERLTAERDSLNKEIEELRASI 505

>Ecym_1072 Chr1 (137296..139347) [2052 bp, 683 aa] {ON} similar to
            Ashbya gossypii AFR683C
          Length = 683

 Score = 35.0 bits (79), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 27/97 (27%), Positives = 55/97 (56%), Gaps = 7/97 (7%)

Query: 1273 SNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQF-I 1331
            + LSGG+K   ++A  F L    P+ L ++DE  +ALD ++  I+A  ++ R+++ +  I
Sbjct: 567  TQLSGGQKQRIAIARAFIL---DPSIL-ILDEATSALDSQSEDIIAQALRARSESGKITI 622

Query: 1332 VISLRNNMFELAQRLVGIYKNSNMTRSTTLQNRDIIN 1368
             I+ R +  E + R++ + +N  ++ +      D+IN
Sbjct: 623  SIAHRISTIEHSNRVIVLSRNGGVSETGAFC--DLIN 657

>AER044W Chr5 (714355..717666) [3312 bp, 1103 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YLR383W (RHC18)
          Length = 1103

 Score = 35.0 bits (79), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 26/52 (50%)

Query: 1270 RNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI 1321
            RN+  LSGGEK+ S + L+ +        +  +DE D  +D  N +I    I
Sbjct: 1002 RNVDTLSGGEKSFSQITLLLSTWSTMRARIIALDEFDVFMDQVNRTIGTRMI 1053

>Skud_2.110 Chr2 (207224..214711) [7488 bp, 2495 aa] {ON} YBL004W
           (REAL)
          Length = 2495

 Score = 34.7 bits (78), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 40/78 (51%), Gaps = 2/78 (2%)

Query: 132 FSAVVGPNGSGKSNVIDSMLFAFGFRANKMRQGKLSHLIHKSEKYPD-LDFCSVEIQFQY 190
           FSA + P+   K + + ++L A+  +   + +  L +++   E Y D L+F S   QF  
Sbjct: 505 FSAYISPDNFTK-DTVGTLLKAYSKKDEVLGENLLRNILENYESYKDSLNFLSGWNQFMS 563

Query: 191 VVDEPDGTTRVLSGKPEL 208
            VD  +G   ++S  PEL
Sbjct: 564 NVDPSEGVKELISAYPEL 581

>Kpol_2000.79 s2000 complement(175048..177171) [2124 bp, 707 aa] {ON}
            complement(175048..177171) [2124 nt, 708 aa]
          Length = 707

 Score = 34.7 bits (78), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 29/91 (31%), Positives = 50/91 (54%), Gaps = 5/91 (5%)

Query: 1273 SNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQ-FI 1331
            + LSGG+K   +LA  F L    P+ L ++DE  +ALD ++  I+A  ++ R +  Q  I
Sbjct: 594  TQLSGGQKQRIALARTFLLD---PSIL-ILDEATSALDSQSEDIIAQNLQARNEKGQTTI 649

Query: 1332 VISLRNNMFELAQRLVGIYKNSNMTRSTTLQ 1362
             I+ R +  + + R+V + KN  +  + T Q
Sbjct: 650  SIAHRLSTIKHSSRVVVLGKNGCVVETGTFQ 680

>KLTH0B01100g Chr2 complement(94260..98156) [3897 bp, 1298 aa] {ON}
            similar to uniprot|P12866 Saccharomyces cerevisiae
            YKL209C STE6 ATP-binding cassette (ABC) transporter
            required for the export of a-factor catalyzes ATP
            hydrolysis coupled to a-factor transport contains 12
            transmembrane domains and two ATP binding domains
            expressed only in MATa cells
          Length = 1298

 Score = 34.7 bits (78), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 25/81 (30%), Positives = 48/81 (59%), Gaps = 5/81 (6%)

