Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
AGR088W8.260ON28872887147380.0
Ecym_43108.260ON2943296050010.0
NCAS0B050108.260ON2952302434980.0
TBLA0E044208.260ON3148266228700.0
SAKL0H17072g8.260ON2997152723550.0
Kwal_YGOB_56.238088.260ON2941152222180.0
KLTH0G13728g8.260ON2966152321880.0
Smik_12.1468.260ON2958150721250.0
Skud_12.1558.260ON2959151121240.0
YLR087C (CSF1)8.260ON2958152021050.0
Suva_10.1718.260ON2958152020990.0
CAGL0L12210g8.260ON2981154720990.0
Kwal_56.23810singletonOFF2763134220380.0
NDAI0B019808.260ON2959152220040.0
TDEL0F038708.260ON2942153719680.0
KAFR0B027208.260ON2982133318680.0
Kpol_392.78.260ON2995153618620.0
ZYRO0C01694g8.260ON3006132818110.0
KNAG0G020308.260ON2998133018010.0
KLLA0F19096g8.260ON2923152316180.0
TPHA0J007308.260ON3046134116101e-180
NDAI0B053901.216ON4076105812.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AGR088W
         (2887 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AGR088W Chr7 (892680..901343) [8664 bp, 2887 aa] {ON} Syntenic h...  5681   0.0  
Ecym_4310 Chr4 (657929..666760) [8832 bp, 2943 aa] {ON} similar ...  1930   0.0  
NCAS0B05010 Chr2 complement(922165..931023) [8859 bp, 2952 aa] {...  1352   0.0  
TBLA0E04420 Chr5 complement(1126342..1135788) [9447 bp, 3148 aa]...  1110   0.0  
SAKL0H17072g Chr8 (1498942..1507935) [8994 bp, 2997 aa] {ON} sim...   911   0.0  
Kwal_YGOB_56.23808 s56 (712095..712280,712384..721023) [8826 bp,...   858   0.0  
KLTH0G13728g Chr7 (1175228..1184128) [8901 bp, 2966 aa] {ON} sim...   847   0.0  
Smik_12.146 Chr12 complement(286690..295566) [8877 bp, 2958 aa] ...   823   0.0  
Skud_12.155 Chr12 complement(290039..298918) [8880 bp, 2959 aa] ...   822   0.0  
YLR087C Chr12 complement(306855..315731) [8877 bp, 2958 aa] {ON}...   815   0.0  
Suva_10.171 Chr10 complement(311672..320548) [8877 bp, 2958 aa] ...   813   0.0  
CAGL0L12210g Chr12 complement(1315265..1324210) [8946 bp, 2981 a...   813   0.0  
Kwal_56.23810 s56 (712732..721023) [8292 bp, 2763 aa] {OFF} YLR0...   789   0.0  
NDAI0B01980 Chr2 complement(483519..492398) [8880 bp, 2959 aa] {...   776   0.0  
TDEL0F03870 Chr6 complement(713797..722625) [8829 bp, 2942 aa] {...   762   0.0  
KAFR0B02720 Chr2 complement(549702..558650) [8949 bp, 2982 aa] {...   724   0.0  
Kpol_392.7 s392 (10369..19356) [8988 bp, 2995 aa] {ON} (10369..1...   721   0.0  
ZYRO0C01694g Chr3 (121250..130270) [9021 bp, 3006 aa] {ON} simil...   702   0.0  
KNAG0G02030 Chr7 complement(453579..462575) [8997 bp, 2998 aa] {...   698   0.0  
KLLA0F19096g Chr6 complement(1762215..1770986) [8772 bp, 2923 aa...   627   0.0  
TPHA0J00730 Chr10 complement(165253..174393) [9141 bp, 3046 aa] ...   624   e-180
NDAI0B05390 Chr2 complement(1313930..1326160) [12231 bp, 4076 aa...    36   2.5  

>AGR088W Chr7 (892680..901343) [8664 bp, 2887 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YLR087C (CSF1)
          Length = 2887

 Score = 5681 bits (14738), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 2762/2887 (95%), Positives = 2762/2887 (95%)

Query: 1    MVIFAIFYVGRVLGYIVSKAANLVLWKQYRVTVSIQSLVFSPLAGKVHFKNVSVTSQDQL 60
            MVIFAIFYVGRVLGYIVSKAANLVLWKQYRVTVSIQSLVFSPLAGKVHFKNVSVTSQDQL
Sbjct: 1    MVIFAIFYVGRVLGYIVSKAANLVLWKQYRVTVSIQSLVFSPLAGKVHFKNVSVTSQDQL 60

Query: 61   ISVLKGTITWRYWLIGRYRRSGTADGARRCRFALKFEGFEYFVYNRNGVYDRIARELDGE 120
            ISVLKGTITWRYWLIGRYRRSGTADGARRCRFALKFEGFEYFVYNRNGVYDRIARELDGE
Sbjct: 61   ISVLKGTITWRYWLIGRYRRSGTADGARRCRFALKFEGFEYFVYNRNGVYDRIARELDGE 120

Query: 121  DXXXXXXXXXXXXXXXIAELQDDPLIRRFLPVEFLHNKGAIVLGNKQTHSVAIMNYEKLA 180
            D               IAELQDDPLIRRFLPVEFLHNKGAIVLGNKQTHSVAIMNYEKLA
Sbjct: 121  DTSAEPTVSVPSVEEVIAELQDDPLIRRFLPVEFLHNKGAIVLGNKQTHSVAIMNYEKLA 180

Query: 181  GTVSIEVPDDTRAPSSFRTEAKISNCTVAIKPNISYEVDNPVKIYVEPKRTARLWKKYKT 240
            GTVSIEVPDDTRAPSSFRTEAKISNCTVAIKPNISYEVDNPVKIYVEPKRTARLWKKYKT
Sbjct: 181  GTVSIEVPDDTRAPSSFRTEAKISNCTVAIKPNISYEVDNPVKIYVEPKRTARLWKKYKT 240

Query: 241  LLGTVLEATLHAKRKKEQHQTPKWYDNWRGLSMYDVNXXXXXXXXVKFDIEHHEYAKCTT 300
            LLGTVLEATLHAKRKKEQHQTPKWYDNWRGLSMYDVN        VKFDIEHHEYAKCTT
Sbjct: 241  LLGTVLEATLHAKRKKEQHQTPKWYDNWRGLSMYDVNLDEELDEEVKFDIEHHEYAKCTT 300

Query: 301  VLKADQMDVTYSYGMPGTARVTDSDNAENPLLERPELDHSVDILVYDANCTYGPWANRQV 360
            VLKADQMDVTYSYGMPGTARVTDSDNAENPLLERPELDHSVDILVYDANCTYGPWANRQV
Sbjct: 301  VLKADQMDVTYSYGMPGTARVTDSDNAENPLLERPELDHSVDILVYDANCTYGPWANRQV 360

Query: 361  QQCLRVFSPTVCRNFKLRTPEEIAQQTEPAAFKLSVTIMEDSVLRVPMKESSKDAAFLEK 420
            QQCLRVFSPTVCRNFKLRTPEEIAQQTEPAAFKLSVTIMEDSVLRVPMKESSKDAAFLEK
Sbjct: 361  QQCLRVFSPTVCRNFKLRTPEEIAQQTEPAAFKLSVTIMEDSVLRVPMKESSKDAAFLEK 420

Query: 421  YKQTRDETRPFGWIDIRIAKESNITVRMAAYPTENGFENILHANLVDTTISTSVNHDTLL 480
            YKQTRDETRPFGWIDIRIAKESNITVRMAAYPTENGFENILHANLVDTTISTSVNHDTLL
Sbjct: 421  YKQTRDETRPFGWIDIRIAKESNITVRMAAYPTENGFENILHANLVDTTISTSVNHDTLL 480

Query: 481  KAKSHDITVDFSYPYGWQDKAEWNFNVCSTQAELFVLRDHVYLISDLVTDFSGGEEVLYE 540
            KAKSHDITVDFSYPYGWQDKAEWNFNVCSTQAELFVLRDHVYLISDLVTDFSGGEEVLYE
Sbjct: 481  KAKSHDITVDFSYPYGWQDKAEWNFNVCSTQAELFVLRDHVYLISDLVTDFSGGEEVLYE 540

Query: 541  QFRPFDYRFRWDIRGYSAYLNVNDANIINNPIDFGENCYLSVHGDDAEITFSLPITSIIQ 600
            QFRPFDYRFRWDIRGYSAYLNVNDANIINNPIDFGENCYLSVHGDDAEITFSLPITSIIQ
Sbjct: 541  QFRPFDYRFRWDIRGYSAYLNVNDANIINNPIDFGENCYLSVHGDDAEITFSLPITSIIQ 600

Query: 601  KYVTVDFNIFTPHFSLFLNAPPWHTFSELLHYKEIGRSKNFNIKGSYTSYSEVDVDNVDA 660
            KYVTVDFNIFTPHFSLFLNAPPWHTFSELLHYKEIGRSKNFNIKGSYTSYSEVDVDNVDA
Sbjct: 601  KYVTVDFNIFTPHFSLFLNAPPWHTFSELLHYKEIGRSKNFNIKGSYTSYSEVDVDNVDA 660

Query: 661  LNIACETDYIVVLCYGVILKCMLNVKVNYFGEMVHFRTTEEYVEELQRRNKQNPSTCRPF 720
            LNIACETDYIVVLCYGVILKCMLNVKVNYFGEMVHFRTTEEYVEELQRRNKQNPSTCRPF
Sbjct: 661  LNIACETDYIVVLCYGVILKCMLNVKVNYFGEMVHFRTTEEYVEELQRRNKQNPSTCRPF 720

Query: 721  NSDGNVHDSDVVATESNEIIDASFDAFGGPPTIKKSALKRSINELDVWFTFISKGGCFFF 780
            NSDGNVHDSDVVATESNEIIDASFDAFGGPPTIKKSALKRSINELDVWFTFISKGGCFFF
Sbjct: 721  NSDGNVHDSDVVATESNEIIDASFDAFGGPPTIKKSALKRSINELDVWFTFISKGGCFFF 780

Query: 781  PENIYKFDACLGFYFDNLEASLRFLNYYVDAAVSLDSIYFKRHTDIDARTLFKVIEDIGI 840
            PENIYKFDACLGFYFDNLEASLRFLNYYVDAAVSLDSIYFKRHTDIDARTLFKVIEDIGI
Sbjct: 781  PENIYKFDACLGFYFDNLEASLRFLNYYVDAAVSLDSIYFKRHTDIDARTLFKVIEDIGI 840

Query: 841  PIDASDAYLSQFSFRLHKMLGIMPSEESYACEFDVRVDTLDVHCDLAVLKAFVNTLRNLA 900
            PIDASDAYLSQFSFRLHKMLGIMPSEESYACEFDVRVDTLDVHCDLAVLKAFVNTLRNLA
Sbjct: 841  PIDASDAYLSQFSFRLHKMLGIMPSEESYACEFDVRVDTLDVHCDLAVLKAFVNTLRNLA 900

Query: 901  FGFKDVENSLQYEREQVFDLNKISCVIENVTVKLQNVDKDEDIWLSLNLPVTTLTSFDLA 960
            FGFKDVENSLQYEREQVFDLNKISCVIENVTVKLQNVDKDEDIWLSLNLPVTTLTSFDLA
Sbjct: 901  FGFKDVENSLQYEREQVFDLNKISCVIENVTVKLQNVDKDEDIWLSLNLPVTTLTSFDLA 960

Query: 961  NERYSRRSDLSIPELLFGIYRGDSESTCLGAFSTGVTVTLFERFEQFARCRVLQRKHILV 1020
            NERYSRRSDLSIPELLFGIYRGDSESTCLGAFSTGVTVTLFERFEQFARCRVLQRKHILV
Sbjct: 961  NERYSRRSDLSIPELLFGIYRGDSESTCLGAFSTGVTVTLFERFEQFARCRVLQRKHILV 1020

Query: 1021 NDAPFHRCSFMLPPEYKKMPIYRSLYGCXXXXXXXXXXXXXXXADNFEVIFEKLLGEIYQ 1080
            NDAPFHRCSFMLPPEYKKMPIYRSLYGC               ADNFEVIFEKLLGEIYQ
Sbjct: 1021 NDAPFHRCSFMLPPEYKKMPIYRSLYGCIPPSSSLPLFPEPISADNFEVIFEKLLGEIYQ 1080

Query: 1081 EYASDSSYQITDDSISSTEHDYHNQTVNAAIGTSSSLFIRSQNHQQTLSSFIVEFDPIDG 1140
            EYASDSSYQITDDSISSTEHDYHNQTVNAAIGTSSSLFIRSQNHQQTLSSFIVEFDPIDG
Sbjct: 1081 EYASDSSYQITDDSISSTEHDYHNQTVNAAIGTSSSLFIRSQNHQQTLSSFIVEFDPIDG 1140

Query: 1141 YLDLSATEFMLEIYKYLTEVSLDEAIDSLEIGIINQFIQTFGEDNGISEVRVLCPNISLS 1200
            YLDLSATEFMLEIYKYLTEVSLDEAIDSLEIGIINQFIQTFGEDNGISEVRVLCPNISLS
Sbjct: 1141 YLDLSATEFMLEIYKYLTEVSLDEAIDSLEIGIINQFIQTFGEDNGISEVRVLCPNISLS 1200

Query: 1201 ATNKQSKFSMFKLSSKIKNLDITSRIKSSDPNLKPDPEKTTLCYKIDYIRANIVQDGIVV 1260
            ATNKQSKFSMFKLSSKIKNLDITSRIKSSDPNLKPDPEKTTLCYKIDYIRANIVQDGIVV
Sbjct: 1201 ATNKQSKFSMFKLSSKIKNLDITSRIKSSDPNLKPDPEKTTLCYKIDYIRANIVQDGIVV 1260

Query: 1261 PPKQPSQLFSCSIELLEGYLSYDKLSLLDNNVQSCSVTLSPGTDKLLFEFLNPFISTFDL 1320
            PPKQPSQLFSCSIELLEGYLSYDKLSLLDNNVQSCSVTLSPGTDKLLFEFLNPFISTFDL
Sbjct: 1261 PPKQPSQLFSCSIELLEGYLSYDKLSLLDNNVQSCSVTLSPGTDKLLFEFLNPFISTFDL 1320

Query: 1321 LQRELSSFEDTLLASKREFLLNILRGGRDYEIQHDPPVITKPANITRFSNRHIRSAESWR 1380
            LQRELSSFEDTLLASKREFLLNILRGGRDYEIQHDPPVITKPANITRFSNRHIRSAESWR
Sbjct: 1321 LQRELSSFEDTLLASKREFLLNILRGGRDYEIQHDPPVITKPANITRFSNRHIRSAESWR 1380

Query: 1381 IIMRLRHILNYLPQEWHQSFTRHLGTQDFTSPEEAGKEFLSIFSDWRSWEPTDVQGSFVH 1440
            IIMRLRHILNYLPQEWHQSFTRHLGTQDFTSPEEAGKEFLSIFSDWRSWEPTDVQGSFVH
Sbjct: 1381 IIMRLRHILNYLPQEWHQSFTRHLGTQDFTSPEEAGKEFLSIFSDWRSWEPTDVQGSFVH 1440

Query: 1441 EKVFTKKRSRPFAALQGFTFSSDDIRLNMKDDARVPITVKGVTLGIRNNGLAPEQVDGRT 1500
            EKVFTKKRSRPFAALQGFTFSSDDIRLNMKDDARVPITVKGVTLGIRNNGLAPEQVDGRT
Sbjct: 1441 EKVFTKKRSRPFAALQGFTFSSDDIRLNMKDDARVPITVKGVTLGIRNNGLAPEQVDGRT 1500

Query: 1501 EGSMPDPDYISFCTTDEVVMRVDRSFVKTLKEFRDLIHRFKIGGPVGTAKHDNVSLFSNI 1560
            EGSMPDPDYISFCTTDEVVMRVDRSFVKTLKEFRDLIHRFKIGGPVGTAKHDNVSLFSNI
Sbjct: 1501 EGSMPDPDYISFCTTDEVVMRVDRSFVKTLKEFRDLIHRFKIGGPVGTAKHDNVSLFSNI 1560

Query: 1561 TFQFGKLYVVAKLAGVYLRICLDNLSALMLTXXXXXXXXXXXXXXXXFDHMQAILGYRSF 1620
            TFQFGKLYVVAKLAGVYLRICLDNLSALMLT                FDHMQAILGYRSF
Sbjct: 1561 TFQFGKLYVVAKLAGVYLRICLDNLSALMLTSQSSVESKVISSSTLSFDHMQAILGYRSF 1620

Query: 1621 RFMTIDIDMFSVLLHYLPGQGCYSIDWKARKFHIDSSSATTKDLTESLPYVRDEIKYLVE 1680
            RFMTIDIDMFSVLLHYLPGQGCYSIDWKARKFHIDSSSATTKDLTESLPYVRDEIKYLVE
Sbjct: 1621 RFMTIDIDMFSVLLHYLPGQGCYSIDWKARKFHIDSSSATTKDLTESLPYVRDEIKYLVE 1680

Query: 1681 ALVPELFAEPPIERESSGNKIHAVLFQGQVANITLKLQILSPFIILYCAENFELQAESTD 1740
            ALVPELFAEPPIERESSGNKIHAVLFQGQVANITLKLQILSPFIILYCAENFELQAESTD
Sbjct: 1681 ALVPELFAEPPIERESSGNKIHAVLFQGQVANITLKLQILSPFIILYCAENFELQAESTD 1740

Query: 1741 SVIFDLNSGESYMEISSAKQKLDYFKYTHTCLKLSGTSSSARLFEHISCDIGILKLSVFD 1800
            SVIFDLNSGESYMEISSAKQKLDYFKYTHTCLKLSGTSSSARLFEHISCDIGILKLSVFD
Sbjct: 1741 SVIFDLNSGESYMEISSAKQKLDYFKYTHTCLKLSGTSSSARLFEHISCDIGILKLSVFD 1800

Query: 1801 LKTRITDLLQDIKAALFSMKSLSDILNISQSSPTASAFGSWFSILPDNLSLQATYAGLLL 1860
            LKTRITDLLQDIKAALFSMKSLSDILNISQSSPTASAFGSWFSILPDNLSLQATYAGLLL
Sbjct: 1801 LKTRITDLLQDIKAALFSMKSLSDILNISQSSPTASAFGSWFSILPDNLSLQATYAGLLL 1860

Query: 1861 GFGHTLYILEFNNFEAKHTRDGLPDAITPRPCFKVDHSIESASFLIKDRRIDDRLAKVVD 1920
            GFGHTLYILEFNNFEAKHTRDGLPDAITPRPCFKVDHSIESASFLIKDRRIDDRLAKVVD
Sbjct: 1861 GFGHTLYILEFNNFEAKHTRDGLPDAITPRPCFKVDHSIESASFLIKDRRIDDRLAKVVD 1920

Query: 1921 FAVNFNMVHDTDLCIQSVQIESTHLKITLAPMTVVRLLSLINEFGIIRKQFTEESIYTPS 1980
            FAVNFNMVHDTDLCIQSVQIESTHLKITLAPMTVVRLLSLINEFGIIRKQFTEESIYTPS
Sbjct: 1921 FAVNFNMVHDTDLCIQSVQIESTHLKITLAPMTVVRLLSLINEFGIIRKQFTEESIYTPS 1980

Query: 1981 SAHNNSTATECLEPSVWRLIIKSGHILSHDFSIVWLFDIPNSSADGLICGYDRLFSVYEK 2040
            SAHNNSTATECLEPSVWRLIIKSGHILSHDFSIVWLFDIPNSSADGLICGYDRLFSVYEK
Sbjct: 1981 SAHNNSTATECLEPSVWRLIIKSGHILSHDFSIVWLFDIPNSSADGLICGYDRLFSVYEK 2040

Query: 2041 PYGKLTLLNAYFSAAKILASEADFYSSVVRKQRINTSYLSDMQLRYWFTEDSENTDLFIR 2100
            PYGKLTLLNAYFSAAKILASEADFYSSVVRKQRINTSYLSDMQLRYWFTEDSENTDLFIR
Sbjct: 2041 PYGKLTLLNAYFSAAKILASEADFYSSVVRKQRINTSYLSDMQLRYWFTEDSENTDLFIR 2100

Query: 2101 IHGAKLAVDISAEIVTLLEETIQSIQTFNNLKKALVDPFRTKKQDSDISKEPYNWNNQLA 2160
            IHGAKLAVDISAEIVTLLEETIQSIQTFNNLKKALVDPFRTKKQDSDISKEPYNWNNQLA
Sbjct: 2101 IHGAKLAVDISAEIVTLLEETIQSIQTFNNLKKALVDPFRTKKQDSDISKEPYNWNNQLA 2160

Query: 2161 TGVRSLNCIINYAGVTLKLHSHDGRGDASPLELTSPSYKVAIDYKYFPNLEKTHRFRTLI 2220
            TGVRSLNCIINYAGVTLKLHSHDGRGDASPLELTSPSYKVAIDYKYFPNLEKTHRFRTLI
Sbjct: 2161 TGVRSLNCIINYAGVTLKLHSHDGRGDASPLELTSPSYKVAIDYKYFPNLEKTHRFRTLI 2220

Query: 2221 TATPTHNTFYSTSAFLIHDLCYRFXXXXXXXXXXXXXXXXXXXXXIKVEGSDNSTLLGSI 2280
            TATPTHNTFYSTSAFLIHDLCYRF                     IKVEGSDNSTLLGSI
Sbjct: 2221 TATPTHNTFYSTSAFLIHDLCYRFSKLLKTSSTENKSSSASTSSSIKVEGSDNSTLLGSI 2280

Query: 2281 DLVIILNVGKQEVTFSCEPKAKVQATVGXXXXXXXXXXXXXXXXXSLCLAIEIENLMTNS 2340
            DLVIILNVGKQEVTFSCEPKAKVQATVG                 SLCLAIEIENLMTNS
Sbjct: 2281 DLVIILNVGKQEVTFSCEPKAKVQATVGFEKFDIKIFNNNINDEESLCLAIEIENLMTNS 2340

Query: 2341 RHIYSREVCASLKLRHISMVFDIMGSQVRRIYGSTLISSPLFYFNMKQLQDLKLFIDQWF 2400
            RHIYSREVCASLKLRHISMVFDIMGSQVRRIYGSTLISSPLFYFNMKQLQDLKLFIDQWF
Sbjct: 2341 RHIYSREVCASLKLRHISMVFDIMGSQVRRIYGSTLISSPLFYFNMKQLQDLKLFIDQWF 2400

Query: 2401 PQKTPMNTGSYPEGVLVDDISRXXXXXXXXXXXXXXXXXXXXVIVAGSCAEIELGPSLGV 2460
            PQKTPMNTGSYPEGVLVDDISR                    VIVAGSCAEIELGPSLGV
Sbjct: 2401 PQKTPMNTGSYPEGVLVDDISRSIGSKFYKGSSSSSFTWGYSVIVAGSCAEIELGPSLGV 2460

Query: 2461 LNVTSEDVWAISKQQVDWSQQLDLNMGKLDVTSSGRLGGNFLVRNAHLSLELKWPNPKDF 2520
            LNVTSEDVWAISKQQVDWSQQLDLNMGKLDVTSSGRLGGNFLVRNAHLSLELKWPNPKDF
Sbjct: 2461 LNVTSEDVWAISKQQVDWSQQLDLNMGKLDVTSSGRLGGNFLVRNAHLSLELKWPNPKDF 2520

Query: 2521 FQVPLVCVKLGSDTVDTKLSFDYHTFFISSLKQGYASLFNERDEDGSLADLLSVTVSFES 2580
            FQVPLVCVKLGSDTVDTKLSFDYHTFFISSLKQGYASLFNERDEDGSLADLLSVTVSFES
Sbjct: 2521 FQVPLVCVKLGSDTVDTKLSFDYHTFFISSLKQGYASLFNERDEDGSLADLLSVTVSFES 2580

Query: 2581 VNIFLTALAAANISDIKNSITRLKKDNELSYLSSFLASDQPSDEPEEDGGIFDXXXXXXX 2640
            VNIFLTALAAANISDIKNSITRLKKDNELSYLSSFLASDQPSDEPEEDGGIFD       
Sbjct: 2581 VNIFLTALAAANISDIKNSITRLKKDNELSYLSSFLASDQPSDEPEEDGGIFDTLSLLRT 2640

Query: 2641 XXXXXXGVFRLQISPTSLFDSDVLILTATKMMANTGIQADIKIKTDLHWQLDDVSLALLP 2700
                  GVFRLQISPTSLFDSDVLILTATKMMANTGIQADIKIKTDLHWQLDDVSLALLP
Sbjct: 2641 QLSLNLGVFRLQISPTSLFDSDVLILTATKMMANTGIQADIKIKTDLHWQLDDVSLALLP 2700

Query: 2701 FNNSLDESYLATMEVGKYIELSSTIQGGAIFSAPSIVVNMTTWQEPQSNVIELLYSTSFG 2760
            FNNSLDESYLATMEVGKYIELSSTIQGGAIFSAPSIVVNMTTWQEPQSNVIELLYSTSFG
Sbjct: 2701 FNNSLDESYLATMEVGKYIELSSTIQGGAIFSAPSIVVNMTTWQEPQSNVIELLYSTSFG 2760

Query: 2761 GTVKIRWNLGPISFIKDMWQAHMNAMQLREGYYHGLAESGVAVTPLNSKAVPLEMHLGSD 2820
            GTVKIRWNLGPISFIKDMWQAHMNAMQLREGYYHGLAESGVAVTPLNSKAVPLEMHLGSD
Sbjct: 2761 GTVKIRWNLGPISFIKDMWQAHMNAMQLREGYYHGLAESGVAVTPLNSKAVPLEMHLGSD 2820

Query: 2821 YQYLPLQEPDIEMPRIKDLGDATPPIEWFGVNRTKFPGFTHQFVIVPLQKLARTAEKEYE 2880
            YQYLPLQEPDIEMPRIKDLGDATPPIEWFGVNRTKFPGFTHQFVIVPLQKLARTAEKEYE
Sbjct: 2821 YQYLPLQEPDIEMPRIKDLGDATPPIEWFGVNRTKFPGFTHQFVIVPLQKLARTAEKEYE 2880

Query: 2881 KILGRAL 2887
            KILGRAL
Sbjct: 2881 KILGRAL 2887

>Ecym_4310 Chr4 (657929..666760) [8832 bp, 2943 aa] {ON} similar to
            Ashbya gossypii AGR088W
          Length = 2943

 Score = 1930 bits (5001), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1094/2960 (36%), Positives = 1666/2960 (56%), Gaps = 126/2960 (4%)

Query: 3    IFAIFYVGRVLGYIVSKAANLVLWKQYRVTVSIQSLVFSPLAGKVHFKNVSVTSQDQLIS 62
            +F  FY+ R +GYIV+K  N V+WK+Y+V ++IQSL FS + GKV+FKN+S+T +DQ IS
Sbjct: 34   VFTTFYLWRAIGYIVTKILNWVIWKRYKVVINIQSLGFSIIGGKVYFKNISITDRDQTIS 93

Query: 63   VLKGTITWRYWLIG----RYRRSGTADGARRCRFALKFEGFEYFVYNRNGVYDRIAREL- 117
            +LKGT TWRYWL+     + + S   D   +CRF L+ +G E F+YN+  VY+ I  EL 
Sbjct: 94   ILKGTFTWRYWLLNPRPTQLKNSNINDENSKCRFKLECDGVELFIYNKIAVYEDILNELA 153

Query: 118  -----------------------------DGEDXXXXXXXXXXXXXXXIAELQDDPLIRR 148
                                         D  D               ++     PL   
Sbjct: 154  KSDKDSSRKFATDDESIFGRVKTDSSVMFDPLDESSEQSKVGQTILNSVSNQSAVPLYLD 213

Query: 149  FLPVEFLHNKGAIVLGNKQTHSVAIMNYEKLAGTVSIEVPDDTRAPSSFRTEAKISNCTV 208
            FLP E + + GA+V+GNK T SVAI+ Y ++ G + +  P         R+E ++S+  V
Sbjct: 214  FLPAEVILSSGAVVVGNKHTPSVAIIQYARIEGIIDVAGPTSNLDQYKLRSEFELSSTRV 273

Query: 209  AIKPNISYEVDNPVKIYVEPKRTARLWKKYK-TLLGTVLEATLHAKRKKEQHQTPKWYDN 267
            ++KPNIS+   +  K +    +   LW+K K  LL T+         KK      ++  +
Sbjct: 274  SVKPNISFGNGSSSKKHKIDGKPFNLWQKLKDCLLFTISHILAFTGNKKGLTGQEEFLTS 333

Query: 268  WRGLSMYDVNXXXXXXXXVKFDIEHHEYAKCTTVLKADQMDVTYSYGMPGTARVTDSDNA 327
            W+GL+MYDV         + FD+++HEYAK TT+L AD++ + YSY  PG    T     
Sbjct: 334  WKGLAMYDVATSDTFSDEIPFDLQNHEYAKYTTILNADRIKLLYSYDTPGVITETLIKGY 393

Query: 328  ENPLLERPELDHSVDILVYDANCTYGPWANRQVQQCLRVFSPTVCRNFKLRTPEEIAQQT 387
            EN  +  P  ++S+D+ +YDAN  YGPWA+RQ+Q  +++FSP V R+F       + +  
Sbjct: 394  ENGDIP-PSPEYSIDVQLYDANFYYGPWAHRQLQYFIKMFSPAVSRDFSAHRKPVLGKSR 452

Query: 388  EPAAFKLSVTIMEDSVLRVPMKESSKDAAFLEKYKQTRDETRPFGWIDIRIAKESNITVR 447
            E A F+  + IMEDSV R+P KE SKDAAFL+KYK T DE+R FGWIDI++ K++NI++ 
Sbjct: 453  EHANFRCEIVIMEDSVWRIPTKEPSKDAAFLDKYKSTNDESRAFGWIDIKLNKDTNISIE 512

Query: 448  MAAYPTENGFENILHANLVDTTISTSVNHDTLLKAKSHDITVDFSYPYGWQDKAEWNFNV 507
            +    +E GFEN  HANLV+  I TSVNHD L  AK+H I    SYP+ W     W  + 
Sbjct: 513  LGLQASECGFENTFHANLVNPVIITSVNHDVLFNAKAHQIIARQSYPHQWNSAITWALHF 572

Query: 508  CSTQAELFVLRDHVYLISDLVTDFSGGEEVLYEQFRPFDYRFRWDIRGYSAYLNVNDANI 567
             S+  ELF+LRDH  L+ DL TDF+ G+ V YE FRP  Y+F WDI  YS YLN NDANI
Sbjct: 573  ISSDLELFILRDHFNLLVDLFTDFASGDAVPYELFRPVLYQFSWDISNYSLYLNANDANI 632

Query: 568  INNPIDFGENCYLSVHGDDAEITFSLPITSIIQKYVTVDFNIFTPHFSLFLNAPPWHTFS 627
            +NNP+DF ENCY+S+HG+ A I   LPI +I ++ +T+ + I+TP F + L  PPWHT  
Sbjct: 633  VNNPLDFNENCYISIHGNSARIGVKLPIETISEESITISYEIYTPKFDIQLKTPPWHTLH 692

Query: 628  ELLHYKEIGRSKNFNIKGSYTSYSEVDVDNVDALNIACETDYIVVLCYGVILKCMLNVKV 687
            E +  + +GRS  F+  GSY SY++VD+DNVD +N+ C+T++   L YG +L+ ++N+K+
Sbjct: 693  EFMAQRFVGRSHEFSASGSYLSYNDVDIDNVDTINLECKTNHATFLAYGFLLRYVMNLKL 752

Query: 688  NYFGEMVHFRTTEEYVEELQRRNKQNPSTCRPFNSDGNVHDSDVVATESNEIIDASFDAF 747
            NYFGE   FRTTEEY EEL +RN         FN++ +   +++V  E N   ++ FD  
Sbjct: 753  NYFGEFAQFRTTEEYSEELAQRND---VATDIFNNNDDDQTTELV--EPNSYGESGFDIL 807

Query: 748  GGPPTIKKSALKRSINELDVWFTFISKGGCFFFPENIYKFDACLGFYFDNLEASLRFLNY 807
             G   I K++LKR++NE D+W TF  + GCF  PE+ Y F +C G +FDN+   +R+L+Y
Sbjct: 808  HG-KKIDKASLKRTVNEKDIWVTFFFEDGCFVLPESFYDFKSCFGLHFDNITFDMRYLSY 866

Query: 808  YVDAAVSLDSIYFKRHTDIDARTLFKVIEDIGIPIDASDAYLSQFSFRLHKMLGIMPSEE 867
            Y D A S++S Y KR+ D+ + ++F V           D YLS+F+  +H+M G+ P+EE
Sbjct: 867  YADLAFSMNSTYIKRYPDVSSNSVFDVCGSNPFITSNYDGYLSEFNIHIHRMFGLPPAEE 926

Query: 868  SYACEFDVRVDTLDVHCDLAVLKAFVNTLRNLAFGFKDVENSLQYEREQVFDLNKISCVI 927
            +Y  + DV +  L    D+  LK F+  +   +FGF + E+ L YE  + FD++ +S   
Sbjct: 927  TYLFKIDVSLGYLSFESDIEALKGFIQFITKFSFGFDNFEDVLHYEMARSFDISCLSFFA 986

Query: 928  ENVTVKLQNVDKDEDIWLSLNLPVTTLTSFDLANERYSRRSDLSIPELLFGIYRGDSEST 987
            ++++++L N+D ++  ++SL++P  +L   D    +YS R+++ IP   F +   D  + 
Sbjct: 987  DDISIRLNNIDTNK--FISLSIPNVSLKLLDFGTSKYSLRANIDIPNFDFLVSSMDDHNI 1044

Query: 988  CLGAFSTGVTVTLFERFEQFARCRVLQRKHILVNDAPFHRCSFMLPPEYKKMPIYRSLYG 1047
             LG  ST ++  +F R   F     LQ +HIL++DAPF RCSF+ P EY+   +Y+ LY 
Sbjct: 1045 VLGTISTSISFAIFSRNPDFKTTNNLQTQHILLSDAPFCRCSFLHPQEYQTSDLYKLLYA 1104

Query: 1048 CXXXXXXXXXXXXXXXADNFEVIFEKLLGEIYQEYASDSSYQITDDS---ISSTEHDYHN 1104
                             +NF+ IFE LLG+IYQ+Y S+ ++ I++D+   ++  E   H+
Sbjct: 1105 SIPPSSSIPLLPEPIGPNNFDTIFENLLGDIYQDYISEGTFDISNDTKLQLNIDEFKKHS 1164

Query: 1105 QTVNAAIGTSSSLFIRSQNHQQTLSSFIVEFDPIDGYLDLSATEFMLEIYKYLTEVSLDE 1164
            +   +   T  +L I   +    + SF+ E   I+  + +   E   ++Y+ LT  ++ +
Sbjct: 1165 ENSFSKHKT-KNLTIDIVDELHEVRSFVFELPHINIDIHIDVLEVFADLYRQLTTFTISD 1223

Query: 1165 AIDSLEIGIINQFIQTFGEDNGISEVRVLCPNISLSATNKQSKFSMFKLS-------SKI 1217
             ID L + I+N F +TF   + ++E +V+CP I      +   +  + L        S I
Sbjct: 1224 TIDGLGVDIVNNFSKTFFGASSVTEAKVVCPRIDF----RLRMYEYYALEDVKHYFVSDI 1279

Query: 1218 KNLDITSRIKSSDPNLKPDPE-----KTTLCYKIDYIRANIVQDGIVVPPKQPSQL-FSC 1271
              LD+  R++        + E     K ++ YK   I   ++     + P + S+  +  
Sbjct: 1280 NKLDLNLRLRQEYDKESANSEMNSKNKLSVYYKTALINGKMLSKENFIYPSESSEFSYKS 1339

Query: 1272 SIELLEGYLSYDKLSLLDNNVQSCSVTLSPGTDKLLFEFLNPFISTFDLLQRELSSFEDT 1331
            + E LEGY  YD   + D N+Q   V ++      + EF+      F+   + ++  ++ 
Sbjct: 1340 TFEELEGYAFYDDDLVTDANLQRGCVFINQEHSDSISEFIKTLYLKFNTFIKSVTISKNF 1399

Query: 1332 LLASKREFLLNILRGGRDYEIQHDPPVITKPANITRFSNRHIRSAESWRIIMRLRHILNY 1391
              + KRE L+ I + G+DY IQHDPPVITKPA ITR S  H+R + SWRI+ RLRH+LNY
Sbjct: 1400 NKSMKRELLIRIAQAGQDYGIQHDPPVITKPAVITRLSRHHVRESRSWRIVTRLRHVLNY 1459

Query: 1392 LPQEWHQSFTRHLGTQDFTSPEEAGKEFLSIFSDWRSWEPTDVQGSFVHEKVFTKKRSRP 1451
            LPQ W+++ +  L    F S E+A  +FL IF+ WRSWE  DV+  F+++K +       
Sbjct: 1460 LPQYWYETTSLELQKGKFRSEEDAKLQFLDIFTRWRSWEFADVERCFLYKKTYIPAEV-T 1518

Query: 1452 FAALQGFTFSSDDIRLNMKDDARVPITVKGVTLGIRNNGLAPEQVDGRTEGSMPDPDYIS 1511
            FA  +   FSSD + ++  +  +  + +    + IRN+      V G +  +  +  Y +
Sbjct: 1519 FA--KTICFSSDLLTISFNERDKEHLFMNSFMIDIRNDCYVSSAV-GESMAAKSNNVYKT 1575

Query: 1512 FCTTDEVVMRVDRSFVKTLKEFRDLIHRFKI----GGPVGTAKHDNVSLFSNITFQFGKL 1567
              + DE+ + VD+  +  L +   LIH  K       P+  AK  N     NI+ Q  K+
Sbjct: 1576 VVSLDELQINVDKKIILKLSK---LIHTLKFEYVYSNPIVVAKDANGRC-KNISLQLNKI 1631

Query: 1568 YVVAKLAGVYLRICLDNLSALMLTXXXXXXXXXXXXXXXXFDHMQAILGYRSFRFMTIDI 1627
                 L  V L    + +    L                 FD  +    Y++    ++D 
Sbjct: 1632 TTNCFLGNVSLGFIFERIYVYSLIDTLDSGNNSLLSVLLFFDVAKLFFRYKTRNLFSLDF 1691

Query: 1628 DMFSVLLHYLPGQGCYSIDWKARKFHIDSSSATTKDLTESLPYVRDEIKYLVEALVPEL- 1686
                  L YL  Q  Y     A   +I+SS  +  D+ E+   +R  I  + +     + 
Sbjct: 1692 TDLHFNLTYLSKQKTYGFYHSAEFMNINSSIPSINDIIEANNEIRLHINEIGQDFASNIQ 1751

Query: 1687 FAEPPIERESSGNKIHAVLFQGQVANITLKLQILSPFIILYCAENFELQAESTDSVIFDL 1746
            + E P+  +S   K  A++ +  +A I ++LQ+L PFI+ Y  + FE+  +    +   L
Sbjct: 1752 YTELPVLPDSQVLKPIAMV-KMNIAAINIQLQLLLPFILRYSCKEFEINVDFGRILQSSL 1810

Query: 1747 NSGESYMEISSAKQKLDYFKYTHTCLKLSGTS-SSARLFEHISCDIGILKLSVFDLKTRI 1805
            +  ++ +E+ S + +  Y KY+H+ LKL G    +      IS D    KLS+F+ K  +
Sbjct: 1811 SLQDTSVELLSLEFQEPYMKYSHSYLKLIGMDLGNTDNLGRISLDSSFSKLSIFEPKKNM 1870

Query: 1806 TDLLQDIKAALFSMKSLSDILNISQSSPTASAFGSWFSILPDNLSLQATYAGLLLGFGHT 1865
               L DI+ A+ +++ L   +  ++SS   + F  +  ++P  L+L   Y GLLL FG T
Sbjct: 1871 RLFLSDIEQAVKNIEILRSTMLETKSSTVQNEF-PFSRLIPIQLNLNVEYIGLLLDFGTT 1929

Query: 1866 LYILEFNNFEAKHTRDGLPDAITPRPCFKVDHSIESASFLIKDRRIDDRLAKVVDFAVNF 1925
            LY+LEFNN E   ++D         P F  D+S ES  FLIKDRR+ + L+KV+DF++  
Sbjct: 1930 LYVLEFNNLEFSFSKDKTSSNPVV-PTFSSDYSSESICFLIKDRRVKETLSKVLDFSLRI 1988

Query: 1926 NMVHDTDLCIQSVQIESTHLKITLAPMTVVRLLSLINEFGIIRKQFTEESIY---TPSSA 1982
             ++  + L IQS+QIES++L   L+PM++VRLLS +NEF I++      SIY    P S 
Sbjct: 1989 KVIRSSLLAIQSLQIESSYLHAVLSPMSLVRLLSFVNEFSIMK------SIYHDIKPRST 2042

Query: 1983 HNNSTATECLEPSVWRLIIKSGHILSHDFSIVWLFDIPNSSADGLICGYDRLFSVYEKPY 2042
             +NST       S+  + IKS HILS++  I WLFD+  ++ +GLI GY+RLF+VY+KPY
Sbjct: 2043 SSNSTL------SILPISIKSAHILSYNLCIGWLFDLGYNANEGLIWGYERLFAVYDKPY 2096

Query: 2043 GKLTLLNAYFSAAKILASEADFYSSVVRKQRINTSYLSDMQLRYWFTEDSENTDLFIRIH 2102
            GKLTLL+AYFS A   +S + +Y     K  +N SYL  MQ+ YW  E++   DLFIR++
Sbjct: 2097 GKLTLLDAYFSVAHGFSS-STYYPDGNEKGAMNRSYLPSMQINYWLEEENGTKDLFIRVN 2155

Query: 2103 GAKLAVDISAEIVTLLEETIQSIQTFNNLKKALVDPFRTKKQDSDISKEPYNWNNQLATG 2162
            G +L V + A   T+++E  QS+  F  LK+ ++DP +    D  + +  Y  +N LA+ 
Sbjct: 2156 GEELDVSLLAWWFTIVDEATQSLHKFKKLKETILDPLKVTSNDPILGEWNY-LDNPLASS 2214

Query: 2163 VRSLNCIINYAGVTLKLHSHDG-RGDASPLELTSPSYKVAIDYKYFPNLEKTHRFRTLIT 2221
            VRS+NCIINYAG ++KL+S D  +      E+ SP++ V IDYKY+P+ +K+H  RTL T
Sbjct: 2215 VRSINCIINYAGSSMKLYSRDDIQHGTCSFEIRSPAHTVTIDYKYYPSKKKSHWIRTLAT 2274

Query: 2222 ATPTHNTFYSTSAFLIHDLCYRFXXXXXXXXXXXXXXXXXXXXXIKVEGSDNSTLLGSID 2281
               THNT +     L++++   F                      K E  +   LL + D
Sbjct: 2275 VNTTHNTLFPVCVPLLNEMWLTFNTMLKNSCSQFSNGAPNLASA-KAE-INYRDLLEAFD 2332

Query: 2282 LVIILNVGKQEVTFSCEPKAKVQATVGXXXXXXXXXXXXXXXXXSLCLAIEIENLMTNSR 2341
            + +I+NVGKQE++ +CEP AK+QAT+G                  LCL++++ NLM +SR
Sbjct: 2333 IAVIINVGKQEISLTCEPTAKIQATIGFEKFDIKIFTNSMVPDEPLCLSVDLHNLMASSR 2392

Query: 2342 HIYSREVCASLKLRHISMVFDIMGSQVRRIYGSTLISSPLFYFNMKQLQDLKLFIDQWFP 2401
            H++SRE+ +SL L+ ISMVF +  S+    YGSTLIS PLFYFN+KQ++DL LF++ W  
Sbjct: 2393 HVFSREISSSLSLQQISMVFSLTHSEYIHTYGSTLISKPLFYFNVKQIEDLNLFLEIWSI 2452