Query: 1275 LSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVIS 1334
            LSGG+  L  LA+V AL + KP  L V+DE  +ALD ++  I++ ++++ +++   +V++
Sbjct: 1198 LSGGQ--LQRLAIVRALLR-KP-QLLVLDECTSALDAQHGFIMSEFVRQGSQSTTTLVLT 1253

Query: 1335 LRNNMFELAQRLVGIYKNSNM 1355
                M     R++  + N N+
Sbjct: 1254 HSEQMMRACNRIL-TFANGNI 1273

>TBLA0F02750 Chr6 (661437..665681) [4245 bp, 1414 aa] {ON} Anc_7.488
           YBL047C
          Length = 1414

 Score = 34.3 bits (77), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 36/133 (27%), Positives = 73/133 (54%), Gaps = 16/133 (12%)

Query: 397 LANRLVSMNNTNKESLAKMRQLERELVSNEEKQKSLLQKRSKAEKTLNTVEKSIKQCENK 456
           L  +LV++ NTNKES  K+ +L  +   +++    L +K       + T+  +    ENK
Sbjct: 651 LQTQLVTLENTNKESELKLNELTAQFNESQKLNDELKEK-------MTTINTTTNDLENK 703

Query: 457 IEEYISQNQEYETSLTTLNHTIVDAQAELEKMKL-ALSDKTGDITKEVAVL---EKELEP 512
           IEE  S  Q+ E S+T +N      Q EL+++ +  L+ +  D+ +++ +    +KEL+ 
Sbjct: 704 IEELKSVYQK-EKSMTDVN----SKQLELKEINVETLNTELSDLQEKIDIYLKKQKELDD 758

Query: 513 WTNKVEEKKSEIK 525
           +  +VE++ ++++
Sbjct: 759 YKTQVEQQHAQLE 771

>NCAS0B08700 Chr2 (1674262..1676409) [2148 bp, 715 aa] {ON} Anc_1.67
          Length = 715

 Score = 33.9 bits (76), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 28/75 (37%), Positives = 37/75 (49%), Gaps = 10/75 (13%)

Query: 1251 LDPFSEGVLFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALD 1310
            L  F EGV   V P        + LSGG+K   +LA  F LH      L ++DE  +ALD
Sbjct: 569  LKNFPEGVNTLVGPRG------TQLSGGQKQRIALARAFLLHP----ALLILDEATSALD 618

Query: 1311 FRNVSIVANYIKERT 1325
             ++  IVA  + ER 
Sbjct: 619  SQSEEIVAKNLSERV 633

>TPHA0D01120 Chr4 (234669..235715) [1047 bp, 348 aa] {ON} Anc_8.650
           YPL138C
          Length = 348

 Score = 33.5 bits (75), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 41/144 (28%), Positives = 73/144 (50%), Gaps = 14/144 (9%)

Query: 424 SNEEKQKSLLQKRSKAEKTLNTVEKSIKQC-ENKIEEYI----SQNQEYETSLTTLNHTI 478
            N    K++ +++ + E   +  ++S K C E   +EYI    ++ Q  +T+ T L+  +
Sbjct: 86  GNHPIPKTMWKRKCRVESCFSPCKESSKYCSEAHGQEYIKNLVNRVQLMQTNGTVLDKEV 145

Query: 479 VDAQ----AELEKMKLALSDKTGDITKEVAVLEKELEP-WTNKVEEKKSEIKLVESEISI 533
           V  Q    +E ++ K       G I ++V    KEL P   + + E  S++K +ES+IS 
Sbjct: 146 VLTQLVELSENDREKFKAYGTEGFIYQDV---NKELNPELHSSLIENDSQLKDLESQISQ 202

Query: 534 IKEADL-KLESEIANLSQEIEQLR 556
           IKE  L K+E +I  L + I+  +
Sbjct: 203 IKEKTLPKIEKKIQILDEYIQWFK 226

>Smik_10.298 Chr10 complement(464213..465262) [1050 bp, 349 aa] {ON}
            YJR019C (REAL)
          Length = 349