Query: 2402 QK---------TPMNTGSYPEGVLVDDISRXXXXXXXXXXXXXXXXXXXXVIVAGSCAEI 2452
            +K          P+   S+     +  + R                    +I++   AEI
Sbjct: 2453 EKQKSVNDIILAPVTASSFESVPSMPKLQR--------VPINATFSWDYLLIISEIGAEI 2504

Query: 2453 ELGPSLGVLNVTSEDVWAISKQQVDWSQQLDLNMGKLDVTSSGRLGGNFLVRNAHLSLEL 2512
            +LGPSLG++ V S+++W +S   +DW+Q+L ++M ++ ++SSGRLGG   +++     ++
Sbjct: 2505 DLGPSLGLVKVKSDNLWGLSSHNIDWTQKLLISMKEICMSSSGRLGGYVFIKDIVWKSKI 2564

Query: 2513 KWPNPKDFFQVPLVCVKLGSDTVDTKLSFDYHTFFISSLKQGYASLFNERDEDGSLADLL 2572
             WP   +F  VPLV + L     +TKLSFDYH FFIS+++     LFN++DE G LADLL
Sbjct: 2565 TWPIINNFHGVPLVELSLALGAFNTKLSFDYHMFFISTIQNAAIELFNQQDERGFLADLL 2624

Query: 2573 SVTVSFESVNIFLTALAAANISDIKNSITRLKKDNELSYLSSFLASDQPSDEPEEDGGIF 2632
            SV+VS +++ +F+T+LA AN+ DI ++I R++ D+  + L    +++       ++  + 
Sbjct: 2625 SVSVSVDNIQVFITSLAYANLFDIYSTIRRMRNDSGRTNLDLLESNELKKISSFDNSKML 2684

Query: 2633 DXXXXXXXXXXXXXGVFRLQISPTSLFDSDVLILTATKMMANTGIQA------DIKIKTD 2686
                           +  L I  T+L  ++V++L   K++ANT  +A      D K++T+
Sbjct: 2685 ASLLSLRTELSVNAQLLNLHIFSTTLIGTEVVVLRTRKVIANTKNEASSKTTSDAKVQTE 2744

Query: 2687 LHWQLDDVSLALLPFNNSLDESYLATMEVGKYIELSSTIQGGAIFSAPSIVVNMTTWQEP 2746
            L WQL D+SL+L  F + LDE+ L  ++V  Y++L+S I GG I  APSI V M TWQ  
Sbjct: 2745 LTWQLQDMSLSLSSFKHQLDENQLDKIDVIDYVKLASIIHGGIILEAPSIFVTMNTWQSQ 2804

Query: 2747 QSNVIELLYSTSFGGTVKIRWNLGPISFIKDMWQAHMNAMQLREGYYHGLAESGVAVTPL 2806
             SNVIELLYS+SFG  V I WNL PI+FIKDMW  H+NAM+LR       +E  +     
Sbjct: 2805 YSNVIELLYSSSFGNGVSITWNLRPINFIKDMWSIHINAMKLRHMQKGNSSEIHIPKDE- 2863

Query: 2807 NSKAVPLEMHLGSDYQYLPLQEPDIEMPRIKDLGDATPPIEWFGVNRTKFPGFTHQFVIV 2866
            + +A   ++ LG+ Y Y PL+EP+IEMP+IKDLGDATPP+EWFG+NR++FPG THQ V+V
Sbjct: 2864 DIEAKLAKVDLGTKYIYKPLEEPNIEMPKIKDLGDATPPVEWFGLNRSRFPGLTHQIVVV 2923

Query: 2867 PLQKLARTAEKEYEKILGRA 2886
            PLQKL+  AEKEY +ILG+ 
Sbjct: 2924 PLQKLSAVAEKEYVRILGKV 2943

>NCAS0B05010 Chr2 complement(922165..931023) [8859 bp, 2952 aa] {ON}
            Anc_8.260 YLR087C
          Length = 2952

 Score = 1352 bits (3498), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 898/3024 (29%), Positives = 1463/3024 (48%), Gaps = 251/3024 (8%)

Query: 6    IFYVGRVLGYIVSKAANLVLWKQYRVTVSIQSLVFSPLAGKVHFKNVSVTSQDQLISVLK 65
            IFY+GR + YI++     +LWK  +V V+IQSL  S L G++ FKNV++  +D  IS+L+
Sbjct: 37   IFYLGRTIAYIITFILEWLLWKHAKVKVNIQSLRISLLGGRIFFKNVTIIHKDSTISILE 96

Query: 66   GTITWRYWLIGRYR---RSGTADGARR-----------CRFALKFEGFEYFVYNRNGVYD 111
            G ITWRYWL    +   +  + D  +            CRF +  EG E F+YN+   YD
Sbjct: 97   GNITWRYWLFNTRKPEFQEASVDETQTKPTSIKNWQLPCRFVVNLEGLEIFLYNKTVAYD 156

Query: 112  RIARELDGEDXXXXXXXXXXXXXXXIAELQ------------------------------ 141
             I +    E+                A ++                              
Sbjct: 157  NIIQMFSKEERFQFEKFLNEQILSDSATVKSMDDSQFDTSESTSTDKSESSATNDRVFQE 216

Query: 142  ---DDPLIRRFLPVEFLHNKGAIVLGNKQTHSVAIMNYEKLAGTVSIEVPDDTRAPSSFR 198
               D     RFLP++FL  +G+++LGNK T S+ I++ +     +    P +      F+
Sbjct: 217  EETDTSSFLRFLPIQFLVTRGSLILGNKFTPSLLIVSADSADALMDFAQPKEKLDLYKFK 276

Query: 199  TEAKISNCTVAIKPNISYEVDNPVKIYVEPKRTARLWKKYKTLLGTVLEAT--LHAKRKK 256
              A++ N    +K NI ++ D  +K  ++  + + +W  +  +LG + +     H  R+K
Sbjct: 277  LSAELINTEATLKQNIGFDEDVSMKFKLDRGKVSEVWNHFTRMLGILYKPLRFTHMHRRK 336

Query: 257  EQHQTPKWYDNWRGLSMYD---VNXXXXXXXXVKFDIEHHEYAKCTTVLKADQMDVTYSY 313
             +H+  K+   WRGL++Y    +         ++FD  +HEYAK +++LK+ ++  T  +
Sbjct: 337  NEHE-DKFQAKWRGLALYKGTGLGERRNDIDDIEFDFANHEYAKFSSILKSPKVTFTSQH 395

Query: 314  GMPGTARVTDSDNAENPLLERPEL-------DHSVDILVYDANCTYGPWANRQVQQCLRV 366
             MPG   V    +    +L+ P++       D+S+DI ++  +  +GPWA RQ     ++
Sbjct: 396  DMPGI--VPHGAHPTISVLDGPDVGNSGAPPDYSLDIQIFGGSVCFGPWAQRQADHLWKL 453

Query: 367  FSPTVCRNFKLRTPEEIAQQTEPAAFKLS------VTIMEDSVLRVPMKESSKDAAFLEK 420
             SP V R  K   P    ++  P   ++       VTIM+D+  R+P +ESSKD  FL+ 
Sbjct: 454  LSPVVSRTAK---P---VKRLTPGCRRIYTYGQVLVTIMDDATWRIPTRESSKDFEFLQH 507

Query: 421  YKQTRDETRPFGWIDIRIAKESNITVRMAAYPTENGFENILHANLVDTTISTSVNHDTLL 480
            Y++T  E RPFGWID++ +KE+ +    A  PT +GF+N +  +L +    +SVNHD LL
Sbjct: 508  YRETNGEYRPFGWIDLKFSKETTVNTTFALCPTVDGFKNNIKIHLTENETRSSVNHDILL 567

Query: 481  KAKSHDITVDFSYPYGWQDKAEWNFNVCSTQAELFVLRDHVYLISDLVTDFSGGEEVLYE 540
            K K  D  +D S+P GW D+A W  N+ S+Q E F+LR+H+ LI+D +TDFS GE   YE
Sbjct: 568  KCKYFDFDIDTSFPLGWNDEATWTINLNSSQMEAFILREHITLIADTLTDFSSGEPTPYE 627

Query: 541  QFRPFDYRFRWDIRGYSAYLNVNDANIINNPIDFGENCYLSVHGDDAEITFSLPITSIIQ 600
             FRPF Y   W I GYS YLNVND NI+NNP+DF ENCYLS HGD+  + F +P TSI  
Sbjct: 628  LFRPFIYSINWKIDGYSLYLNVNDHNIVNNPLDFNENCYLSFHGDELSLDFLIPKTSITA 687

Query: 601  KYVTVDFNIFTPHFSLFLNAPPWHTFSELLHYKEIGRSKNFNIKGSYTSYSEVDVDNVDA 660
            ++  + + I TP F L LN PPW+T +E + +KE+GRS +F + GSY  YS++D+DNVD 
Sbjct: 688  RHTDISYTIKTPMFRLLLNTPPWNTLNEFMKHKEVGRSYDFKVVGSYLIYSDLDIDNVDT 747

Query: 661  LNIACETDYIVVLCYGVILKCMLNVKVNYFGEMVHFRTTEEYVEELQRRNKQNPSTCRPF 720
            + + C +    + CYG +++ ++NVK+NYFG+  HF T+EEY   ++             
Sbjct: 748  IMMDCTSKGTTLQCYGFVVRYLINVKMNYFGDFFHFVTSEEYTGAIRA------------ 795

Query: 721  NSDGNVHDSDVVATESNEIIDASFDAFGGP------PTIKKSALKRSINELDVWFTFISK 774
            N D   + S+     S+     +      P        +++S LKR+ NE D+WFTF   
Sbjct: 796  NEDDMQYASESDDDRSSISSFDTMQGNDAPGRRRLHTELQRSDLKRTTNETDLWFTFTVW 855

Query: 775  GGCFFFPENIYKFDACLGFYFDNLEASLRFLNYYVDAAVSLDSIYFKRHTDIDARTLFKV 834
             G    PE IY  D C+G +F  L   LR  NYY+D   +++ +  KR+       +F+ 
Sbjct: 856  EGALLLPETIYNCDPCVGLHFGELVIDLRSCNYYMDLLANMNDVSIKRYVSKHPHEIFEA 915

Query: 835  IEDIGIPIDASDAYLSQFSFRLHKMLGIMPSEESYACEFDVRVDTLDVHCDLAVLKAFVN 894
            I         +   LS  +   H+M G+ P E +Y C++D  + TLD+  D+  L+ F +
Sbjct: 916  IHKNNGEEYHTHGSLSSLTIHGHRMYGLPPMEPTYFCQWDFDLGTLDIASDIEFLRGFFS 975

Query: 895  TLRNLAFGFKDVENSLQYEREQVFDLNKISCVIENVTVKLQNVDKDEDIWLSLNLPVTTL 954
            +   + FG+ D+EN L YE+E   D+  ++  +E ++V LQ  +   +++ S +L     
Sbjct: 976  SFTRIGFGYVDLENILLYEKETYDDMTSVTVNLEKLSVMLQ--EPKLNMYASFDLNNLYF 1033

Query: 955  TSFDLANERYSRRSDLSIPELLFGIYRGDSESTCLGAFS--TGVTVTLFERFEQFARCRV 1012
            T  D  NE+YS R DL IP L F ++  + + T    F+  T V +T F + + F   R 
Sbjct: 1034 TFIDFENEKYSTRLDLIIPTLEFSLFIKEEDGTTKKLFTLETKVKITNFVQSQDFDEHRK 1093

Query: 1013 LQRKHILVNDAPFHRCSFMLPPEYKKMPIYRSLYGCXXXXXXXXXXXXXXXADNFEVIFE 1072
             QR++I ++DAP+HRCSF+LP EY+    Y+ L+G                    + I E
Sbjct: 1094 TQREYIKLHDAPYHRCSFILPQEYQDAEQYQELFGAIAPSSSLPPLPVPLIPSTTDFIIE 1153

Query: 1073 KLLGEIY---------------QEYASDSSYQITDDSISSTEHDYHNQTVNAAIGTSSSL 1117
             LLGE                 Q+YA+D S   T++ I   E +  ++ +          
Sbjct: 1154 DLLGEFQDLLETSSPFRMPFSDQDYATDVSDDETEEDIDPLEFNTPSEAI---------- 1203

Query: 1118 FIRSQNHQQTLSSFIVE------------FDPIDGYLDLSATEFMLEIYKYLTEVSLDEA 1165
                QN +    SFI++             D I  +L L +TE +++I            
Sbjct: 1204 ----QNDKCERDSFIIDVSFISIEICPDILDSIGTFLMLFSTENIVQI------------ 1247

Query: 1166 IDSLEIGIINQFIQTFGEDNGISEVRVLCPNISLSATNKQSKFSMFKLSSKIKNLDITSR 1225
            ID +EI  +N+          ++ V++    + L   ++        +   +  +D    
Sbjct: 1248 IDDIEIATVNRLSNLREGAFKLTNVKINILYLDLFWGSRTDT----GVGIYLDRIDFAMC 1303

Query: 1226 IKSSDPNLKPDPEKTTLCYKIDYIRANIVQDGIVVPPKQPSQLFSCSIELLEGYLSYDKL 1285
             K+ + N +    + T+  KI  +R  + Q       ++     S  IE  E + S  + 
Sbjct: 1304 EKTVEENKEKKLIELTVLNKIRSVRGTVNQTAANSKNEERPPALSLVIEGWEIWSSTVED 1363

Query: 1286 SLLDNNVQSCSVTLSPGTDKLLFEFL-NPFISTFDLLQRELSSFEDTLLASKREFLLNIL 1344
             +   N+ S  +T+     + LF +  N  +   D+++    + +   + S++E + ++ 
Sbjct: 1364 QVNSLNILSTDITVDEAQLEWLFGYFDNQGLQIQDMIKTS-DTIQKRKIESRKELISSLT 1422

Query: 1345 RGGRDYEIQHDPPVITKPANITRFSNRHIRSAESWRIIMRLRHILNYLPQEWHQSFTRHL 1404
                 Y+I HDP VITKPA ITR S  H+R   SW+II RLRHIL YLP++WH +  R L
Sbjct: 1423 AASEYYQISHDPYVITKPAFITRLSRGHVRENRSWKIITRLRHILTYLPEDWHSTINRSL 1482

Query: 1405 GTQDFTSP--EEAGKEFLSIFSDWRSWEPTDVQGSFVHEKVFTKKRSRPFAALQGFTFSS 1462
             TQ  T+   ++A   F+S+FS+WR+WE +D+  S+++ K+F  + S      Q    + 
Sbjct: 1483 -TQSKTAATTQDAKGIFISVFSNWRNWEFSDIARSYIYRKLFLNQHSN-----QEIHTTK 1536

Query: 1463 DDIRLNMKDDARVPITVKGVTLGIRNN------GLAPEQVDGRTEGSMPDPDYISFCTT- 1515
              I + +   A   +TV      + +N       L  E     ++ S+      +   T 
Sbjct: 1537 KSITIKI---ASFFVTVYSAGYEVEHNFIITRTNLLLETNSPTSDSSLSRETIFNITGTL 1593

Query: 1516 --------DEVVMRVDRSFVKTL--------KEFRDLIHRFKIGGPVGTAKHDNVSLFSN 1559
                    D+++M   ++ + +L        KE  D +  FK+   +   + +       
Sbjct: 1594 GTAKGKLSDKIIMI--KNLLPSLKITDGGKSKETFDFVKSFKLNTLILCERGE------- 1644

Query: 1560 ITFQFGKLYVVAKLAGVYLRICLDNLSALMLTXXXXXXXXXXXXXXXXFDHMQAILGYRS 1619
            +    G   +V+++ G  L +  +  S   LT                  H+ A L    
Sbjct: 1645 LQIDIGNTRLVSRVFGARLSMLWE--SPKDLTSQAVSLAVYTQRAEIHLKHINATLAEIQ 1702

Query: 1620 FRFMTIDIDMFSVLLHYLPGQGCYSIDWKARKFHIDSSSATTKDLTESLPYVRDEIKYLV 1679
             R  ++ +   S    Y P      ++ +    H+ + +AT   L  S+  + + I  + 
Sbjct: 1703 IRDFSLIVTTES--WSYKP---TILVNSQCSDLHLMAMTATDI-LVASIKEIMENIHRIE 1756

Query: 1680 EALVPELFAEPPIERESSGNKIHA-VLFQGQVANITLKLQILSPFIILYCAENFELQAES 1738
            + L+    AE   + ES G K     +      NI+ +L  +SPF I + A+  ++    
Sbjct: 1757 QDLLAGTRAEKITKVESHGPKPKVNTILTCFFTNISFELMPISPFFIRHEAKQLDIYFNR 1816

Query: 1739 TDSVIFDLNSGESYMEISSAKQKLDYFKYTHTCLKLSGTSSSARLFEHISCDIGILKLSV 1798
              S    L+  ++ + ++S   K  YF+++   L+L G   +     ++     ILKL+V
Sbjct: 1817 FGSNEILLSVWDADIYLTSHLTKQQYFRFSFGDLQLKGNMVNDPYHINLYLSASILKLTV 1876

Query: 1799 FDLKTRITDLLQDIKAALFSMKSLS--DILNISQSSPTASAFG----SWFSILPDNLSLQ 1852
             D++  I   LQD K    S++     D+  +S++  +         SW      ++   
Sbjct: 1877 SDVQKLIPSFLQDEKILTESIEDFITLDLFGLSKNQKSKPEKDNNKFSW------SIDTN 1930

Query: 1853 ATYAGLLLGFGHTLYILEFNNFEAKHTRDGLPDAITPRPCFKVDHSIESASFLIKDRRID 1912
              Y GLL   G   ++ E     A  T+ G    I  +       S+E+  F IK+R + 
Sbjct: 1931 INYFGLLAPIGSAYFLFELRMLLASLTKMG--SDIPNQSDISGQFSVENVLFFIKERALP 1988

Query: 1913 DRLAKVVDFAVNFNMVHDTDLCIQSVQIESTHLKITLAPMTVVRLLSLINEFGIIRKQFT 1972
             RL+K++DF++  + +        + QIES+H ++ L+P ++VRLL   N+     + + 
Sbjct: 1989 VRLSKLLDFSIKVSALQKKKNTSNTYQIESSHFRVCLSPESLVRLLWATNQVSTSIQYYK 2048

Query: 1973 EESI---YTPSSAHNNSTATECLEPSVWRLIIKSGHILSHDFSIVWLFDIPNSSADGLIC 2029
            +  +   +   S  NN      L      L + S HILS++F + WLF + + S  GLI 
Sbjct: 2049 DHHVDNKWDLRSKLNNIPKAPDLP-----LNVPSFHILSYNFCVGWLFSVDSKSEPGLIL 2103

Query: 2030 GYDRLFSVYEKPYGKLTLLNAYFSAAKILASEADFYSSVVRKQRINTSYLSDMQLRYWFT 2089
            GY+RLFS YEK  GKLTL++ +FS A   +S+ +F+S    K + N SYL +MQ+ YWF 
Sbjct: 2104 GYNRLFSAYEKNLGKLTLVDVFFSIANGNSSD-NFFSEGKEKDKYNRSYLPNMQISYWFK 2162

Query: 2090 EDSENTDLFIRIHGAKLAVDISAEIVTLLEETIQSIQTFNNLKKALVDPFRTKKQDSDIS 2149
            +     DLF+R HG  L V   +  + ++E  + S+QTF  LKK L+     K++ +D  
Sbjct: 2163 DAGTMRDLFVRFHGEALDVTFLSSYLDVIESALTSVQTFQELKKDLIPGLPKKQKVNDDK 2222

Query: 2150 KEPYNWNNQLATGVRSLNCIINYAGVTLKLHS-HDGRGDASP-LELTSPSYKVAIDYKYF 2207
                N  +     +RS++C   Y G   K+ S  D    + P  E+ SP+  + ++YK+ 
Sbjct: 2223 TLELNTLSPFLANIRSISCQFKYDGGVFKIFSLEDAETQSEPSFEVNSPNVVIDLNYKHL 2282

Query: 2208 PNLEKTHRFRTLITATPTHNTFYSTSAFLIHDLCYRFXXXXXXXXXXXXXXXXXXXXXIK 2267
             N  K H  R+LI    THN  Y+  A L+ D   R                        
Sbjct: 2283 ENRTKQHWIRSLIKINSTHNILYAKCAPLLSDFFERIQGMVKKHSSSEESTLSKPSS--- 2339

Query: 2268 VEGSDNSTLLGSIDLVIILNVGKQEVTFSCEPKAKVQATVGXXXXXXXXXXXXXXXXXSL 2327
             +  D   LL S D+ + +   KQ+++ SCEPKAKVQA +G                  L
Sbjct: 2340 -QNLDYKRLLDSFDIALKITSAKQQLSLSCEPKAKVQADIGFQSFIFTVTTNDLDAAEPL 2398

Query: 2328 CLAIEIENLMTNSRHIYSREVCASLKLRHISMVFDIMGSQVRRIYGSTLISSPLFYFNMK 2387
              ++ +E    + +HI+SRE   S+ +  + +        V  ++G+ LIS+   +FN+K
Sbjct: 2399 SFSLSVEKTEASIKHIFSRETSTSIGVDFVDVTLMFTHPDVINVHGTALISNINLFFNVK 2458

Query: 2388 QLQDLKLFIDQWFPQKTPMNTGSYPEGVLVDDISRXXXXXXXXXXXXXXXXXXXXVIVAG 2447
            QLQ+L LF+D W   +      S P   +V   +                     +I   
Sbjct: 2459 QLQNLYLFLDIW---RLSDLLKSKPANDIVKAKTDSSLSIAQLSDPESIIPWCFTLIFTN 2515

Query: 2448 SCAEIELGPSLGVLNVTSEDVWAISKQQVDWSQQLDLNMGKLDVTSSGRLGGNFLVRNAH 2507
               +++LGPSLGV++V  +  W  +    +  + L        ++S GRL G F ++ A 
Sbjct: 2516 VKGDVDLGPSLGVISVQLKRTWFATDHYKNMRKVLHAFTDGTSLSSKGRLSGIFELKGAS 2575