 Score = 33.1 bits (74), Expect = 4.3,   Method: Composition-based stats.
 Identities = 29/121 (23%), Positives = 53/121 (43%), Gaps = 18/121 (14%)

Query: 1036 ELTEQLQKLQNLANYLKKEMNEYDSKLSHLKLRDLGQVMLDLEENKSLQSFSHSPT---- 1091
            ++T  +Q L+N  N++ K++  Y     H KL     ++  ++ +K   S  H  T    
Sbjct: 79   KITYHVQNLRNGRNFIHKQVTAY----QHDKLIFTSMILFAVQRSKEHDSLQHWETIPGL 134

Query: 1092 ----PDTKRENIQSSMLETHLASPSPNERKISIAEN-----NLSMEVDE-QASVLENGLP 1141
                PD  R    +S+ +  + +P    R  S+++      ++S  VD  Q  V+E   P
Sbjct: 135  EDEQPDPHRYEEATSLFQKEVLNPQKLSRYASLSDRFQDAASMSKYVDAFQYGVMEYQFP 194

Query: 1142 K 1142
            K
Sbjct: 195  K 195

>AFR683C Chr6 complement(1697786..1699819) [2034 bp, 677 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YLR188W
            (MDL1)
          Length = 677

 Score = 33.5 bits (75), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 30/110 (27%), Positives = 57/110 (51%), Gaps = 11/110 (10%)

Query: 1254 FSEGVLFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRN 1313
            F EG+  +V P        + LSGG+K   +LA  F     +   + ++DE  +ALD ++
Sbjct: 555  FPEGLQTAVGPRG------TQLSGGQKQRVALARAF----LQDPAILILDEATSALDSKS 604

Query: 1314 VSIVANYIKERTKNAQF-IVISLRNNMFELAQRLVGIYKNSNMTRSTTLQ 1362
              IVA+ + +R + A+  I I+ R +  + + R++ + K  ++  + T Q
Sbjct: 605  EDIVASTLLQRCQEAKITISIAHRKSTIQHSTRVIVLDKLGHVLETGTYQ 654

>YDL058W Chr4 (345665..351037) [5373 bp, 1790 aa] {ON}  USO1Essential
            protein involved in the vesicle-mediated ER to Golgi
            transport step of secretion; binds membranes and
            functions during vesicle docking to the Golgi; required
            for assembly of the ER-to-Golgi SNARE complex
          Length = 1790

 Score = 33.5 bits (75), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 57/233 (24%), Positives = 102/233 (43%), Gaps = 38/233 (16%)

Query: 390  LTDASEQLANRLVSMNNTNK-----------ESLAKMRQLERELVSNEEKQKSLLQKRSK 438
            LT+  + LAN    M   N+           ES  ++  L+ ++ S  +++++   +R  
Sbjct: 960  LTEKLKSLANNYKDMQAENESLIKAVEESKNESSIQLSNLQNKIDSMSQEKENFQIERGS 1019

Query: 439  AEKTLNTVEKSIKQCENKIEEYISQNQ----EYETSLTTLNHTIVDAQAELEKMKLALS- 493
             EK +  ++K+I   E   EE IS++     EYE+ ++ L           EK++ A + 
Sbjct: 1020 IEKNIEQLKKTISDLEQTKEEIISKSDSSKDEYESQISLLK----------EKLETATTA 1069

Query: 494  -----DKTGDITKEVAVLEKELEPWTN-------KVEEKKSEIKLVESEISIIKEADLKL 541
                 +K  ++TK    LE EL  + N       K+E  +  +K V+     +KE  ++L
Sbjct: 1070 NDENVNKISELTKTREELEAELAAYKNLKNELETKLETSEKALKEVKENEEHLKEEKIQL 1129

Query: 542  ESEIANLSQEIEQLRGNISHREESIETLNVESSSIRDYILVGERECTSARSKL 594
            E E     Q++  LR N+   E+  E L  +     + I   ER+     S+L
Sbjct: 1130 EKEATETKQQLNSLRANLESLEKEHEDLAAQLKKYEEQIANKERQYNEEISQL 1182

>NCAS0A01630 Chr1 complement(317259..320390) [3132 bp, 1043 aa] {ON}
            Anc_4.113
          Length = 1043

 Score = 33.5 bits (75), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 27/76 (35%), Positives = 38/76 (50%), Gaps = 5/76 (6%)

Query: 983  SSYDTISTGMQELQKQLSDLQEEIGTLTDEHAVTKHELDQKNEK--IDSYSSI---EIEL 1037
            SSY + S+      KQ S       TL +E   T+  LD K E   ++  + +   +  L
Sbjct: 108  SSYTSCSSICLNGAKQDSVSSASSATLVNETGFTRKHLDVKKELRLVEGNNGLYKEDASL 167

Query: 1038 TEQLQKLQNLANYLKK 1053
             EQL  LQN++NYLKK
Sbjct: 168  QEQLIALQNISNYLKK 183

>Kwal_33.15561 s33 (1157299..1161192) [3894 bp, 1297 aa] {ON} YKL209C
            (STE6) - ABC transporter, glycoprotein, component of
            a-factor secretory pathway [contig 290] FULL
          Length = 1297

 Score = 33.5 bits (75), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 42/78 (53%), Gaps = 4/78 (5%)

Query: 1275 LSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVIS 1334
            LSGG+  +  LA+V AL + KP  L V+DE  +ALD R+  I++ ++K    +   +V++
Sbjct: 1197 LSGGQ--VQRLAIVRALLR-KPQ-LLVLDECTSALDARHSFIMSEFVKHHLYHTTTLVVT 1252

Query: 1335 LRNNMFELAQRLVGIYKN 1352
                M     R++   K 
Sbjct: 1253 HSEQMMRSCHRILTFNKG 1270

>ZYRO0F17050g Chr6 complement(1417445..1419589) [2145 bp, 714 aa] {ON}
            similar to uniprot|P33310 Saccharomyces cerevisiae
            YLR188W MDL1 Half-type ATP-binding cassette (ABC)
            transporter of the inner mitochondrial membrane mediates
            export of peptides generated upon proteolysis of
            mitochondrial proteins plays a role in the regulation of
            cellular resistance to oxidative stress
          Length = 714

 Score = 33.1 bits (74), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 28/91 (30%), Positives = 46/91 (50%), Gaps = 5/91 (5%)

Query: 1273 SNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNA-QFI 1331
            + LSGG+K   +LA  F L       L V+DE  +ALD ++  IVA  ++ER +     I
Sbjct: 588  AQLSGGQKQRVALARAFLLDP----ALLVLDEATSALDSQSEEIVARTLQERVRRGLTTI 643

Query: 1332 VISLRNNMFELAQRLVGIYKNSNMTRSTTLQ 1362
             I+ R +    + R+V + ++  +  S   Q
Sbjct: 644  SIAHRISTIAHSTRVVVLGRDGFVVESGPFQ 674

>YHR023W Chr8 (151666..157452) [5787 bp, 1928 aa] {ON}  MYO1Type II
            myosin heavy chain, required for wild-type cytokinesis
            and cell separation; localizes to the actomyosin ring;
            binds to myosin light chains Mlc1p and Mlc2p through its
            IQ1 and IQ2 motifs respectively
          Length = 1928

 Score = 33.1 bits (74), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 41/142 (28%), Positives = 71/142 (50%), Gaps = 30/142 (21%)

Query: 461  ISQN-QEYETSLTTLNHTIVDAQAELEKMKLALSDKTGDITKEVAVLEKELEPWTNKVEE 519
            ++QN +E    +  L  TI + +A LEK    L  K  ++ K+++ L             
Sbjct: 950  VAQNLEEAHQKIQGLQETIREREATLEK----LHSKNNELIKQISDL------------- 992