Query: 2508 LSLELKWPNPKDFFQVPLVCVKLGSDTVDTKLSFDYHTFFISSLKQGYASLFNERDEDGS 2567
               E+ WP        PLV + +  D + TK +FDYH F I ++      L +E+D +G 
Sbjct: 2576 WISEVNWPTDTTINAHPLVSITMNIDEISTKAAFDYHMFLIGAINNTRVHLHSEKDVNGV 2635

Query: 2568 LADLLSVTVSFESVNIFLTALAAANISDIKNSITRLKKDNELSYLSSFLASDQPSDEPEE 2627
            + DLL VT   ES+ +  TAL AANI DI N+  R+++DN++SY+ +   S++   +P  
Sbjct: 2636 MPDLLKVTFLCESITLCSTALVAANILDIYNTAMRMRQDNKISYIETLRESNEAESKPPI 2695

Query: 2628 D-GGIFDXXXXXXXXXXXXXGVFRLQISPTSLFDSDVLILTATKMMANTGIQADIKIKTD 2686
            +   I                   +QISP +LFD +VL++T   + A +   +  K+ T+
Sbjct: 2696 NYTDILRSLNLLQTDVSVDIYTLNIQISPITLFDVEVLVITIESISARSETHSGKKLMTE 2755

Query: 2687 LHWQLDDVSLALLPFNNSLDESYLATMEVGKYIELSSTIQGGAIFSAPSIVVNMTTWQEP 2746
            L  Q+ D S++L      +DE+ ++ + V  Y++ +S I GG I   P ++V+MTT+QE 
Sbjct: 2756 LEMQVYDASVSLSTSKEEMDEATVSKISVKNYLQYASKIVGGTIIEIPKLLVSMTTFQEE 2815

Query: 2747 QSNVIELLYSTSFGGTVKIRWNLGPISFIKDMWQAHMNAMQLRE----GYYHGLAESGVA 2802
            +S+++E LY+  F   + +RWNLGPI+FIK+MW  H+ A+ +R     G   G +E  V 
Sbjct: 2816 KSDILEYLYTCVFDDKLSVRWNLGPINFIKEMWTTHIRAIAVRRSQVVGVLDGQSEEDV- 2874

Query: 2803 VTPLNSKAVPLEMHLGSDYQYLPLQEPDIEMPRIKDLGDATPPIEWFGVNRTKFPGFTHQ 2862
                  K +  E +  S ++Y+ L+ P I+MP+I+DLGDATPP+EWFGVNR +FP FTHQ
Sbjct: 2875 -----EKRIKEEENF-SRFKYVALEPPRIDMPQIRDLGDATPPMEWFGVNRKRFPAFTHQ 2928

Query: 2863 FVIVPLQKLARTAEKEYEKILGRA 2886
              +  +QKL  +AE+EY  ILG +
Sbjct: 2929 TAVFLVQKLVYSAEREYANILGSS 2952

>TBLA0E04420 Chr5 complement(1126342..1135788) [9447 bp, 3148 aa] {ON}
            Anc_8.260 YLR087C
          Length = 3148

 Score = 1110 bits (2870), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 789/2662 (29%), Positives = 1261/2662 (47%), Gaps = 170/2662 (6%)

Query: 316  PGTARVTDSD---NAENPLLERPELDH-------SVDILVYDANCTYGPWANRQVQQCLR 365
            P T R  +SD   N +     R   D+       +++  ++DA+  YGPWA+R +    R
Sbjct: 564  PDTDRNNESDASNNQQRNTYSRSTTDNISAPPESNMEFQLFDASINYGPWAHRNIMNIQR 623

Query: 366  VFSPTVCRNFKLRTPEEIAQQTEPAAFKLSVTIMEDSVLRVPMKESSKDAAFLEKYKQTR 425
            +FSP V R  +L+   E          K+SV+IMEDS  RVP +E SKD  FL++Y +T 
Sbjct: 624  IFSPIVSRTPELQPDPEPGFLRRYTMTKISVSIMEDSSWRVPTREPSKDQDFLKRYMKTN 683

Query: 426  DETRPFGWIDIRIAKESNITVRMAAYPTENGFENILHANLVDTTISTSVNHDTLLKAKSH 485
            D +R FGW D+  ++ S  T  +++ P  NG+ N L+ +  D  + +SVNHD   ++KS+
Sbjct: 684  DSSRSFGWFDLNFSRNSEATFCISSIPDVNGYANKLNLDFKDLEVRSSVNHDIFFRSKSY 743

Query: 486  DITVDFSYPYGWQDKAEWNFNVCSTQAELFVLRDHVYLISDLVTDFSGGEEVLYEQFRPF 545
             +  D  YP GW D+  W+F   S Q E F LR+H+ LI+D  +DFS GE   YE FRP 
Sbjct: 744  RVDSDIGYPLGWNDEVTWSFVFDSYQLETFFLREHLVLIADTFSDFSSGEPTPYEFFRPS 803

Query: 546  DYRFRWDIRGYSAYLNVNDANIINNPIDFGENCYLSVHGDDAEITFSLPITSIIQKYVTV 605
             Y+  W+  GYSAYLNVND NIINNP+DF ENCY+SVHGDDA I   +P   I   Y  +
Sbjct: 804  IYKVDWNFHGYSAYLNVNDHNIINNPLDFNENCYISVHGDDAHIGVEIPRLGITATYTDI 863

Query: 606  DFNIFTPHFSLFLNAPPWHTFSELLHYKEIGRSKNFNIKGSYTSYSEVDVDNVDALNIAC 665
             F I TP F L LN PPW+T +E +  KEIGR  +F  +GSY  YS++D+DNVD+L I C
Sbjct: 864  IFQISTPMFRLLLNTPPWNTLNEFMRNKEIGRGYDFTAEGSYIIYSDLDIDNVDSLTIEC 923

Query: 666  ETDYIVVLCYGVILKCMLNVKVNYFGEMVHFRTTEEYVEELQRRNKQNPSTCRPF----- 720
             T  + +L YG ++  +LNV++NYFGE  HF T EEY + ++  +    ST   F     
Sbjct: 924  STRRMTLLTYGFVIGYLLNVQMNYFGEFSHFITAEEYTDIVRGNDNDIVSTLADFSVMSE 983

Query: 721  -NSDGNVHDSDVVATESNE--IIDASFDAFGGPPTIKKSALKRSINELDVWFTFISKGGC 777
             NS  NV +S      S++  IID  ++     P ++K  +KR +NE D+WFTF    G 
Sbjct: 984  TNSVSNVSNSQHNPDNSSKSNIIDPLYN-----PPLRKDDIKRKVNETDIWFTFSVWEGA 1038

Query: 778  FFFPENIYKFDACLGFYFDNLEASLRFLNYYVDAAVSLDSIYFKRHTDIDARTLFKVIED 837
               PE +Y  D C+   F  L    R  +YY+D   +L+   FKR    +   +F+++ +
Sbjct: 1039 LLLPEVLYNSDPCIALSFKELIIDFRNCDYYLDLLATLNGTSFKRCIRKNQNDIFELVHN 1098

Query: 838  IGIPIDASDAYLSQFSFRLHKMLGIMPSEESYACEFDVRVDTLDVHCDLAVLKAFVNTLR 897
              I        +S  S   H+M G  P+  SY  ++ V V+ L ++ D+  ++ F++ + 
Sbjct: 1099 NAIKNLEEHGSVSNISIHGHRMYGAPPTSPSYFSDWAVDVNNLSINSDIYFIRGFISYIT 1158

Query: 898  NLAFGFKDVENSLQYEREQVFDLNKISCVIENVTVKLQNVDKDEDIWLSLNLPVTTLTSF 957
             + F F +++N L Y+ E V D N  S  +    + +   DK     + LN+   T    
Sbjct: 1159 KVGFEFSNLQNILLYD-ESVLD-NMTSVTVHGTGIDILVADKSTSAQVLLNMDGITFNRI 1216

Query: 958  DLANERYSRRSDLSIPELLFGIYRGDS--ESTCLGAFSTGVTVTLFERFEQFARCRVLQR 1015
            + AN+RYS R DL +P L F  +   S  + TCL  F T +  T F + +        Q+
Sbjct: 1217 NFANDRYSSRIDLQVPGLHFAFFDNGSSMDKTCLFEFKTKINFTNFTQMKDGELHSKKQQ 1276

Query: 1016 KHILVNDAPFHRCSFMLPPEYKKMPIYRSLYGCXXXXXXXXXXXXXXXADNFEVIFEKLL 1075
            + I +ND+ FHRCSF+L P  ++  +Y  LYG                A+    I +  L
Sbjct: 1277 EFIALNDSAFHRCSFLLLPHIQESLLYHELYGGITPSSSVPPLPIPVQAETIAFIIDDFL 1336

Query: 1076 GEIYQEYASDSSYQITDDSISSTEHDYH------NQTVNAAIGTSSSLFIRSQNHQQTLS 1129
            G     +  +S+  +   S S+  H  +      + +V   I +  S  + SQ+   T  
Sbjct: 1337 G----PFGINSTELLGSISTSTPIHSSNKPLKPPSSSVIHPIESMQSHLVPSQS--VTHG 1390

Query: 1130 SFIVEFDPIDGYLDLS------ATEFMLEIYKYLTEVSLDEAIDSLEIGIINQFIQTFGE 1183
            ++I++   I   LD++      A+ F+ E Y      ++ E ID +E+ I+N+      E
Sbjct: 1391 NYIIDISYIT--LDINPLFFTYASNFLDEFYSE----NIIETIDGIEMAIVNRLGTKSEE 1444

Query: 1184 DNGISEVRVLCPNISLSATNKQSKFSMFKLSSKIKNLDITSRIKSSDPNLKPDPEKTTLC 1243
             + ++ +++    +      + ++     L   +  +D+    K+         ++  + 
Sbjct: 1445 LDSVTNIKLQIKYLDFFFGQRNTE----GLELYVDQIDLEVSQKTFQKKSTVVLDEIAIL 1500

Query: 1244 YKIDYIRANIVQDGIVVPPKQPSQLFSCSIELLEGYLSYDKLSLLDNNVQSCSVTLSPGT 1303
             +   +RA+I +  ++    +     S ++E  EG+ S     +   N+ S  +T+    
Sbjct: 1501 SRFLSLRASINEKKVLEDFDERPPALSLALEGWEGWSSTASSQVNSLNISSTDITVDESQ 1560

Query: 1304 DKLLFEFLNPFISTFDLLQRELSSFEDTLLASKREFLLNILRGGRDYEIQHDPPVITKPA 1363
             + L ++LN  +     L   L S +      +++ + ++      Y+I HDP VITKPA
Sbjct: 1561 IEWLIDYLNRLVVFVHELVNSLDSIQKKSNGIQKKLVSDLTLASEYYQISHDPYVITKPA 1620

Query: 1364 NITRFSNRHIRSAESWRIIMRLRHILNYLPQEWHQSFTRHLGTQDFTSPEEAGKEFLSIF 1423
             + R S  H+R   SWRI+ RLRHI  YLP +W       +  +D     ++   FL++F
Sbjct: 1621 YVMRVSKGHVRQNRSWRIVTRLRHIYTYLPDDWEIHVQEEMRGKDMNDVSDSSDIFLTVF 1680

Query: 1424 SDWRSWEPTDVQGSFVHEKVFTKKRSRPFAALQGFTFSSDDIRLNMKDDARVPITVKGVT 1483
            S+WR+WE +DV  S++++K+F                S+D+     K    V + +  + 
Sbjct: 1681 SNWRNWEVSDVARSYIYKKIF---------------LSNDETTSEKKLQTTVKLNLNSIF 1725

Query: 1484 LGIRNNGLAPEQ----------VDGRTEGSMPDPDYISFCTTDEVVMRVDRSFVKTLKEF 1533
              I + G A +           ++  TE ++  P        ++ ++ +  S      EF
Sbjct: 1726 FTIYSTGYAIDHNIILTKAVILLELTTETAVSPP-------IEKSILNMTGSLGSIKGEF 1778

Query: 1534 RDLIHRFKIGGPVGTAKHDNVSLFSNITFQFGK-------LYVVAKLAGVYLRICLDNLS 1586
             D   R     P  + + D  SL  N +    K       L+++ +  G+ L +    LS
Sbjct: 1779 SDKFLRLLELIPDFSKEEDIKSLTENSSIVSEKSPYFTIHLFLLFENGGLQLTMGDTTLS 1838

Query: 1587 ALMLTXXXXXXXXXXXXXXXXFDHMQAILGYRSFRFMTIDIDMFSVL-LHYLP--GQGCY 1643
               +T                F +  A    +S   +  + D+ +   LH+L     G Y
Sbjct: 1839 N-NVTDGKISALLEKSSYSKEFSYSGAYYMKKSEMCLKHNKDIIAEFQLHHLGLISTGIY 1897

Query: 1644 S-------IDWKARKFHIDSSSATTKDLTESLPYVRDEIKYLVEALVPELFAEPPIERES 1696
            +       I+ ++   H   S A+T+ + +++  + +   +L +      +   P + + 
Sbjct: 1898 TPICPVILINLRSADLHF-KSLASTEKIVKTIEDITEYSVHLYKHYDLRKYTTKPTKVDQ 1956

Query: 1697 SGNKIH-AVLFQGQVANITLKLQILSPFIILYCAENFELQAESTDSVIFDLNSGESYMEI 1755
               KI+  V     ++ ++ +L ++SPF + Y  +  +L           L+  ++ + +
Sbjct: 1957 KPEKINFDVRVACNLSKVSAELTLISPFYLRYETKQLDLYFNQNGDGEILLSLWDTDIFV 2016

Query: 1756 SSAKQKLDYFKYTHTCLKLSGTSSSAR-LFEHISCDIGILKLSVFDLKTRITDLLQDIKA 1814
            +S   K  YF++++  ++++    S +     +S    ++KL+  + +      LQD + 
Sbjct: 2017 TSHHTKEQYFRFSYDDIQINCNPMSEKNKVLVVSLSASLVKLTFSEPRRIFASFLQDERI 2076

Query: 1815 ALFSMKSL-----------SDILNISQSSPTASAFGSWFSILPDNLSLQATYAGLLLGFG 1863
             + S + L            ++  ++   P       W       L L   Y G+LL   
Sbjct: 2077 TIESFQELKKLKKIFFSNAKNVKKLNNDVPKEDTPTKW------ALELNINYFGILLPIA 2130

Query: 1864 HTLYILEFNNFEAKHTRDGLPDAITPRPCFKVDH------SIESASFLIKDRRIDDRLAK 1917
             T ++LE +      T        T     +V++      S+E+  FLI DR +  RL+K
Sbjct: 2131 STFFVLELHMLLGSLTN-------TTEEIQEVNNQISGQISLENILFLINDRSLPLRLSK 2183

Query: 1918 VVDFAVNFNMVHDTDLCIQSVQIESTHLKITLAPMTVVRLL----SLINEFGIIRKQFTE 1973
            +VDF++  + +  T    +S+QIES+H ++  +P ++V +L     L NE    +   T+
Sbjct: 2184 LVDFSIRISTLQKTTSSYESLQIESSHFRMCFSPESLVFVLWGVKQLQNELEYYKDHKTK 2243

Query: 1974 ESIYTPSSAHNNSTATECLEPSVWRLIIKSGHILSHDFSIVWLFDIPNSSADGLICGYDR 2033
                   S+H   T +   E  +     +S HILS++F I W+         G + GYDR
Sbjct: 2244 RQWNL--SSHKTGTKSSTSESPLNYF--RSIHILSYNFCIGWMLPENQKDIPGWMFGYDR 2299

Query: 2034 LFSVYEKPYGKLTLLNAYFSAAKILASEADFYSSVVRKQRINTSYLSDMQLRYWFTEDSE 2093
            LFS YEK YGKLTL+  Y S     +S  DF+S    K R N S+L  MQ+ YW  E + 
Sbjct: 2300 LFSAYEKNYGKLTLIEGYMSVTNSNSSN-DFFSQGEEKNRHNRSFLPSMQILYWLKEFNS 2358

Query: 2094 NTDLFIRIHGAKLAVDISAEIVTLLEETIQSIQTFNNLKKA-LVDPFRTKKQDSDISKE- 2151
              DLFIR+HG  L VDI +  V ++E   +S Q F + +K+ +V     +K    I  E 
Sbjct: 2359 KKDLFIRLHGDALDVDILSNFVNIIELIFKSYQIFEDFRKSKIVQNIEKQKHHEHIKSEN 2418

Query: 2152 PYNWNNQLATGVRSLNCIINYAGVTLKLHS-HDGRGDASP-LELTSPSYKVAIDYKYFPN 2209
               +     + + S+NC   Y G TL++ S  D   D++P LEL +P   + ++YK+F +
Sbjct: 2419 ATEFVPTFLSDINSINCEFKYEGGTLRVFSVDDVEIDSTPSLELNAPKVSIYLNYKHFDD 2478

Query: 2210 LEKTHRFRTLITATPTHNTFYSTSA-FLIHDLCYRFXXXXXXXXXXXXXXXXXXXXXIKV 2268
              K H  R +I    +HN  YS  A F+I      F                     I  
Sbjct: 2479 SPKPHWLRCVIDIHSSHNILYSKCAPFVI-----EFVESIQEILENRPVEPKQSVSKIAT 2533

Query: 2269 EGSDNSTLLGSIDLVIILNVGKQEVTFSCEPKAKVQATVGXXXXXXXXXXXXXXXXXSLC 2328
                   +L   D+   +   KQ ++FSCEP AKVQA VG                  L 
Sbjct: 2534 PNRTYKRILAPFDIAFRIKAAKQMLSFSCEPSAKVQANVGLDSFLFGISTGGSSVEDPLS 2593

Query: 2329 LAIEIENLMTNSRHIYSREVCASLKLRHISMVFDIMGSQVRRIYGSTLISSPLFYFNMKQ 2388
            L + I  + T+ +HI+S+E  AS  L  I + F         +Y   LIS    +FNMKQ
Sbjct: 2594 LTLCINKISTSVQHIFSKEASASFSLNFIDLTFIFTQPT---LYCVGLISDIDIFFNMKQ 2650

Query: 2389 LQDLKLFIDQWFPQKTPMNTGSYPEGVLVDDISRXXXXXXXXXXXXXXXXX-XXXVIVAG 2447
             Q+L LF+D W   ++    G  P                               +I   
Sbjct: 2651 QQNLLLFLDIWHLSES---IGIRPNRKKRKHKKHKGHTQIPETPQPGKIIPWNFNIIFTN 2707

Query: 2448 SCAEIELGPSLGVLNVTSEDVWAISKQQVDWSQQLDLNMGKLDVTSSGRLGGNFLVRNAH 2507
              A+I LGP+LG+++   E  W IS + +D  Q L L    + + S GRL G   + NA 
Sbjct: 2708 VNADIHLGPALGIVSAKLEKTWFISDRYLDKRQILQLFTDGMVLKSRGRLSGMLDISNAG 2767

Query: 2508 LSLELKWPNPKDFFQVPLVCVKLGSDTVDTKLSFDYHTFFISSLKQGYASLFNERDEDGS 2567
              LE+ + + +  +  P+V + +    V  K +FDYH F IS +   +  L +ERD +G 
Sbjct: 2768 WRLEVNYADNELNYNSPIVAIGIDIGCVALKTAFDYHMFMISKVNNIHFRLHSERDPEGK 2827

Query: 2568 LADLLSVTVSFESVNIFLTALAAANISDIKNSITRLKKDNELSYLSSFLAS---DQPSDE 2624
            L DLL  T+  E ++I  T L A+NI DI N+I R ++D + SY  + + S   D  ++ 
Sbjct: 2828 LPDLLLTTLLCEEISICSTTLVASNILDIYNTIIRTRQDTKNSYFETLMESNNQDTRTNI 2887

Query: 2625 PEEDGGIFDXXXXXXXXXXXXXGVFRLQISPTSLFDSDVLILTATKMMANTGIQADIKIK 2684
            P  D  I                  +LQISP SLFD +VL++    M A +   +  K+K
Sbjct: 2888 PYSD--ILKSLNLLRTDVQIDVSKLQLQISPISLFDFEVLVINIDNMSARSETTSTDKLK 2945

Query: 2685 TDLHWQLDDVSLALLPFNNSLDESYLATMEVGKYIELSSTIQGGAIFSAPSIVVNMTTWQ 2744
            T L  Q+ + S+AL      LDE  +  + V  Y+  +S I+GG I   P ++V MTTWQ
Sbjct: 2946 TRLELQVCNASVALSTAKEELDEESVNKISVADYMTYASKIKGGTILIIPKLLVGMTTWQ 3005

Query: 2745 EPQSNVIELLYSTSFGGTVKIRWNLGPISFIKDMWQAHMNAMQLREGYYHGLAESGVAVT 2804
            +  SN IE  ++  F G V +RWNLGP++FIK+MW  H+ ++ +R+       E      
Sbjct: 3006 KVTSNTIEYTFTCKFDGKVSVRWNLGPVNFIKEMWATHVKSLAVRQARIEEPVEYSSEEL 3065

Query: 2805 PLNSKAVPLEMHLGSDYQYLPLQEPDIEMPRIKDLGDATPPIEWFGVNRTKFPGFTHQFV 2864
              + +++ LE      + Y+ L EP IEMP+IKDL DATPP+EWFG+NR KFP FTHQ  
Sbjct: 3066 ESSPESIYLE-PAQPKFTYVALVEPSIEMPQIKDLEDATPPMEWFGLNRKKFPSFTHQTA 3124

Query: 2865 IVPLQKLARTAEKEYEKILGRA 2886
            ++ +QKL    EKEY KI+G +
Sbjct: 3125 VIVVQKLVHAVEKEYAKIIGHS 3146

 Score = 79.3 bits (194), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 38/130 (29%), Positives = 67/130 (51%), Gaps = 17/130 (13%)