Query: 520  KKSEIKLVESEISIIKEADLKLESEIANLSQEIEQLRGNISHREESIETLNVE-SSSIRD 578
               +I   +S  S+IKE+ LKLE+       EI++L+  I+ +EE I++ N + SSS  D
Sbjct: 993  -NCDISKEQSSQSLIKESKLKLEN-------EIKRLKDVINSKEEEIKSFNDKLSSSEED 1044

Query: 579  Y---ILVGERECTSARSKLEEM 597
                ++  E+ C  A S+L+ +
Sbjct: 1045 LDIKLVTLEKNCNIAMSRLQSL 1066

>YEL043W Chr5 (70478..73348) [2871 bp, 956 aa] {ON} Predicted
           cytoskeleton protein involved in intracellular
           signalling based on quantitative analysis of
           protein-protein interaction maps; may interact with
           ribosomes, based on co-purification studies; contains
           fibronectin type III domain fold
          Length = 956

 Score = 33.1 bits (74), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 27/100 (27%), Positives = 54/100 (54%), Gaps = 5/100 (5%)

Query: 485 LEKMKLALSDKTGDITKE-VAVLEKELEPWTNKVEEKKSEIKLVESEISIIKEADLKLES 543
           L  +K+   +K  D +KE ++ +  +++ W+ +  E  S+  + E    ++ E++    +
Sbjct: 287 LTDLKIEKLNKKIDKSKEKISKMRNDMQKWSQEDTELLSKDTIKEKYFKLLNESN----A 342

Query: 544 EIANLSQEIEQLRGNISHREESIETLNVESSSIRDYILVG 583
            +AN+++EIE L+  IS  EES + LN    S+   I+V 
Sbjct: 343 SVANINKEIESLQNEISKMEESNKRLNASKKSLITSIVVN 382

>KAFR0G03200 Chr7 complement(663726..669335) [5610 bp, 1869 aa] {ON}
            Anc_4.238 YDL058W
          Length = 1869

 Score = 32.7 bits (73), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 47/187 (25%), Positives = 90/187 (48%), Gaps = 17/187 (9%)

Query: 446  VEKSIKQCENKIEEYISQNQEYETSLTTLNHTIVDAQAELEK----MKLALSDKTGDITK 501
            +EK  K    K+EE + +N +   SL  L  T+V  + ELEK     K+ L++K   + K
Sbjct: 1577 LEKENKDLRQKLEESLKRNSQEYKSLEQLQETLVKEKQELEKSLNDSKIQLNEKEK-VIK 1635

Query: 502  EVAVLEKELEPWTNKVEEKKSEIKLVESEISIIKEADLKLESEIANLSQEIE-------Q 554
            +  V +++L+   N + EK+  ++  E+    ++E +  L SE    +Q+ E       +
Sbjct: 1636 DFEVTKEKLQETENALSEKEKAMQDFEATKEKLQETENAL-SEKEKAAQDFEITKKKLVE 1694

Query: 555  LRGNISHREESIETLNVESSSIRDYILVGERECTSARSKLEEMKKVLVTHRQRVNDARSA 614
                +S + +++E L + ++ +++     E E T    KLE  K+   T  + + +A + 
Sbjct: 1695 TEKALSEKGKAVEDLEITTNKLKE----SEIELTEKGKKLEHFKETSATFEKELQEAIAG 1750

Query: 615  VSSAENK 621
              S E K
Sbjct: 1751 KKSLEEK 1757

>NCAS0A02450 Chr1 complement(463760..469546) [5787 bp, 1928 aa] {ON}
           Anc_4.238 YDL058W
          Length = 1928

 Score = 32.7 bits (73), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 46/175 (26%), Positives = 80/175 (45%), Gaps = 21/175 (12%)