Query: 1   MVIFAIFYVGRVLGYIVSKAANLVLWKQYRVTVSIQSLVFSPLAGKVHFKNVSVTSQDQL 60
           + +   FY+ RV  Y ++   + +LW+ Y+V +  +S+  S L+ ++ FKN+ + +++  
Sbjct: 32  LCLLMFFYIDRVFAYSLTFILDWLLWRPYKVKIHCESIRLSLLSARISFKNLCIITENST 91

Query: 61  ISVLKGTITWRYWL----IGRYR-------------RSGTADGARRCRFALKFEGFEYFV 103
           IS+L+G I W+YWL    +  Y               SG  +    C+F  + EG E FV
Sbjct: 92  ISILEGKIIWQYWLLNTRVSAYELHQQQKEHGYITPGSGFKNIQLPCKFLFQCEGAEIFV 151

Query: 104 YNRNGVYDRI 113
           YN+   Y+ I
Sbjct: 152 YNKTSAYENI 161

 Score = 75.9 bits (185), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 52/184 (28%), Positives = 87/184 (47%), Gaps = 16/184 (8%)

Query: 149 FLPVEFLHNKGAIVLGNKQTHSVAIMNYEKLAGTVSIEVPDDTRAPSSFRTEAKI--SNC 206
           F P      KG+I+ GNK T S+ I++Y+   G V + +P        ++ + K+   N 
Sbjct: 300 FYPFGLKLTKGSIIFGNKFTPSLLIISYKSAEGIVDV-LPATNPRVDLYKMKMKLDFQNF 358

Query: 207 TVAIKPNISYEVDNPVKIYVEPKRTARLWKKYKTLLGTV---LEATLHAKRKKEQH---- 259
            + +KPNISYE D+  K +      +RLW K+ TL   +   L   +H  R  +      
Sbjct: 359 EIEVKPNISYEDDSKPKAFYCDSMLSRLWTKFSTLFDIMPNPLSRYIHFSRLHKNSLFLE 418

Query: 260 ----QTPKWYDNWRGLSMYD--VNXXXXXXXXVKFDIEHHEYAKCTTVLKADQMDVTYSY 313
               +   +   W+GLS+Y             ++FD  +HEYA+  +++KA ++  T  Y
Sbjct: 419 DNIFEDEDFEKKWKGLSLYKDAALNRGNPEEHIEFDFLNHEYARYCSIVKAPRLIFTNEY 478

Query: 314 GMPG 317
            +PG
Sbjct: 479 DIPG 482

>SAKL0H17072g Chr8 (1498942..1507935) [8994 bp, 2997 aa] {ON} similar
            to uniprot|Q12150 Saccharomyces cerevisiae YLR087C CSF1
            Protein required for fermentation at low temperature
          Length = 2997

 Score =  911 bits (2355), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 524/1527 (34%), Positives = 804/1527 (52%), Gaps = 103/1527 (6%)

Query: 8    YVGRVLGYIVSKAANLVLWKQYRVTVSIQSLVFSPLAGKVHFKNVSVTSQDQLISVLKGT 67
            Y GR L Y ++     VLW++Y+V ++IQSL  S L G+V FKN++V ++DQ IS L+G+
Sbjct: 39   YFGRALAYCITILMKWVLWRRYKVKINIQSLKISFLGGRVFFKNLTVITKDQTISFLQGS 98

Query: 68   ITWRYWLIGRYR-------RSGTADGAR----RCRFALKFEGFEYFVYNRNGVYDRIARE 116
             TWRYWL+   +       +SG     +    +CRF L+ +GFE F+YNR   YD I R 
Sbjct: 99   FTWRYWLLNSRKTLLEELEKSGEEKDQKSRMLQCRFFLESDGFELFIYNRTVAYDGILRS 158

Query: 117  L---DGEDXXXXXXXXXXXXXXXIAELQDDPL-------------------------IRR 148
            +   D E                  +L+D+ L                         + +
Sbjct: 159  VAKDDKESFKKFFEGGEDSLHSSEEKLEDETLASDSSVSNVDSTNDRNFQEQDSRSMLLQ 218

Query: 149  FLPVEFLHNKGAIVLGNKQTHSVAIMNYEKLAGTVSIEVPDDTRAPSSFRTEAKISNCTV 208
            FLP+    N+GA++LGN  T SV I+ YE   G V +   ++       R +   +N  +
Sbjct: 219  FLPIHLKVNRGAVLLGNTTTPSVMIIGYESAEGVVDVCQSNEKLDLYKIRYDLDFNNVDL 278

Query: 209  AIKPNISYEVDNPVKIYVEPKRTARLWKKYKTLLGTVLEATL-HAKRKK---EQHQTPKW 264
             IKPNIS+  +NP+K Y+   R +R+WKK+K +    +   L H+  +K    +HQ  ++
Sbjct: 279  KIKPNISFGDENPIKSYIVHSRMSRVWKKFKKIFFERMSHYLAHSDNQKIMFVKHQ--QF 336

Query: 265  YDNWRGLSMYDVNXXXXXXXXVKF-----------DIEHHEYAKCTTVLKADQMDVTYSY 313
            ++ WRGL++Y           V             D+ +HEYAK T +LK+ ++ VTY+Y
Sbjct: 337  FEKWRGLALYSEYNVTTSDHSVGDEEEEEDENMMSDVGNHEYAKYTQILKSTKVAVTYAY 396

Query: 314  GMPG--------TARVTDSDNAENPLLERPELDHSVDILVYDANCTYGPWANRQVQQCLR 365
             +PG        T    D  +  N     PE   S+D  +Y A   YGPWA+RQ+Q   R
Sbjct: 397  DIPGMVPHGALHTMEQRDGPDVGNSGAP-PEF--SLDFKLYGATICYGPWAHRQIQYLQR 453

Query: 366  VFSPTVCRN---FKLRTPEEIAQQTEPAAFKLSVTIMEDSVLRVPMKESSKDAAFLEKYK 422
            +  P V R+    K  TP      T    F LSV +MED++ R+P +ESSKD  FL++Y+
Sbjct: 454  MLCPIVSRDAIPLKKLTPGSRRIYTR---FNLSVLMMEDALWRIPTRESSKDQDFLKQYR 510

Query: 423  QTRDETRPFGWIDIRIAKESNITVRMAAYPTENGFENILHANLVDTTISTSVNHDTLLKA 482
            +++++ RPFGW+DI++ KE+++ + +   PT  GFEN L  +LV   I +SVNHD   KA
Sbjct: 511  ESKNKERPFGWLDIKLTKETDLFMTVGMCPTITGFENKLGFHLVKPEIRSSVNHDIFFKA 570

Query: 483  KSHDITVDFSYPYGWQDKAEWNFNVCSTQAELFVLRDHVYLISDLVTDFSGGEEVLYEQF 542
             +  I+ D  YP GW  +A+W F   S Q   F LRDH+ L+SD+  DF  G    YE F
Sbjct: 571  DAQTISADLGYPLGWNSEAQWVFQFNSKQVHTFFLRDHINLLSDIFMDFGSGIPTPYELF 630

Query: 543  RPFDYRFRWDIRGYSAYLNVNDANIINNPIDFGENCYLSVHGDDAEITFSLPITSIIQKY 602
            RPF YRF W I  YS YLNVNDANIINNP+DF ENCYLS+HGD  +I FS+ + +I    
Sbjct: 631  RPFVYRFEWSIDNYSIYLNVNDANIINNPLDFNENCYLSLHGDTLKIDFSVDLKTITGNS 690

Query: 603  VTVDFNIFTPHFSLFLNAPPWHTFSELLHYKEIGRSKNFNIKGSYTSYSEVDVDNVDALN 662
             TV+++I TP F L L+ P W T  E +  KE+GRS +F + GSY  +S+VDV N+D + 
Sbjct: 691  TTVNYSIRTPEFHLQLDTPSWSTLHEFMKNKEVGRSYDFCMNGSYQFHSDVDVGNMDTIL 750

Query: 663  IACETDYIVVLCYGVILKCMLNVKVNYFGEMVHFRTTEEYVEELQRR--NKQNPSTCRPF 720
            I C++ Y  + C G +++ ++N+ +NYFG+ +HF+TTEEY  ELQ +   ++        
Sbjct: 751  IECQSKYTTLQCCGFVIRYLMNINMNYFGDFIHFKTTEEYTRELQEKLETREAEVIADNV 810

Query: 721  NSDGNVHDSDVVATESNEIIDASFDAFGGPPTIKKSALKRSINELDVWFTFISKGGCFFF 780
            + + +   S    T   E  +     F   P +K++ LKR  NE DVWFTF  + GC  F
Sbjct: 811  SDESSQMSSTSFVTNDKETTEYDLHEFNEDPKVKRADLKRKENEKDVWFTFCVEDGCLVF 870

Query: 781  PENIYKFDACLGFYFDNLEASLRFLNYYVDAAVSLDSIYFKRHTDIDARTLFKVIEDIGI 840
            PENIY   +C+G +FD+L+  LR+LNYY+D   SL   Y KRH+D + R +F V+     
Sbjct: 871  PENIYDCTSCIGLHFDSLDVDLRYLNYYMDLQASLSPTYIKRHSDFNPRNIFDVVRACEG 930

Query: 841  PIDASDAYLSQFSFRLHKMLGIMPSEESYACEFDVRVDTLDVHCDLAVLKAFVNTLRNLA 900
             +D    +LS+ +   H+M G+   EE+Y C++D ++ +LD+  D+   K  +     + 
Sbjct: 931  LVDGHQGFLSELNIHAHRMFGLPIIEETYFCKWDFQIGSLDIDSDIDFAKGLIGAFSKIG 990

Query: 901  FGFKDVENSLQYEREQVFDLNKISCVIENVTVKLQNVDKDEDIWLSLNLPVTTLTSFDLA 960
            FG+KD EN L YE  +  D+  ++ V ++++ K+   D + +  ++L+L   + +  D  
Sbjct: 991  FGYKDYENMLIYEIIKPIDMTSLTLVTDSISFKV--TDGNTNCVVALDLDKISASMIDFE 1048

Query: 961  NERYSRRSDLSIPELLFGIYRGDSESTCLGAFSTGVTVTLFERFEQFARCRVLQRKHILV 1020
            NERYS +    IP +   +    S++   G F T + +  F +   F   R LQR HI +
Sbjct: 1049 NERYSNKMSAKIPNIKLLVSEKSSKNEVQGLFETSLDLAYFGQNRDFDNHRNLQRNHITL 1108

Query: 1021 NDAPFHRCSFMLPPEYKKMPIYRSLYGCXXXXXXXXXXXXXXXADNFEVIFEKLLGEIYQ 1080
            +D+P+HRC+F+LP +Y+K  +Y  L+G                 +  + IFE LLG+ YQ
Sbjct: 1109 HDSPYHRCAFLLPMQYQKTVLYNKLFGAITPGVSIPPLTQPVIPNTIDSIFESLLGKHYQ 1168

Query: 1081 EYASDSSYQITDDSISSTEHDYHNQTVNAAIGTSSSLFIRSQNHQQTLS----------S 1130
            +Y   S    + ++  + E    N +     G++S+L   S   Q   S          S
Sbjct: 1169 DYECCSDANYSKETAITEE----NSSFIQGSGSTSALKELSSYSQNCPSYKLEPKFEYDS 1224

Query: 1131 FIVEFDPIDGYLDLSATEFMLEIYKYLTEVSLDEAIDSLEIGIINQFIQTFGEDNGISEV 1190
            FI+        ++ S+ + +L IY      S+D+ ID+ EI I+ +F + F E + ++ +
Sbjct: 1225 FIINLGKTIIAINPSSEKCLLSIYLQFCVGSIDDIIDANEIDIVEKFSKYFVEKSAVTNL 1284

Query: 1191 RVLCPNISLSATNKQSKFSM-----FKLSSKIKNLDITSR--IKSSDPNLKPDPEKTTLC 1243
            RVL P I  +  + + KF +       +     +LD+  +     ++ +     E+ T  
Sbjct: 1285 RVLAPKICFTFGSPKGKFEVSDYDHLYVEVNHPSLDLCQKKIFGQTNSSKLEYTEEVTSS 1344

Query: 1244 YKIDYIRANIVQDGIVVPPK---QPSQLFSCSIELLEGYLSYDKLSLLDNNVQSCSVTLS 1300
             K   I   I Q  +   PK   +   +FS   E LE +    + S    N ++    ++
Sbjct: 1345 LKASSINFFINQQQL--KPKTLLKARPVFSIVFEELEFWSDSSESSKNSLNARAVDFFVN 1402

Query: 1301 PGTDKLLFEFLNPFISTFDLLQRELSSFEDTLLASKREFLLNILRGGRDYEIQHDPPVIT 1360
                + L ++L   I     L    S  +  + A ++E +        +Y I HD PVIT
Sbjct: 1403 HSQLEWLSDYLRAVILCATKLFASFSKSKTLIQARQKELIFRTALASVEYNIIHDSPVIT 1462

Query: 1361 KPANITRFSNRHIRSAESWRIIMRLRHILNYLPQEWHQSFTRHLGTQDFTSPEEAGKEFL 1420
            KPA ITR S  HIR   SWRII RLRHILNYLP+ W++     L  ++F  P++A  +FL
Sbjct: 1463 KPAYITRLSKNHIRENRSWRIITRLRHILNYLPKSWYKRTEESLKKEEFKIPDDARDQFL 1522

Query: 1421 SIFSDWRSWEPTDVQGSFVHEKVFTKK 1447
             IFS+WRSWE +DVQ  +++++VF  +
Sbjct: 1523 KIFSNWRSWEFSDVQKCYIYKRVFLSR 1549

 Score =  754 bits (1948), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 441/1246 (35%), Positives = 690/1246 (55%), Gaps = 66/1246 (5%)

Query: 1675 IKYLVEALVPELFAEPPIE--------RESSGNKIHAVLFQGQVANITLKLQILSPFIIL 1726
            IK  V+ +  EL +  P +        +  + ++++ V     ++  +L +Q L+PF I 
Sbjct: 1780 IKASVDGIRKELASAIPKKNNTTISTTKPETSSRLNTVTLDATLSGFSLNIQPLTPFGIH 1839

Query: 1727 YCAENFELQAESTDSVIFDLNSGESYMEISSAKQKLDYFKYTHTCLKL--SGTSSSARLF 1784
               ++ E+  E    +  D+   +  +E+ S + K  Y K++ + + L  S T     +F
Sbjct: 1840 QSTDSIEVHVEKHHQLNADITIRDIDIELLSTRSKQRYLKFSQSTVNLVISNTPEQNAMF 1899

Query: 1785 EHISCDIGILKLSVFDLKTRITDLLQDIKAALFSMKSLSDILNISQSSPTASAFGS---- 1840
             ++    GI KL+V D +  I  L++D      ++K+ + + ++++  P+ +   S    
Sbjct: 1900 LNVGVASGISKLTVSDPREFIYSLVED---ETLAIKNFAQLKSLAEKFPSKNQEKSKQRK 1956

Query: 1841 -----WFSILPDNLSLQATYAGLLLGFGHTLYILEFNNFEAKHTRDGLPDAITPRPCFKV 1895
                 W       L +   Y G+++  G   Y+LE NN         L + I+ R   + 
Sbjct: 1957 QTNIIWL------LHVNVEYIGIIVLLGSAGYVLELNN-----VLTSLSNNISARKYLEQ 2005

Query: 1896 -------DHSIESASFLIKDRRIDDRLAKVVDFAVNFNMVHDTDLCIQSVQIESTHLKIT 1948
                   D SIE+   LI   R+   L+K+VD AVN  +  +    +Q++QIES+H ++ 
Sbjct: 2006 GLHGIVGDFSIENVLLLIHANRLKGELSKLVDLAVNLKVSQEEGDDLQNIQIESSHFRVA 2065

Query: 1949 LAPMTVVRLLSLINEFGIIRKQFTEESIYTPSSAHNNSTATECLEPSVWRLIIKSGHILS 2008
            L PM++ ++L  INEF  + + +   S       H  +  T+  E S      +S  ILS
Sbjct: 2066 LCPMSLTKVLWAINEFTRVSEAYKTRSSLL---QHKKTAPTDISELSN---KFRSIQILS 2119

Query: 2009 HDFSIVWLFDIPNSSADGLICGYDRLFSVYEKPYGKLTLLNAYFSAAKILASEADFYSSV 2068
            ++F I W+FD  + +  GLI GY+RLF+ Y+KPYGKLTLL+AYFS A   +S+  F+S+ 
Sbjct: 2120 YNFCIGWIFDAGSETDPGLIWGYERLFAAYQKPYGKLTLLDAYFSIAHGASSDT-FFSNG 2178

Query: 2069 VRKQRINTSYLSDMQLRYWFTEDSENTDLFIRIHGAKLAVDISAEIVTLLEETIQSIQTF 2128
              K + N SYL  MQ+ YWF ++ + ++LF+RI G +L V+  +  + +    ++SIQTF
Sbjct: 2179 KEKDQFNRSYLPSMQIGYWFVKEGDTSNLFVRITGERLDVNFLSSSIGIANGAVKSIQTF 2238

Query: 2129 NNLKKALVDPFRTKKQDSDISKEPYNWN----NQLATGVRSLNCIINYAGVTLKLHSH-D 2183
              LKK +VDPF T K     +++P N      + + + +R+ NCI+ YAG   KL S  D
Sbjct: 2239 QELKKTMVDPFATNK----TTEKPVNSEAAPLDPILSKIRAFNCIVKYAGGVFKLFSEED 2294

Query: 2184 GRGDASP-LELTSPSYKVAIDYKYFPNLEKTHRFRTLITATPTHNTFYSTSAFLIHDLCY 2242
             + ++ P  E+ SPS +VAIDYK+ P++ K+H  R L+T  P++NT + T   ++  +  
Sbjct: 2295 IQNNSKPSFEVESPSVEVAIDYKHLPDVIKSHWIRGLVTVDPSNNTLFPTCVPILSGMT- 2353

Query: 2243 RFXXXXXXXXXXXXXXXXXXXXXIKVEGSDNSTLLGSIDLVIILNVGKQEVTFSCEPKAK 2302
                                   I   G +   LL + D+  ++N+GKQ ++ SCEPKAK
Sbjct: 2354 --KDVRNMLKSFNSKPKPDRNSTISSSGMNYKKLLRAFDIAFLVNIGKQGISLSCEPKAK 2411

Query: 2303 VQATVGXXXXXXXXXXXXXXXXXSLCLAIEIENLMTNSRHIYSREVCASLKLRHISMVFD 2362
            VQA VG                  L L+I+IE+L   SRHI+SREV  S ++ HI  VF 
Sbjct: 2412 VQADVGFEKLAVKMFTNNLDNSEPLSLSIDIEHLRATSRHIFSREVSTSFQIDHIDAVFV 2471

Query: 2363 IMGSQVRRIYGSTLISSPLFYFNMKQLQDLKLFIDQWFP--QKTPMNTGSYPEGVLVDDI 2420
            +   ++ + YG+TL+S    YFNMKQLQDL LF+D W P  Q   M  G       +   
Sbjct: 2472 LTHPEIIQTYGTTLVSDVQIYFNMKQLQDLNLFLDIWKPDSQILEMPKGGNTRTRSLSSH 2531

Query: 2421 SRXXXXXXXXXXXXXXXXXXXXVIVAGSCAEIELGPSLGVLNVTSEDVWAISKQQVDWSQ 2480
             +                    +I +    +I+LGPSLGVL+V +   WAIS   VDW Q
Sbjct: 2532 DKLPVSKFQKPAGTNAFPWNYTLIFSNIKGDIDLGPSLGVLSVRNNRSWAISDHFVDWRQ 2591

Query: 2481 QLDLNMGKLDVTSSGRLGGNFLVRNAHLSLELKWPNPKDFFQVPLVCVKLGSDTVDTKLS 2540
            +L + +  + ++S GRLGG   +     S E+ WP    F++ PL+ + L   ++  K S
Sbjct: 2592 RLSVFLENILLSSDGRLGGFLGIERVCWSSEISWPVKGGFYETPLISLSLELGSLALKTS 2651

Query: 2541 FDYHTFFISSLKQGYASLFNERDEDGSLADLLSVTVSFESVNIFLTALAAANISDIKNSI 2600
            FDYH F I++++     L+NERDE G L DLL+V+V+   +++FLTALA+AN  DI N+I
Sbjct: 2652 FDYHMFLIANVEHLLLKLYNERDEMGILKDLLAVSVTCGKIHLFLTALASANAIDIYNTI 2711

Query: 2601 TRLKKDNELSYLSSFLASD-QPSDEPEEDGGIFDXXXXXXXXXXXXXGVFRLQISPTSLF 2659
             R+++DN+ SY+ +   S+ Q +    ++  + +              +F LQ+ P++LF
Sbjct: 2712 IRMRQDNKNSYIETLKDSNTQSTKSKRQNQNVLESLSLLRTDLSVGIDLFYLQVFPSTLF 2771

Query: 2660 DSDVLILTATKMMANTGIQADIKIKTDLHWQLDDVSLALLPFNNSLDESYLATMEVGKYI 2719
            D +VL+L A  M A+T  Q D K+KT L+WQL +  ++L  F N  +E  ++ +EV +YI
Sbjct: 2772 DMEVLVLKAEDMSAHTQTQGDHKVKTRLNWQLHNFKVSLSAFKNQFNEEIVSQIEVKEYI 2831

Query: 2720 ELSSTIQGGAIFSAPSIVVNMTTWQEPQSNVIELLYSTSFGGTVKIRWNLGPISFIKDMW 2779
            + ++ ++GG I +AP+I+V+MTTWQE  SNVIELLY++SFGG V ++WNLGPI+FI++MW
Sbjct: 2832 KHATKVRGGTILAAPAILVDMTTWQEVSSNVIELLYTSSFGGKVDVKWNLGPINFIREMW 2891

Query: 2780 QAHMNAMQLREGYYHGLAESGVAVTPLNSKAVPL-EMHLGSDYQYLPLQEPDIEMPRIKD 2838
              H+ A+ LR    H + +   +          + ++ LG+ Y Y+PL+EP IEMP+IKD
Sbjct: 2892 ATHVRALALRR--VHDMRDKNKSFFEDEHIEEKIKDVDLGNKYVYIPLEEPRIEMPQIKD 2949

Query: 2839 LGDATPPIEWFGVNRTKFPGFTHQFVIVPLQKLARTAEKEYEKILG 2884
            LGDATPP+EWFGVNR +FPG THQ V+VPLQKLA  AE+EY ++LG
Sbjct: 2950 LGDATPPVEWFGVNRQRFPGLTHQSVVVPLQKLAHMAEEEYARVLG 2995

>Kwal_YGOB_56.23808 s56 (712095..712280,712384..721023) [8826 bp, 2941
            aa] {ON} ANNOTATED BY YGOB -
          Length = 2941

 Score =  858 bits (2218), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 503/1522 (33%), Positives = 788/1522 (51%), Gaps = 134/1522 (8%)

Query: 3    IFAIFYVGRVLGYIVSKAANLVLWKQYRVTVSIQSLVFSPLAGKVHFKNVSVTSQDQLIS 62
            + + FY GRVLGY ++     + WK+Y V V           G+V FKN++V +QDQ  S
Sbjct: 32   LLSAFYFGRVLGYTITTILEYLAWKRYGVKV-----------GRVFFKNLTVITQDQTYS 80

Query: 63   VLKGTITWRYWLIGRYRRSGTADGARR----CRFALKFEGFEYFVYNRNGVYDRIARELD 118
            +L G+ITWRYWL+   + S  +   +     CRF ++ +G E+F+YNR   +D I   L 
Sbjct: 81   ILHGSITWRYWLLSSRKTSLESQSEKAAKLPCRFRIECQGLEHFIYNRTQAFDNILSSLP 140

Query: 119  GEDXXXXXXXXXXXXXXXIAELQDD----------------------------------- 143
             ED                 E   +                                   
Sbjct: 141  REDQENVKKFFSDPSPRATEETSTENDSAAQKSHLETSMSSPSASTESLNDRTYQLPNSM 200

Query: 144  PLIRRFLPVEFLHNKGAIVLGNKQTHSVAIMNYEKLAGTVSIEVPDDTRAPSSFRTEAKI 203
            P   R LP+E+   KGA+++GNK+T SV + ++EKL G +    PD        + ++ I
Sbjct: 201  PSFLRLLPLEYSVQKGALIIGNKKTSSVMVSSFEKLKGHLDACAPDTKIDLYKIKLQSDI 260

Query: 204  SNCTVAIKPNISYEVDNPVKIYVEPKRTARLWKKYKTLLGTVLEATLHAKRKKEQHQTP- 262
            +   ++++PN+ Y+ D P+K   +  R  +L  KY      V +  L    K E  +   
Sbjct: 261  TKFQMSLRPNLCYDNDEPLKNLPKANRLPKLLHKYYETFLRVRKRYLSRGSKTESTRKDL 320

Query: 263  -KWYDNWRGLSMYDVNXXXXXXXXVKFDIEHHEYAKCTTVLKADQMDVTYSYGMPGTARV 321
                + WRGL +Y             F++  HEYA+ + V+K + M + YS+  PG    
Sbjct: 321  RNPLERWRGLGLYWKENDPAWDDVFHFELPKHEYARYSKVMKCEHMLIEYSHDTPGVV-- 378

Query: 322  TDSDNAENPLLE---RPEL-------DHSVDILVYDANCTYGPWANRQVQQCLRVFSPTV 371
                +   P LE    P++       D S+DI V+ AN  YGPWA+ ++    +VFSP V
Sbjct: 379  ---PHGAFPTLEPLDGPDVGNGGAPPDFSLDIQVFGANIHYGPWAHHEIMPIQKVFSPVV 435

Query: 372  CRNFKLRTPEEIAQQTEPAAF---KLSVTIMEDSVLRVPMKESSKDAAFLEKYKQTRDET 428
             R+     P E         F   ++S+ IM DS+ R+P +E SKD  FL++YK+T D+T
Sbjct: 436  SRD---SHPTERLSAGSTRVFTRLRISIMIMSDSIWRIPTREPSKDLDFLKRYKETEDDT 492

Query: 429  RPFGWIDIRIAKESNITVRMAAYPTENGFENILHANLVDTTISTSVNHDTLLKAKSHDIT 488
            RPFGW+++ +A+ S + + +A  PT  GF+N L  + +   I TSVNHD LL A++HDI 
Sbjct: 493  RPFGWLELSLAEGSEVRLNIAMCPTSTGFDNKLDLHFIKPEIRTSVNHDILLSAETHDIE 552

Query: 489  VDFSYPYGWQDKAEWNFNVCSTQAELFVLRDHVYLISDLVTDFSGGEEVLYEQFRPFDYR 548
                YP GW  KA+WNF++ S QA +F+L+DH+ L+ D+++DF  G+   Y+ FRPF Y 
Sbjct: 553  AQIGYPLGWNAKAKWNFDLKSHQARMFILKDHITLLGDILSDFGTGDPTPYDLFRPFIYE 612

Query: 549  FRWDIRGYSAYLNVNDANIINNPIDFGENCYLSVHGDDAEITFSLPITSIIQKYVTVDFN 608
            F W++ GYS YLNVNDANI+NNP+DF ENCYLS HGDD  I+F +P  SI     T+D+N
Sbjct: 613  FNWELTGYSMYLNVNDANIVNNPVDFNENCYLSFHGDDLRISFRVPQDSIAGNSTTIDYN 672

Query: 609  IFTPHFSLFLNAPPWHTFSELLHYKEIGRSKNFNIKGSYTSYSEVDVDNVDALNIACETD 668
            ++TP F L +N P W+T  E +  KE+GR+ +F++ GSY  +S++DV+N+D + I C++ 
Sbjct: 673  LYTPLFRLNMNTPSWNTLHEFMKDKEVGRACDFSLAGSYLFHSKLDVENIDTIIIECKSR 732

Query: 669  YIVVLCYGVILKCMLNVKVNYFGEMVHFRTTEEYVEELQRRNKQNPSTCRPFNSDGNVHD 728
               + CYG +++ ++ VK+NYFG+ VHF+TTEEY+EEL R     P      NS+ + + 
Sbjct: 733  MTTLKCYGYVVRFLVGVKMNYFGDFVHFKTTEEYMEEL-RDAYVEPKA----NSEQSANS 787

Query: 729  SD-VVATESNEIIDASFDAFGGPPTIKKSALKRSINELDVWFTFISKGGCFFFPENIYKF 787
            ++   A E  +  +A  +    P   KK +LKR +NE DVWFTFI + GC   P+N+Y  
Sbjct: 788  TETTTAGEGEDKQNAPKNHTTDPVMAKKLSLKRMVNEKDVWFTFIVEDGCLILPKNLYDC 847

Query: 788  DACLGFYFDNLEASLRFLNYYVDAAVSLDSIYFKRHTDIDARTLFKVIEDIGIPIDASDA 847
            +AC  F FD+L+  LR++NYY+D   +L  +  +  +D D   LF   E    P  A+  
Sbjct: 848  NACFAFEFDSLDIDLRYINYYMDLQAALSPVIVRNLSDCDPAHLFSGSEG-RCPSRANFG 906

Query: 848  YLSQFSFRLHKMLGIMPSEESYACEFDVRVDTLDVHCDLAVLKAFVNTLRNLAFGFKDVE 907
             +S      H+M G+ P EE+Y C++D  +  LD+  DL+ + +F +    LAF FKD E
Sbjct: 907  SISDLHIHAHRMFGLPPDEETYFCKWDFSMGVLDISSDLSCILSFGDAWSKLAFSFKDYE 966

Query: 908  NSLQYEREQVFDLNKISCVIENVTVKLQNVDKDEDIWLSLNLPVTTLTSFDLANERYSRR 967
            N + Y+   + D+  I      + VK+ +V    D ++ + +   T    D  NERYS R
Sbjct: 967  NIMNYKIVPILDMTSIIFHAGEIRVKINDVAV--DYYIIVEVENVTARGVDFENERYSSR 1024

Query: 968  SDLSIPELLFGIYRGDSESTCLGAFSTGVTVTLFERFEQFARCRVLQRKHILVNDAPFHR 1027
            +D+ I  +   +  G  + + +G FS+ + +T F + + F    + Q+ HI  NDAPFHR
Sbjct: 1025 ADVDIHSITVQVKEGGKDGSLIGDFSSSLKITKFCQLKNFLVHSMQQKSHIATNDAPFHR 1084

Query: 1028 CSFMLPPEYKKMPIYRSLYGCXXXXXXXXXXXXXXXADNFEVIFEKLL-GE--------- 1077
            CSF+LP   ++   YR L G                 +N  +I ++ L GE         
Sbjct: 1085 CSFLLPLAIQRSDNYRKLLGSIVPGVSIPGMVEPITPENVTMILDEFLKGEKNSLQMGNE 1144

Query: 1078 --IYQEYASDSSYQITDDSISSTEHDYHNQTVNAAIGTSSSLFIRSQNHQQTLSSFIVEF 1135
                ++     ++      +SSTE+D + +        S SL ++    Q ++S+  ++ 
Sbjct: 1145 HFCSKKEEDGYAFNFASGLMSSTENDSNVE--------SESLVVKLIKPQASISACCIK- 1195

Query: 1136 DPIDGYLDLSATEFMLEIYKYLTEVSLDEAIDSLEIGIINQFIQTFGEDNGISEVRVLCP 1195
             P   + D + + F            +++ IDS EI ++  FI+T  +      V+V  P
Sbjct: 1196 -PFRSFSDQAYSNF------------VEQLIDSNEIEVVLHFIETTLKRKQCKNVKVFSP 1242

Query: 1196 NISLSATNKQSKFSMFKLSSKIKNLDITSRIKSSDPNLKPDP-----EKTTL-----CYK 1245
               ++ +N    F    +S     +DI  +  S D +++ +P     EK+T+       K
Sbjct: 1243 TFEMTLSN----FGSDNISQTSDTVDIVIKEISVDISMREEPSPNSSEKSTVQDITALVK 1298

Query: 1246 IDYIR---ANIVQDGIVVPPKQPSQLFSCSIELLEGYLSYDKLSLLDNNVQSCSVTLSPG 1302
            ++ +    +N  ++G +    +  QL S SI+ LE +++ + +     N  S    +   
Sbjct: 1299 VESLALCVSNTSRNGPLENIHE-DQLCSTSIKDLEFWMTSEDIRKSSFNATSIDTWVHSD 1357

Query: 1303 TDKLLFEFLNPFISTFDLLQRELSSFEDTLLASKREFLLNILRGGRDYEIQHDPPVITKP 1362
              +L   FL    +  D +   +S  ++ L  ++R+F   I     +Y+I HDPPVITKP
Sbjct: 1358 KTELCCIFLKNTAANIDTITEVVSVHKERLQKAQRDFFYRISTASDEYQIIHDPPVITKP 1417

Query: 1363 ANITRFSNRHIRSAESWRIIMRLRHILNYLPQEWHQSFTRHLGTQDFTSPEEAGKEFLSI 1422
            A ITR  N+H+R  +SW+II RLRHILNYLP          L +  F +P  AG+ FL+I
Sbjct: 1418 AYITRLPNQHVRENKSWKIITRLRHILNYLPPSLLAEIYGALKSASFEAPTNAGEIFLNI 1477

Query: 1423 FSDWRSWEPTDVQGSFVHEKVF 1444
            FS WRSWE +DV+  +++ K F
Sbjct: 1478 FSKWRSWESSDVEQCYMYRKAF 1499

 Score =  597 bits (1539), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 401/1204 (33%), Positives = 616/1204 (51%), Gaps = 45/1204 (3%)

Query: 1704 VLFQGQVANITLKLQILSPFIILYCAENFELQAESTDSVIFDLNSGESYMEISSAKQKLD 1763
            V F+  V + T ++  LSP  I    +   +Q E   +    L      +++ S      
Sbjct: 1762 VAFEAHVDDFTSEISALSPLSISKRFKGLTVQFEKEANSSLRLKVENFDLDLLSEMTAQQ 1821

Query: 1764 YFKYTHTCLKLSGT--SSSARLFEHISCDIGILKLSVFDLKTRITDLLQDIKAALFSMKS 1821
            Y K + + ++L+        ++   +  +  + K  + D +  I  L QD+  A  +++ 
Sbjct: 1822 YLKVSQSQVELTAKIHDKIEKVASKMQLESALTKFKLCDPREIIETLTQDLVNAKQNLEQ 1881

Query: 1822 LS-DILNISQSSPTASAFGSWFS--ILPDNL--SLQATYAGLLLGFGHTLYILEFNNFEA 1876
            L   +L +     T S     F+  + P      L   Y GLL+  G T YI E N   +
Sbjct: 1882 LKIHLLALGALFGTDSTDEEVFAGALWPREWLWQLDMKYVGLLVPLGTTSYISEINELSS 1941

Query: 1877 KHTRDGLPDAITPRPCFKVDHSIESASFLIKDRRIDDRLAKVVDFAVNFNMVHDTDLCIQ 1936
              + D    A    P    + S+   SFLI D+ + + L+KV++FA    +    +  ++
Sbjct: 1942 SLSCDEA--AEFSFPLVHGELSVAGISFLINDKELPEDLSKVLEFAFRIKLAKVAENSMK 1999

Query: 1937 SVQIESTHLKITLAPMTVVRLLSLINEFGIIRKQFTEESIYTPSSAHNNSTATECLEPSV 1996
            S+QIESTH +I L P +++R+LSL  E   +      +++   +   ++  A +    S 
Sbjct: 2000 SLQIESTHFRIALCPFSLIRILSLAYEATHLSGL---QALKDNAGVKSSDDAKDFFNISQ 2056

Query: 1997 WRLIIKSGHILSHDFSIVWLFDIPNSSADGLICGYDRLFSVYEKPYGKLTLLNAYFSAAK 2056
                  S  ILS+DF + W+F+   +S  GL  GY RLF+ +EKPYGKLTLL+AYF  A+
Sbjct: 2057 ---TFHSIQILSYDFCLGWIFNNDGASNSGLTWGYQRLFAAHEKPYGKLTLLDAYFFIAR 2113

Query: 2057 ILASEADFYSSVVRKQRINTSYLSDMQLRYWFTEDSENTDLFIRIHGAKLAVDISAEIVT 2116
               S  DFY       R N S L  MQ+ YWF  +    +LF+RI+G +L V   ++ + 
Sbjct: 2114 GSTSN-DFYIQPDEVDRPNRSSLPSMQICYWFETNGSEDELFVRINGERLDVSFLSKSIG 2172

Query: 2117 LLEETIQSIQTFNNLKKALVDPFRTKK------QDSDISKEPYNWNNQLATGVRSLNCII 2170
            +     +S+  F  LK+  +DPF+ ++        S  SK P      + + +  +NC +
Sbjct: 2173 IAGGFARSLHLFQELKRQYLDPFKPEEPVKRVPAGSAFSKLP------ILSSISHVNCKV 2226

Query: 2171 NYAGVTLKLHSHD--GRGDASPLELTSPSYKVAIDYKYFPNLEKTHRFRTLITATPTHNT 2228
             YAG   KL+S D   R      +L SPS  V  +Y      ++ H  R L++   +HNT
Sbjct: 2227 RYAGGVFKLYSLDDIKRKTGPSFQLESPSVDVIFEYTKMLTGKRKHLLRALMSVDSSHNT 2286

Query: 2229 FYSTSAFLIHDLCYRFXXXXXXXXXXXXXXXXXXXXXIKVEGSDNSTLLGSIDLVIILNV 2288
             + T   +I ++                            EG +  +LL  +D+  ++N+
Sbjct: 2287 LFPTCVPIISEMALDIRQLLKDLNKSSVETPRTSNMQ---EGINYRSLLQDVDISFMMNI 2343

Query: 2289 GKQEVTFSCEPKAKVQATVGXXXXXXXXXXXXXXXXXSLCLAIEIENLMTNSRHIYSREV 2348
             KQ+++ SCEPKAKVQA VG                  L L+++I N+   SRHI+SREV
Sbjct: 2344 DKQQISLSCEPKAKVQADVGFEKFAMKLFTNDFDVLEPLSLSLDIHNITATSRHIFSREV 2403

Query: 2349 CASLKLRHISMVFDIMGSQVRRIYGSTLISSPLFYFNMKQLQDLKLFIDQWFPQKTPMNT 2408
              SL +  +S VF +        YG   I +   YFN+KQLQDL +FI+ W   K     
Sbjct: 2404 STSLNIECLSFVFMLTHPDTIHTYGIANIPTIDVYFNIKQLQDLNVFINIW---KLDSKI 2460

Query: 2409 GSYPE-----GVLVDDISRXXXXXXXXXXXXXXXXXXXXVIVAGSCAEIELGPSLGVLNV 2463
             S PE      +   ++ +                    VI++    EI+LG SLGVL++
Sbjct: 2461 LSQPELDNKFVIGPTNLEKPLTSKYKKVISNSSFPWNFVVILSRIRGEIDLGISLGVLSL 2520

Query: 2464 TSEDVWAISKQQVDWSQQLDLNMGKLDVTSSGRLGGNFLVRNAHLSLELKWPNPKDFFQV 2523
            T+E +WA++    DW+Q L L + KL ++S GRLGG FL++N     ++KWP  +  F+ 
Sbjct: 2521 TTEKIWAVTDHYSDWTQTLSLQLDKLSLSSDGRLGGTFLLQNFRWMSQIKWPLNEGSFES 2580

Query: 2524 PLVCVKLGSDTVDTKLSFDYHTFFISSLKQGYASLFNERDEDGSLADLLSVTVSFESVNI 2583
            PLV + +  D    KL+FDYH   I+S+++   SLFN+RD  G + +LLSV++S +S  +
Sbjct: 2581 PLVVLNIFLDETAVKLTFDYHLVLIASVEKLSLSLFNKRDPRGVIRNLLSVSLSSDSTQV 2640

Query: 2584 FLTALAAANISDIKNSITRLKKDNELSYLSSFLASDQPSDEPEEDGGIFDXXXXXXXXXX 2643
            FLTALA ANI D+ N+I R++KDN  SYL +   S+    +                   
Sbjct: 2641 FLTALAPANIFDVYNTILRMRKDNRKSYLETLGDSNTRDTKGSSSSHEILSSLSFLRTEL 2700

Query: 2644 XXXGVF-RLQISPTSLFDSDVLILTATKMMANTGIQADIKIKTDLHWQLDDVSLALLPFN 2702
                 F  +Q+ P++LFD +V+   A      +  +   K+KT L  ++ +V LAL  + 
Sbjct: 2701 SVMLKFVHIQVYPSTLFDMEVMTFKARDFSTFSQTEGSKKLKTQLKLKVHNVKLALSTYK 2760

Query: 2703 NSLDESYLATMEVGKYIELSSTIQGGAIFSAPSIVVNMTTWQEPQSNVIELLYSTSFGGT 2762
            + L E   + + V +YIE +S + GG I S P+I++ MTTW +  +N +ELLYS SFGG 
Sbjct: 2761 SQLHERVASQIGVKEYIEHASKVDGGTILSTPAILIGMTTWHDVATNKVELLYSNSFGGK 2820

Query: 2763 VKIRWNLGPISFIKDMWQAHMNAMQLREGYYHGLAESGVAVTPLNSKAVPLEMHLGSDYQ 2822
            + +RWNLG I+F+++MW  H  AM LR   ++G ++S      L  K    ++ LG +Y 
Sbjct: 2821 IGVRWNLGSINFLREMWATHARAMALRRS-HNGQSKSFFEDEHLGDKLK--DVDLGDEYT 2877

Query: 2823 YLPLQEPDIEMPRIKDLGDATPPIEWFGVNRTKFPGFTHQFVIVPLQKLARTAEKEYEKI 2882
            Y+PL+EP IE+P+ KDLG+ATPP+EWFGVNR +FPG THQ VIVPLQKLA  AE E+ +I
Sbjct: 2878 YIPLEEPHIEIPQTKDLGEATPPVEWFGVNRKQFPGLTHQGVIVPLQKLAHLAESEWARI 2937

Query: 2883 LGRA 2886
            LGRA
Sbjct: 2938 LGRA 2941

>KLTH0G13728g Chr7 (1175228..1184128) [8901 bp, 2966 aa] {ON} similar
            to uniprot|Q12150 Saccharomyces cerevisiae YLR087C CSF1
            Protein required for fermentation at low temperature
          Length = 2966

 Score =  847 bits (2188), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 485/1523 (31%), Positives = 782/1523 (51%), Gaps = 111/1523 (7%)

Query: 3    IFAIFYVGRVLGYIVSKAANLVLWKQYRVTVSIQSLVFSPLAGKVHFKNVSVTSQDQLIS 62
            +   FY GRV GY ++     + WK+Y+V +SIQSL  S L G++ FKN++V +Q+Q  S
Sbjct: 32   LLGAFYFGRVFGYTLTFLLEWLAWKRYKVKISIQSLKISFLGGRIFFKNLTVVTQNQTFS 91

Query: 63   VLKGTITWRYWLIGRYRRSGTADGARR---------CRFALKFEGFEYFVYNRNGVYDRI 113
             L+G+ITWRYWL+   R++  A  +           CRF ++ +G E+F+YN+   +D I
Sbjct: 92   FLQGSITWRYWLLNS-RKTAFAKASENIDKSVEKLPCRFRVECQGLEHFIYNKTQAFDNI 150

Query: 114  ARELDGEDXXXXXXXXXXXXXXXIAELQDD------------------------------ 143
               L  ED                 E   D                              
Sbjct: 151  LNSLPREDLERFKDFFQDNSDKNTDECSVDEDSAGQRSHLETSTSSPSSKSKSLNDRSFQ 210

Query: 144  -----PLIRRFLPVEFLHNKGAIVLGNKQTHSVAIMNYEKLAGTVSIEVPDDTRAPSSFR 198
                 P   + LP+E+   KGA+V+GNK + SV +++YEKL G +   +PD        +
Sbjct: 211  SPDSTPPFLKLLPLEYSVQKGAVVIGNKTSSSVMVLSYEKLDGVLDTCLPDSKIDLYKIK 270