Query: 451 KQCENKIE-------EYISQNQEYETSLTTLNHTIVDAQAELEKMK---LALSDKT---- 496
           K+ ENKIE       EY  + Q  ET L T+      A+  + KM     ALS +     
Sbjct: 791 KENENKIEKNEELLKEYKEKLQNIETQLQTIILAKQKAEEGVNKMNRELFALSREKQELE 850

Query: 497 -------GDITKEVAVLEKELEPWTNKVEEKKSEIKLVESEISIIKEADLKLESEIANLS 549
                   D+ K+ AVLEKE    ++K+ EK+ +I  +  E++ ++     LESE     
Sbjct: 851 GNQKIALKDLQKKTAVLEKEKRQLSDKLNEKEKDITRLNEELATLENTVKSLESEKNEKR 910

Query: 550 QEIEQLRGNISHREESIETLNVESSSIRDYILVGERECTSARSKLEEMKKVLVTH 604
           +E+E+ +    + +  +  L  +  S+       E+E  S + +L E++   ++H
Sbjct: 911 KEVEEWKSKFQNHDNLVPKLTDKLKSLATSFKELEKERDSLQEQLTELESANLSH 965

>Skud_4.584 Chr4 (1040035..1040086,1040162..1040345,1040376..1041246)
            [1107 bp, 368 aa] {ON} YDR318W (REAL)
          Length = 368

 Score = 32.3 bits (72), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 61/263 (23%), Positives = 110/263 (41%), Gaps = 40/263 (15%)

Query: 972  EHCDIEIQKMKSSYDTISTGMQELQKQLSDLQEEIGTLTDEHAVTKHELDQKNEKIDSYS 1031
            E   + I+  + + D+ +  +QE ++      +    L DEH     ELD++++K  S  
Sbjct: 26   EELKLNIKNKRKNQDSTNPIIQEFEELFDQFPQLNNFLFDEHP----ELDERDDKDTSSK 81

Query: 1032 SIEIELTEQLQKLQNLANYLKKEMNEYDSKLSHLKLRDLGQVMLDLEENKSLQSFSHSPT 1091
            S+ I  T  L + +  A                          LD +EN S Q +     
Sbjct: 82   SVVIPATPTLHEPKKRAK-------------------------LDNDENVSEQEWVLRTQ 116

Query: 1092 PDTKRENIQSS---MLETH-LASPSPNERKISIAENNLSMEVD-EQASVLENGLPKLPDS 1146
            P  + +   S+   +L+T  L SPS  +RK+ IA+ + S   D E + ++EN       +
Sbjct: 117  PMVQHQMFDSAVADLLDTDILTSPSKRKRKLKIADIDTSDRNDLEDSIIMENVYRMFGIT 176

Query: 1147 ELARVDLEDLERDIVQLQDYIDNSTVDIEILDEYAKRLAEYRRRRIDLNEAIMKRDETRM 1206
                VD  DL     +++D  D   VD E+L    +  +E R+ + +    I+ +   + 
Sbjct: 177  FFPLVDPADL-----KIKDVSDEIFVDREMLGIRLEVFSE-RKSKFEKPHYILLKKRIKS 230

Query: 1207 HCEVLKKRRLDEFMEGFGIISIT 1229
            +   L K  +  F++  GI + T
Sbjct: 231  NSWFLFKHTIPSFIDVQGIFNET 253

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.312    0.129    0.345 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 134,492,068
Number of extensions: 6009870
Number of successful extensions: 41845
Number of sequences better than 10.0: 1721
Number of HSP's gapped: 37938
Number of HSP's successfully gapped: 4030
Length of query: 1370
Length of database: 53,481,399
Length adjustment: 122
Effective length of query: 1248
Effective length of database: 39,492,147
Effective search space: 49286199456
Effective search space used: 49286199456
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 72 (32.3 bits)