Query: 199  TEAKISNCTVAIKPNISYEVDNPVKIYVEPKRTARLW-KKYKTLLGTVLEATLH-AKRKK 256
               +     +++KPN+S E +NP+K +V+  + ++LW + Y+    T   ++ + A   K
Sbjct: 271  VRNEFRKFHISLKPNLSLESENPLKSFVKRSKLSKLWHRSYQLFFKTDSPSSKNPANSAK 330

Query: 257  EQHQTPKWYDNWRGLSMYDVNXXXXXXXXVKFDIEHHEYAKCTTVLKADQMDVTYSYGMP 316
            +  + P     WRGL +Y            +FD+  HEYA+ T V+K D M + Y++  P
Sbjct: 331  DGTRNP--LKRWRGLGLYWKEEDAAWDDRFQFDLSKHEYARYTKVMKCDNMLLEYAFDAP 388

Query: 317  G--------TARVTDSDNAENPLLERPELDHSVDILVYDANCTYGPWANRQVQQCLRVFS 368
            G        T +  D  +  N     P  D+S+DI +  A+  YGPW++ ++    ++FS
Sbjct: 389  GIVPHGALPTFQTVDGPDVGN---SGPPPDYSIDIQISGASLYYGPWSHHEIMPLQKLFS 445

Query: 369  PTVCRNFKLRTPEEIAQQTEPAA------FKLSVTIMEDSVLRVPMKESSKDAAFLEKYK 422
            P V R+       +  +Q  P +       +LS+ I+ +SV R+P +E+SKD  FL++++
Sbjct: 446  PVVSRD------SQPVEQLTPGSKRIYTRLRLSILIVGESVWRIPTREASKDLEFLKRFR 499

Query: 423  QTRDETRPFGWIDIRIAKESNITVRMAAYPTENGFENILHANLVDTTISTSVNHDTLLKA 482
            +T DETRPFGW+++ +++ S +   +A  PT  GF+N L  + V   I TSVNHD LL A
Sbjct: 500  ETEDETRPFGWLEVSLSEGSEVRFNIAMCPTATGFDNTLDLHFVKPEIRTSVNHDILLSA 559

Query: 483  KSHDITVDFSYPYGWQDKAEWNFNVCSTQAELFVLRDHVYLISDLVTDFSGGEEVLYEQF 542
            ++H +     YP GW  KAEW F+  S Q ++F+L+DH+ L+ D+++DF  GE   YE F
Sbjct: 560  QTHSMHATMGYPLGWNKKAEWVFDSVSNQCQIFILKDHITLLGDIISDFGSGEPTPYELF 619

Query: 543  RPFDYRFRWDIRGYSAYLNVNDANIINNPIDFGENCYLSVHGDDAEITFSLPITSIIQKY 602
            RPF Y F W+  GYS YLNVNDANI+NNP++F ENCYLS HGDD  + F +P  +I    
Sbjct: 620  RPFSYTFNWNFTGYSIYLNVNDANIVNNPVNFNENCYLSFHGDDLRLNFEVPQENIAGNS 679

Query: 603  VTVDFNIFTPHFSLFLNAPPWHTFSELLHYKEIGRSKNFNIKGSYTSYSEVDVDNVDALN 662
              +++ +FTP F L +N P W+T  E +  KE+GRS NF++ GSY  +S++DVDN+D + 
Sbjct: 680  TKINYELFTPLFRLNMNTPSWNTLHEFMKDKEVGRSANFSLSGSYLFHSKLDVDNIDTII 739

Query: 663  IACETDYIVVLCYGVILKCMLNVKVNYFGEMVHFRTTEEYVEELQRRNKQNPSTCRPFNS 722
            I C +    + CYG +L+  L VK+NYFG+ VHF+TTEEY+EEL+  N    +T      
Sbjct: 740  IECCSKSTTLKCYGYVLRYFLGVKMNYFGDFVHFKTTEEYMEELRGTNAVTKTT------ 793

Query: 723  DGNVHDSDVVATESNEIIDASFDA----FGGPPTIKKSALKRSINELDVWFTFISKGGCF 778
                HDS+    E+ + +D            P T KK++LKR +NE DVWFTF+ + GCF
Sbjct: 794  ----HDSETEIQEAPKQMDEDSSQREQHIKDPLTAKKTSLKRMVNEKDVWFTFVVEDGCF 849

Query: 779  FFPENIYKFDACLGFYFDNLEASLRFLNYYVDAAVSLDSIYFKRHTDIDARTLFKVIEDI 838
              PEN+Y  D+C    FD+L+  LR +NYY+D   +L  +  +R  D     +F+  +  
Sbjct: 850  ILPENLYDCDSCYALEFDSLDIDLRHINYYMDMQAALSPLRIRRLIDCGCEEVFEQ-KGR 908

Query: 839  GIPIDASDAYLSQFSFRLHKMLGIMPSEESYACEFDVRVDTLDVHCDLAVLKAFVNTLRN 898
             +  +     LS+     H+M G+ P+EE+Y C++D  + TLD+  DL     F+N  + 
Sbjct: 909  ALCGELVAGRLSRLHIHTHRMFGLPPAEETYFCKWDFSLGTLDLSSDLPFTLGFINAWKK 968

Query: 899  LAFGFKDVENSLQYEREQVFDLNKISCVIENVTVKLQNVDKDEDIWLSLNLPVTTLTSFD 958
            L FGF+D EN + Y+   + D+  ++  I+ +      + KDE   + LN    +    D
Sbjct: 969  LGFGFRDYENIMNYKVAPILDMTSVTLAIDAIVFCTDKI-KDETA-IQLNAQDISAKFAD 1026

Query: 959  LANERYSRRSDLSIPELLFGIYRGDSESTCLGAFSTGVTVTLFERFEQFARCRVLQRKHI 1018
            L N  YS R DL +  L   I   +  +  + +F T + ++ F + +        Q+ HI
Sbjct: 1027 LENSLYSSRVDLDVANLTASIIDKNKSNKAIASFMTSIKISNFCQLQDLLAHSQQQKVHI 1086

Query: 1019 LVNDAPFHRCSFMLPPEYKKMPIYRSLYGCXXXXXXXXXXXXXXXADNFEVIFEKLLGEI 1078
              NDAPFHRC F++P   +    Y+ L+GC                +N + +F+   G +
Sbjct: 1087 ASNDAPFHRCPFLIPLTLQNSSDYKGLFGCIPPGVSIPSLAVPLQTENVKAVFQ---GYL 1143

Query: 1079 YQEYAS----DSSYQITD--DSISSTEHDYHNQTVNAAIGTSSSLFIRSQNHQQTLSSFI 1132
              E AS    D  + + +  +  SS+  D+  Q +   +  ++SL     +     ++ +
Sbjct: 1144 KAENASKDFVDRWFPVNEVKNKNSSSLKDFKGQ-LQPILDDNTSLSSSFSDPTFEHNTLV 1202

Query: 1133 VEFDPIDGYLDLSATEFMLEIYKYLTEVSLDEAIDSLEIGIINQFIQTFGEDNGISEVRV 1192
            V  +     +     E +    +   +  +++ ID++E+ ++  FI+          +RV
Sbjct: 1203 VNLENSRLSISPECYEVIGNAVEQCHKKLIEQFIDNIELDVVLHFIKMASRQKNYKNIRV 1262

Query: 1193 LCPNISL--SATNKQSKFSM---FKLSSKIKNLDITSRIKSSDPNLKPDPEKTTLCYKID 1247
            L P + +     NK++ + +    K+++   +LD + +     P    DPE TT   KI+
Sbjct: 1263 LMPTLDVLFETYNKENTYDVEGQVKVTANQVSLDWSLKKGLKLPGSDNDPEDTTSLLKIE 1322

Query: 1248 YIRA---NIVQDGIVVPPKQPSQLFSCSIELLEGYLSYDKLSLLDNNVQSCSVTLSPGTD 1304
             +     N +           +  F CS++ LE +   + ++  D+++   S+  S   D
Sbjct: 1323 SLDLEVFNKLDKKTKFAEMDENIAFGCSVKELEAWSYLNGIA--DSSLYLKSINASVALD 1380

Query: 1305 KL--LFEFLNPFISTFDLLQRELSSFEDTLLASKREFLLNILRGGRDYEIQHDPPVITKP 1362
            K   L +F+    +    L   LS        +++EF   I +   +Y+I HDPPVITKP
Sbjct: 1381 KFNWLIDFMRKAFNDSKQLINRLSYCTGQFRKAEQEFFYRISKASDEYQITHDPPVITKP 1440

Query: 1363 ANITRFSNRHIRSAESWRIIMRLRHILNYLPQEWHQSFTRHLGTQDFTSPEEAGKEFLSI 1422
            A ITR  ++H+R + SW+I+ RLRHILNYLP          L   ++     A + FL I
Sbjct: 1441 AYITRLPSQHVRESRSWKIVTRLRHILNYLPTTLISDIFNDLKNSEYPPRSTAEETFLEI 1500

Query: 1423 FSDWRSWEPTDVQGSFVHEKVFT 1445
            FS+W +W+ +DV+  +++ +VFT
Sbjct: 1501 FSNWGNWDYSDVEKCYMYRRVFT 1523

 Score =  658 bits (1698), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 407/1181 (34%), Positives = 624/1181 (52%), Gaps = 64/1181 (5%)

Query: 1732 FELQAESTDSVIFDLNSGESYMEISSAKQKLDYFKYTHTCLKLSGTSSSARLFEHISCDI 1791
             +L  E+ D  +F   + + Y++IS +          H   K + +  + +L      D 
Sbjct: 1824 LKLAFETLDIDVFSTRTTQQYLKISQSNISFSL----HRPKKNNASPPTVKL------DS 1873

Query: 1792 GILKLSVFDLKTRITDLLQDI---KAALFSMKSLSDILN-------ISQSSPTASAFGSW 1841
             I KL ++D +     L +DI   KA L S+KS    LN       +SQ +   +   SW
Sbjct: 1874 NITKLKLYDPRDITLPLGKDIAQAKACLASLKSCFGKLNTKNDKDIMSQGNTKFNFSASW 1933

Query: 1842 FSILPDNLSLQATYAGLLLGFGHTLYILEFNNFEAKHTRDGLPDAIT--PRPCFKVDHSI 1899
                     ++  Y GLL+  G T YI E N   A  T D   +  +   +   + D S 
Sbjct: 1934 I------FQVRLNYVGLLIPLGSTSYITELNEISAFITADEFTNKASENSQGALRGDLSA 1987

Query: 1900 ESASFLIKDRRIDDRLAKVVDFAVNFNMVHDTDLCIQSVQIESTHLKITLAPMTVVRLLS 1959
             S +FLI DR + + L++VVDFAV+  +  +++  I+S+QIES + +I L+P ++VR+L 
Sbjct: 1988 ASIAFLINDRMLPEALSRVVDFAVSIKIAKESEEVIRSLQIESPYFRIALSPFSLVRILF 2047

Query: 1960 LINEFGIIRKQFTEESI-YTPSSAHNNSTATECLEPSVWRLIIKSGHILSHDFSIVWLFD 2018
            L+NE   + +    +++   P S        E  E   +R   +S  +LS++F + W+FD
Sbjct: 2048 LVNELSRLSELQKRQTVGKLPESV-------EVRETFRFRRAFRSVQVLSYNFCLGWIFD 2100

Query: 2019 IPNSSADGLICGYDRLFSVYEKPYGKLTLLNAYFSAAKILASEADFYSSVVRKQRINTSY 2078
            + +S   GLI GY RLF+ +EKPYGKLTLL+AYFS A+   S+ DFY+     +  N S+
Sbjct: 2101 VNDSPEPGLIWGYQRLFAAHEKPYGKLTLLDAYFSIAEGSTSD-DFYAHKNSFENPNRSF 2159

Query: 2079 LSDMQLRYWFTEDSENTDLFIRIHGAKLAVDISAEIVTLLEETIQSIQTFNNLKKALVDP 2138
            L  MQ+RYW        +LFIRI+G +L V   ++ + +    ++S+  F+ LKK  VDP
Sbjct: 2160 LPSMQIRYWIESKGLTDELFIRINGERLDVRFLSKSIDVAGGLMKSLNMFDELKKQYVDP 2219

Query: 2139 FRT------KKQDSDISKEPYNWNNQLATGVRSLNCIINYAGVTLKLHSHDG-RGDASP- 2190
            F++          S  SK P      L+T ++ ++C + YAG   +L+S D  + +A P 
Sbjct: 2220 FKSVANPKRPSATSTFSKFP-----GLST-IQRVDCKVQYAGGVFRLYSLDDVQNEAGPS 2273

Query: 2191 LELTSPSYKVAIDYKYFPNLEKTHRFRTLITATPTHNTFYSTSAFLIHDLCYRFXXXXXX 2250
             +L SPS ++  DY+   + + +H  R  +    +HNT + T   +++++          
Sbjct: 2274 FQLESPSVEILFDYRRMVHGKHSHILRAWMIVYSSHNTIFPTCVPVLNEMA---RDIRQL 2330

Query: 2251 XXXXXXXXXXXXXXXIKVEGSDNSTLLGSIDLVIILNVGKQEVTFSCEPKAKVQATVGXX 2310
                           +  E  D  + L   D+  ++++GKQ+++FSCEPKAKVQA +G  
Sbjct: 2331 LKGFNRSPQEASHKSVSQESLDYRSFLRGTDISFLIDIGKQQISFSCEPKAKVQADLGFE 2390

Query: 2311 XXXXXXXXXXXXXXXSLCLAIEIENLMTNSRHIYSREVCASLKLRHISMVFDIMGSQVRR 2370
                            L L+I+I  +   SRHI+SREV  S+K+  +S +F +       
Sbjct: 2391 KLAVKVFTNDLDMSEPLSLSIDIYEITAKSRHIFSREVSTSIKIDQLSWIFILTHPDTIH 2450

Query: 2371 IYGSTLISSPLFYFNMKQLQDLKLFIDQWFPQK----TPMNTGSYPEGVLVDDISRXXXX 2426
             YG   I +   YFN+KQLQDL +F++ W P       P     +   +  ++  +    
Sbjct: 2451 TYGIMHIPNIDVYFNIKQLQDLNIFVNIWKPDSYVFTQPELDSEHSRALTSEE--KPLVA 2508

Query: 2427 XXXXXXXXXXXXXXXXVIVAGSCAEIELGPSLGVLNVTSEDVWAISKQQVDWSQQLDLNM 2486
                            +I++    +I+LG SLGVL++T++ +WAI+    DW+Q+L L M
Sbjct: 2509 KFKKVSSTTSFPWNFILIISKIKGDIDLGISLGVLSLTTDRIWAITDHYSDWTQKLSLQM 2568

Query: 2487 GKLDVTSSGRLGGNFLVRNAHLSLELKWPNPKDFFQVPLVCVKLGSDTVDTKLSFDYHTF 2546
             K+ ++S GRLGG  L+RN      ++WP  +  F+ PLV + +  D  D KLSFDYH  
Sbjct: 2569 EKILLSSDGRLGGTLLLRNFSWMSRIRWPVREGVFESPLVTLDVLLDEFDLKLSFDYHLI 2628

Query: 2547 FISSLKQGYASLFNERDEDGSLADLLSVTVSFESVNIFLTALAAANISDIKNSITRLKKD 2606
             I+S++     LFN+RD  G   +LLSV +S  S  +FLTALA ANI D+ N+I R++KD
Sbjct: 2629 LIASVEVLKLKLFNKRDPRGISRNLLSVAISSNSTQLFLTALAPANILDVYNTILRMRKD 2688

Query: 2607 NELSYLSSFLASD-QPSDEPEEDGGIFDXXXXXXXXXXXXXGVFRLQISPTSLFDSDVLI 2665
            N  SY  +   S+ + +        I +                 +QI P+ LFD +VL 
Sbjct: 2689 NRKSYFETLGDSNTKDTRSASTSKDILNSLSFLRTELEVSLKFVHIQIYPSKLFDMEVLT 2748

Query: 2666 LTATKMMANTGIQADIKIKTDLHWQLDDVSLALLPFNNSLDESYLATMEVGKYIELSSTI 2725
              A   +  + I+ D K+KT L WQ+  V +AL  F N L E   + + V +YIE +   
Sbjct: 2749 FKAKDFLTQSQIEGDEKLKTHLKWQIHGVKIALSRFKNQLHEKAASQIGVKEYIEHARKA 2808

Query: 2726 QGGAIFSAPSIVVNMTTWQEPQSNVIELLYSTSFGGTVKIRWNLGPISFIKDMWQAHMNA 2785
             GG I   P+I++ MTTW +  +N +ELLYS SFGG + IRWNLG I+F+++MW  H+ A
Sbjct: 2809 DGGTILVIPAILIGMTTWHDVATNTVELLYSNSFGGKIGIRWNLGSINFLREMWATHVRA 2868

Query: 2786 MQLREGYYHGLAESGVAVTPLNSKAVPLEMHLGSDYQYLPLQEPDIEMPRIKDLGDATPP 2845
            M LR   ++G          L  K    ++ LG +Y+Y+PL+EP IE+P+ KDLG+ATPP
Sbjct: 2869 MALRRS-HNGQPRGFFEDEHLEEKL--RDVDLGDEYEYVPLEEPHIEIPQTKDLGEATPP 2925

Query: 2846 IEWFGVNRTKFPGFTHQFVIVPLQKLARTAEKEYEKILGRA 2886
            +EWFGVNR +FPG THQ +IVPLQKLA  AE E+ +ILGRA
Sbjct: 2926 VEWFGVNRKQFPGLTHQAMIVPLQKLAHIAETEWARILGRA 2966

>Smik_12.146 Chr12 complement(286690..295566) [8877 bp, 2958 aa] {ON}
            YLR087C (REAL)
          Length = 2958

 Score =  823 bits (2125), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 477/1507 (31%), Positives = 769/1507 (51%), Gaps = 88/1507 (5%)

Query: 6    IFYVGRVLGYIVSKAANLVLWKQYRVTVSIQSLVFSPLAGKVHFKNVSVTSQDQLISVLK 65
            +FY+GR+  Y+VS     +LWK+ +V +++++L  S L G++HFK++SV  +D  IS+L+
Sbjct: 37   VFYMGRIYAYLVSFILEWLLWKRAKVKINVETLRVSLLGGRIHFKHLSVIHKDYTISILE 96

Query: 66   GTITWRYWLIGRYRRSGTADGARR---------CRFALKFEGFEYFVYNRNGVYDRIARE 116
            G+ITW+YWL+   R++   D  +          C+F L+ EG E F+YNR   YD +   
Sbjct: 97   GSITWKYWLLN-CRKAELIDNNKSPSKNNVKLPCKFCLECEGLEIFIYNRTVAYDNVINL 155

Query: 117  L----------------------DGE--DXXXXXXXXXXXXXXXIAELQDD--------- 143
            L                      DG   D                A + +D         
Sbjct: 156  LSKDERDKFEKYLNEHSFPEPFSDGSSADKLDEDLSESAYTTNSDASIINDRDYQETDIG 215

Query: 144  --PLIRRFLPVEFLHNKGAIVLGNKQTHSVAIMNYEKLAGTVSIEVPDDTRAPSSFRTEA 201
              P   +FLP+E   ++G+++LGNK T SV I++YE   G V +  P +       +T+ 
Sbjct: 216  KHPQFLKFLPIELNFSRGSLLLGNKFTPSVMILSYESGEGIVDVLPPKERVDLYRNKTQM 275

Query: 202  KISNCTVAIKPNISYEVDNPVKIYVEPKRTARLWKKYKTLLGTVLEATLHAKRKKEQHQT 261
            +  N  ++IK NI Y+    +K  ++  + ++LWK +  +L  V +  +  + KK    +
Sbjct: 276  EFKNFEISIKQNIGYDDAIGLKFKLDTGKVSKLWKAFIRVLQLVSKPVVSKRTKKNTRSS 335

Query: 262  -PKWYDNWRGLSMYDVNXXXXXXXX---VKFDIEHHEYAKCTTVLKADQMDVTYSYGMPG 317
               +Y  W+GLS+Y              ++FD+ +HEYAK T++LK  ++ ++Y   +PG
Sbjct: 336  NDSFYQKWKGLSLYKATSGEAKANDLDDIEFDLTNHEYAKFTSILKCPKVTISYDVDVPG 395

Query: 318  TA------RVTDSDNAENPLLERPELDHSVDILVYDANCTYGPWANRQVQQCLRVFSPTV 371
                     ++D D  +      P  D ++D+ ++  +  YGPWA RQV    RV SP V
Sbjct: 396  VVPHGAHPTISDIDGPDVGNNGAPP-DFALDVQIHGGSICYGPWAQRQVSHLQRVLSPVV 454

Query: 372  CRNFKLRTPEEIAQQTEPAAFKLSVTIMEDSVLRVPMKESSKDAAFLEKYKQTRDETRPF 431
             R  K         +     F+++++I ED+  R+P +E+SKDA FL+ YK+T +E RPF
Sbjct: 455  SRTAKPIKKLPPGSRRVYTLFRMNISITEDTTWRIPTRETSKDAEFLQHYKETSEEYRPF 514

Query: 432  GWIDIRIAKESNITVRMAAYPTENGFENILHANLVDTTISTSVNHDTLLKAKSHDITVDF 491
            GW+D+R  K++     ++  PT  GF+N  H + V+T I +SVNHD LLK+K  +I  D 
Sbjct: 515  GWMDLRFCKDTYANFNISVCPTVEGFQNNFHVHFVETEIRSSVNHDILLKSKVFNIDGDI 574

Query: 492  SYPYGWQDKAEWNFNVCSTQAELFVLRDHVYLISDLVTDFSGGEEVLYEQFRPFDYRFRW 551
             YP GW  KA W  N+ S Q E F+LR+H+ L++D ++DFS G+   YE FRPF Y+  W
Sbjct: 575  GYPLGWNSKAIWIINMKSEQLEAFLLREHITLVADTLSDFSAGDPTPYELFRPFVYKVNW 634

Query: 552  DIRGYSAYLNVNDANIINNPIDFGENCYLSVHGDDAEITFSLPITSIIQKYVTVDFNIFT 611
            ++ GYS YLNVND NI+NNP+DF ENCYLS+HGD   I  ++P  SI+  Y  + + I T
Sbjct: 635  EMEGYSIYLNVNDHNIVNNPLDFNENCYLSLHGDKLAIDVTVPRESILGTYTDISYEIST 694

Query: 612  PHFSLFLNAPPWHTFSELLHYKEIGRSKNFNIKGSYTSYSEVDVDNVDALNIACETDYIV 671
            P F + LN PPW+T +E + +KE+GR+ +F IKG+Y  YSE+D+DNVD L I C ++  V
Sbjct: 695  PMFRMMLNTPPWNTLNEFMKHKEVGRAYDFTIKGTYLLYSELDIDNVDTLVIECTSNSTV 754

Query: 672  VLCYGVILKCMLNVKVNYFGEMVHFRTTEEYVEELQRRNKQNPSTCRPFNSDGNVHDSDV 731
            + CYG +++ + NVK+NYFGE  +F T+EEY   L  R+  + +T        +  DS  
Sbjct: 755  LHCYGFVMRYLTNVKMNYFGEFFNFVTSEEYTGVLGARDVGDVTTKSSVVDLASTVDSGY 814

Query: 732  VATESNEIIDASFDAFGGPPTIKKSALKRSINELDVWFTFISKGGCFFFPENIYKFDACL 791
                 N  +  + +A  GP  +K+S LKR+ NE D+WFTF    G    PE IY FD C+
Sbjct: 815  ----QNSSVKNNSEA-KGP--MKRSDLKRTTNETDIWFTFSVWNGALILPETIYSFDPCI 867

Query: 792  GFYFDNLEASLRFLNYYVDAAVSLDSIYFKRHTDIDARTLFKVIEDIGIPIDASDAYLSQ 851
              +F  L    R  NYY+D    LD    KRH       +F  I       +     LS 
Sbjct: 868  ALHFSELVVDFRSCNYYMDIMAVLDGTSIKRHVSKQINEVFDFIRRNNGADEQEHGSLSD 927

Query: 852  FSFRLHKMLGIMPSEESYACEFDVRVDTLDVHCDLAVLKAFVNTLRNLAFGFKDVENSLQ 911
             +   H+M G+ P+E +Y C++D+ +  L +  D+  +K F ++   + FG+ D+EN L 
Sbjct: 928  LTIHGHRMYGLPPTEPTYFCQWDINLGDLSIDSDVEFIKGFFSSFYKIGFGYNDLENILL 987

Query: 912  YEREQVFDLNKISCVIENVTVKLQN-VDKDEDIWLSLNLPVTTLTSFDLANERYSRRSDL 970
            Y+ E + D+  ++   E + + L++ V K + +   ++      T  D  NE YS+R D+
Sbjct: 988  YDTETIDDMTSLTVHAERIRISLEDPVMKSQSV---ISAESILFTLIDFENENYSQRIDV 1044

Query: 971  SIPELLFGI--YRGDSESTCLGAFSTGVTVTLFERFEQFARCRVLQRKHILVNDAPFHRC 1028
             +P+L   +    GD        F T +  T FE+++   + R  QRK+I  +D+P+HRC
Sbjct: 1045 KVPKLKISLNCVMGDGVDMSFLKFETKLRFTNFEQYKDIDKKRSEQRKYITFHDSPYHRC 1104

Query: 1029 SFMLPPEYKKMPIYRSLYGCXXXXXXXXXXXXXXXADNFEVIFEKLLGEI---------Y 1079
            SF+LP  Y+    Y+ LYG                 D  + I E ++GE          +
Sbjct: 1105 SFLLPLFYQDSDTYQKLYGAIAPSSSIPTLPLPTLPDTIDFIIEDIVGEYATLLEAANPF 1164

Query: 1080 QEYASDSSYQITDDSISSTEHDYHNQTVNAAIGTSSSLFIRSQNHQQTLSSFIVEFDPID 1139
            ++  +++   +     S TE D  N    ++ G     F    + ++   +++V+   I 
Sbjct: 1165 KDSFAETPSTVEPSKASFTEDD--NDEEASSSGFKPGAFTEDGDDEK--DNYVVDVSYIL 1220

Query: 1140 GYLDLSATEFMLEIYKYLTEVSLDEAIDSLEIGIINQFIQTFGEDNGISEVRVLCPNISL 1199
              +D     F   + + L   ++ + +D +EIGI+ +          IS + +    ++L
Sbjct: 1221 LDIDPLLFVFTKSLLEQLYSENMVQVLDDIEIGIVKRLSNLQEGITSISNIDIHIAYLNL 1280

Query: 1200 S-ATNKQSKFSMFKLSSKIKNLDITSRIKSSDPNLKPDPEKTTLCYKIDYIRANIVQDGI 1258
                  +  F ++     +  +D   R KS + N      +     ++  +R  + Q   
Sbjct: 1281 IWQETGEEGFELY-----LDRIDYQMREKSLEKNRTTKLLEVAALARVKTVRVTVNQKKN 1335

Query: 1259 VVPPKQPSQLFSCSIELLEGYLSYDKLSLLDNNVQSCSVTLSPGTDKLLFEFLNPFISTF 1318
                +      S  +E  E + S +   +   N+ S  +T+     + LF++ +   +  
Sbjct: 1336 PDLSEDRPPALSLGLEGFEIWSSTEGRQVNSLNLTSSDITIDESQMEWLFQYCSDQANLL 1395

Query: 1319 DLLQRELSSFEDTLLASKREFLLNILRGGRDYEIQHDPPVITKPANITRFSNRHIRSAES 1378
              +     S +DT  +SK E +  +      Y+I HDP VITKPA I R S  H+R   S
Sbjct: 1396 QEVATSFHSIQDTRTSSKTELISELTAASEYYQISHDPYVITKPAFIMRLSKGHVRENRS 1455

Query: 1379 WRIIMRLRHILNYLPQEWHQSFTRHLGTQDFTSPEEAGKEFLSIFSDWRSWEPTDVQGSF 1438
            W+II RLRHIL YLP +W  +  + L  + +TS  +A   F+S+FS WR+WE +DV  S+
Sbjct: 1456 WKIITRLRHILTYLPDDWQNNIDKVLKERKYTSANDAKNIFMSVFSTWRNWEFSDVARSY 1515

Query: 1439 VHEKVFT 1445
            ++ K+F+
Sbjct: 1516 IYGKLFS 1522

 Score =  551 bits (1420), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 379/1219 (31%), Positives = 602/1219 (49%), Gaps = 69/1219 (5%)

Query: 1698 GNKIHAVLFQGQVANITLKLQILSPFIILYCAENFEL--QAESTDSVIFDLNSGESYMEI 1755
            G KI+ VL     +N++ ++  LSPF I + A+  ++      ++ ++  +   + +M  
Sbjct: 1772 GQKINTVL-TCYFSNVSSEIMPLSPFYIRHEAKQLDIYFNKFGSNEILISIWDTDFFMTS 1830

Query: 1756 SSAKQKLDYFKYTHTCLKLSGTSSSARLFEHISCDIGILKLSVFDLKTRITDLLQDIKAA 1815
               K++   F +    +K  G S       ++   I ++KL+  + +  +   LQD K A
Sbjct: 1831 HQTKEQYLRFSFGDIEIK-GGVSKEGYSLINVDISISMIKLTFSEPRRIVNSFLQDEKLA 1889

Query: 1816 ------LFSMKSLSDILNISQSSPTASAFGSWFSILPDNLSLQATYAGLLLGFGHTLYIL 1869
                  L S+KSL    NI +      A      ++   L    +Y G+L+    T ++ 
Sbjct: 1890 SQGINLLCSLKSLFFSSNIPKKEKQVPAL-----MINWTLDTSISYFGILIPVASTYFVF 1944

Query: 1870 EFNNF--EAKHTRDG-LPDAITPRPCFKVDHSIESASFLIKDRRIDDRLAKVVDFAVNFN 1926
            E +       +T +G LP+       F    SIE+  FLIK+R +   L+KV+DF++  +
Sbjct: 1945 ELHMLLLSLTNTNNGMLPEETKVTGQF----SIENILFLIKERSLPIGLSKVLDFSIKVS 2000

Query: 1927 MVHDTDLCIQSVQIESTHLKITLAPMTVVRLLSLINEFGIIRKQFTEESIYTPSSAHNNS 1986
             +  T    QS Q+ES+H ++ L+P +++RL+   ++   +   +T+   + P+  +   
Sbjct: 2001 TLQRTIDTEQSFQVESSHFRVCLSPDSLLRLMWGAHKLLDLGHYYTKH--HAPNIWNIKM 2058

Query: 1987 TATECLEPSVWRLIIKSGHILSHDFSIVWLFDIPNSSADGLICGYDRLFSVYEKPYGKLT 2046
               +  +P    L  +S HILS+ F I WLF     S  GL+ GY+RLFS YE+ +GK T
Sbjct: 2059 FTGKSDKPKEIPLNFRSIHILSYKFCIGWLFQYGTGSDPGLMLGYNRLFSAYERDFGKFT 2118

Query: 2047 LLNAYFSAAKILASEADFYSSVVRKQRINTSYLSDMQLRYWFTEDSENTDLFIRIHGAKL 2106
            +++++FS A    S + F+S    K + N S+L +MQ+ YWF    E  D F R HG  L
Sbjct: 2119 VVDSFFSVANGNTS-STFFSEGNEKDKYNRSFLPNMQISYWFKRCGELKDWFFRFHGEAL 2177

Query: 2107 AVDISAEIVTLLEETIQSIQTFNNLKKALVD-PFRTKKQDSDI--SKEPYNWNNQLA--- 2160
             V+     + +++ T+QS++ F  LK+ ++D    +  +DS+I  +    N  + LA   
Sbjct: 2178 DVNFVPSFMDVIDSTLQSMRAFQELKRNILDVSENSHSEDSNIYAASSVENAPSSLAPFL 2237

Query: 2161 TGVRSLNCIINYAGVTLKLHSH-DGRGDASP-LELTSPSYKVAIDYKYFPNLEKTHRFRT 2218
              +RS+N    Y G   +++++ D    + P  E+ SP   +   YK+  +  + H+ RT
Sbjct: 2238 NNIRSVNSNFKYDGGVFRVYTYEDIEAKSEPSFEIKSPVVTINCTYKHDEDKVRPHKIRT 2297

Query: 2219 LITATPTHNTFYSTSAFLIHDLCYRFXXXXXXXXXXXXXXXXXXXXXIKVEGSDNSTLLG 2278
            LIT  PTHNT Y+  A L+ +    F                        +  D   LL 
Sbjct: 2298 LITVDPTHNTLYAGCAPLLME----FSESLQKMIKKHSTDEKPNFTKPSPQNVDYKRLLD 2353

Query: 2279 SIDLVIILNVGKQEVTFSCEPKAKVQATVGXXXXXXXXXXXXXXXXXSLCLAIEIENLMT 2338
              D+ + L   KQ+++ SCEPKAKVQA VG                  L  ++ +E+   
Sbjct: 2354 QFDVAVKLTSAKQQLSLSCEPKAKVQADVGFESFLFSVTTNEFDSEHPLEFSLTLEHTKA 2413

Query: 2339 NSRHIYSREVCASLKLRHISMVFDIMGSQVRRIYGSTLISSPLFYFNMKQLQDLKLFIDQ 2398
            + +HI+SREV  S ++  + +        V  +YG  L+S    +FN+KQLQ+L LF+D 
Sbjct: 2414 SIKHIFSREVSTSFEVGFMDLTILFTHPDVISMYGIGLVSDLNVFFNVKQLQNLYLFLDI 2473

Query: 2399 WF--------PQKTPMNTGSYPEGVLVDDISRXXXXXXXXXXXXXXXXXXXXVIVAGSCA 2450
            W         P +  +N G          I                      +I      
Sbjct: 2474 WRFSSILHTRPAQRSVNKG----------IDMHSLTSTSHVDLGTEIPWCFTLIFTNVSG 2523

Query: 2451 EIELGPSLGVLNVTSEDVWAISKQQVDWSQQLDLNMGKLDVTSSGRLGGNFLVRNAHLSL 2510
            +++LGPSLGV+++ ++  W  +    +  Q L      + +TS GRL G F V NA    
Sbjct: 2524 DVDLGPSLGVISLRTQRTWLATDHYDEKRQLLHAFTDGISLTSEGRLSGLFEVANASWLS 2583

Query: 2511 ELKWPNPKDFFQVPLVCVKLGSDTVDTKLSFDYHTFFISSLKQGYASLFNERDEDGSLAD 2570
            E+KW   K     PLV   L  D +  K +FDYH F I ++   +  L NE+D  G L D
Sbjct: 2584 EVKWSPEKGKNTHPLVSTSLNIDDMAIKAAFDYHMFLIGTINNIHFQLHNEKDAKGVLPD 2643

Query: 2571 LLSVTVSFESVNIFLTALAAANISDIKNSITRLKKDNELSYLSSFLASDQ-PSDEPEEDG 2629
            LL V+ S + + +  TAL AANI DI N+I R+++DN++SY+ +   S+   S +P    
Sbjct: 2644 LLQVSFSSDEIILSSTALVAANILDIYNTIVRMRQDNKISYMETLRDSNPGESRQPVLYK 2703

Query: 2630 GIFDXXXXXXXXXXXXXGVFRLQISPTSLFDSDVLILTATKMMANTGIQADIKIKTDLHW 2689
             I                  ++QISP SLFD +VL++   K+   +   +  K+KTDL  
Sbjct: 2704 DILRSLKLLRTDLSVSISSLKVQISPISLFDVEVLVVRIDKVSIRSETHSGKKLKTDLQL 2763

Query: 2690 QLDDVSLALLPFNNSLDESYLATMEVGKYIELSSTIQGGAIFSAPSIVVNMTTWQEPQSN 2749
            Q+ DVS AL      LDE   A++ +  Y+  +S I GG I   P + V+MTT QE ++N
Sbjct: 2764 QVLDVSAALSTSKEELDEEVGASIAIDDYMHYASKIVGGTIIDIPKLAVHMTTLQEEKTN 2823

Query: 2750 VIELLYSTSFGGTVKIRWNLGPISFIKDMWQAHMNAMQLREGYYHGLAESGVAVTPLNSK 2809
             +E L++ SF   + +RWNLGP++FIK+MW  H+ A+ +R         S +A       
Sbjct: 2824 NLEYLFACSFSDKISVRWNLGPVNFIKEMWTTHVKALAVR--------RSQIANISFGQT 2875

Query: 2810 AVPLEMHL-----GSDYQYLPLQEPDIEMPRIKDLGDATPPIEWFGVNRTKFPGFTHQFV 2864
               LE  +      S + Y+ L+EP IE+P+I+DLGDATPP+EWFGVNR +FP FTHQ  
Sbjct: 2876 EEELEESINKEETASKFNYIALEEPQIEVPQIRDLGDATPPMEWFGVNRKRFPKFTHQTA 2935

Query: 2865 IVPLQKLARTAEKEYEKIL 2883
            ++P+QKL   AEK+Y KIL
Sbjct: 2936 VIPVQKLVYLAEKQYVKIL 2954

>Skud_12.155 Chr12 complement(290039..298918) [8880 bp, 2959 aa] {ON}
            YLR087C (REAL)
          Length = 2959

 Score =  822 bits (2124), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 485/1511 (32%), Positives = 772/1511 (51%), Gaps = 96/1511 (6%)

Query: 6    IFYVGRVLGYIVSKAANLVLWKQYRVTVSIQSLVFSPLAGKVHFKNVSVTSQDQLISVLK 65
            IFY+GR+  Y+V+     +LWK+  + +++++L  S L G++HFK++SV  +D  ISVL+
Sbjct: 37   IFYMGRIYAYLVTFILEWLLWKRANIKINVETLRVSLLGGRIHFKHLSVIHKDYTISVLE 96

Query: 66   GTITWRYWL--------IGRYRRSGTADGARRCRFALKFEGFEYFVYNRNGVYDRIAREL 117
            G++TW+YWL        I   + S + +    C+F+L+ EG E F+YNR   YD +   L
Sbjct: 97   GSLTWKYWLLNCRKAELIENNKDSLSKNVKLPCKFSLECEGLEIFIYNRTVAYDNVINLL 156

Query: 118  ----------------------DGE--DXXXXXXXXXXXXXXXIAELQDD---------- 143
                                  DG   D                A + +D          
Sbjct: 157  SKDERDKFEKYLNEHSFPESFSDGSSADKLDEDLSESAYTTNSDASIINDRDYQETDIGK 216

Query: 144  -PLIRRFLPVEFLHNKGAIVLGNKQTHSVAIMNYEKLAGTVSIEVPDDTRAPSSFRTEAK 202
             P   +FLP+E   N+G+++LGNK T SV I++YE   G + +  P +       +T+ +
Sbjct: 217  LPKFLKFLPIELKFNRGSLLLGNKFTPSVMILSYENGEGVIDVLPPKERLDLYRNKTQME 276

Query: 203  ISNCTVAIKPNISYEVDNPVKIYVEPKRTARLWKKYKTLLGTVLEATLHAKRKKEQHQTP 262
              N  ++IK NI Y+    +K  ++  + ++LWK +  +L  V +  +  K KK+   + 
Sbjct: 277  FKNFEISIKQNIGYDDAIGLKFKLDTGKVSKLWKTFVRVLRIVTKPIISKKNKKKTGPSD 336

Query: 263  -KWYDNWRGLSMYDV---NXXXXXXXXVKFDIEHHEYAKCTTVLKADQMDVTYSYGMPGT 318
              ++  W+GLS+Y     +        ++FD  +HEYAK T++LK  ++ + Y   + G 
Sbjct: 337  DSFFQKWKGLSLYKAAPGDAKPSDLDDIEFDFTNHEYAKFTSILKCPKLTIAYDVDVSGF 396

Query: 319  ARVTDSDNAENPLLERPEL-------DHSVDILVYDANCTYGPWANRQVQQCLRVFSPTV 371
              V    +   P ++ P++       D ++D+ ++  +  YGPWA RQV    RV SP V
Sbjct: 397  --VPHGAHPTIPDIDGPDVGNNGAPPDFALDVQIHGGSICYGPWAQRQVSHLQRVLSPVV 454

Query: 372  CRNFKLRTPEEIAQQTEPAAFKLSVTIMEDSVLRVPMKESSKDAAFLEKYKQTRDETRPF 431
             R  K         +     F+++V IMED+  R+P +E+SKDA FL+ YK+T +E RPF
Sbjct: 455  SRTSKPVKKLPPGSRRIYTLFRMNVLIMEDTTWRIPTRETSKDAEFLQHYKETSEEYRPF 514

Query: 432  GWIDIRIAKESNITVRMAAYPTENGFENILHANLVDTTISTSVNHDTLLKAKSHDITVDF 491
            GW+D+R  K++     +   PT  GF+N  H + V+T I +SVNHD LLK+K  ++  D 
Sbjct: 515  GWMDLRFCKDTYANFNVVLCPTVEGFQNNFHVHFVETEIRSSVNHDILLKSKVFNLDGDI 574

Query: 492  SYPYGWQDKAEWNFNVCSTQAELFVLRDHVYLISDLVTDFSGGEEVLYEQFRPFDYRFRW 551
             YP GW  KA W  N+ S Q E F+LR+H+ L++D ++DFS GE   YE FRPF Y+  W
Sbjct: 575  GYPLGWNSKAIWIINMKSQQLEAFLLREHITLVADTLSDFSAGEPTPYELFRPFVYKVNW 634

Query: 552  DIRGYSAYLNVNDANIINNPIDFGENCYLSVHGDDAEITFSLPITSIIQKYVTVDFNIFT 611
            ++ GYS YLNVND NI+NNP+DF ENCYLS+HGD   I  ++P  SI+  Y  + + I T
Sbjct: 635  EMEGYSIYLNVNDHNIVNNPLDFNENCYLSLHGDRLYIDITVPRESILGTYTDISYEIST 694

Query: 612  PHFSLFLNAPPWHTFSELLHYKEIGRSKNFNIKGSYTSYSEVDVDNVDALNIACETDYIV 671
            P F + LN PPW+T +E + +KE+GR+ +F +KGSY  YSE+D+DNVD L I C ++  V
Sbjct: 695  PMFRMMLNTPPWNTLNEFMKHKEVGRAYDFTVKGSYLLYSELDIDNVDTLVIECTSNSTV 754

Query: 672  VLCYGVILKCMLNVKVNYFGEMVHFRTTEEYVEELQRRNKQNPSTCRPFNSDGNVHDSDV 731
            + CYG +++ + NVK+NYFGE  +F T+EEY   L  R      T        +  DS  
Sbjct: 755  LHCYGFVMRYLTNVKMNYFGEFFNFVTSEEYTGVLGAREVGEIITKSSVLDLASTLDS-- 812

Query: 732  VATESNEIIDASFDAFGGPPTIKKSALKRSINELDVWFTFISKGGCFFFPENIYKFDACL 791
               +++ + + S D       +K+S LKR+ NE D+WFTF    G    PE IY  D C+
Sbjct: 813  -GYQNSSLKNESEDK----DPVKRSDLKRTTNETDIWFTFSVWNGALILPETIYSLDPCI 867

Query: 792  GFYFDNLEASLRFLNYYVDAAVSLDSIYFKRHTDIDARTLFKVIEDIGIPIDASDAYLSQ 851
              +F  L    R  NYY+D    L+    KRH       +F  I       +     LS 
Sbjct: 868  ALHFTELVVDFRSCNYYMDIMAVLNGTSIKRHVSKPINEVFDFIRRNNGANEQEHGTLSD 927

Query: 852  FSFRLHKMLGIMPSEESYACEFDVRVDTLDVHCDLAVLKAFVNTLRNLAFGFKDVENSLQ 911
             +   H+M G+ P+E +Y C++D+ +  L +  D+  +K F N+   + FG+ D+EN L 
Sbjct: 928  LTIHGHRMFGLPPTEPTYFCQWDINLGDLTIDSDIEFIKGFFNSFYKIGFGYNDLENILL 987

Query: 912  YEREQVFDLNKISCVIENVTVKLQN-VDKDEDIWLSLNLPVTTLTSFDLANERYSRRSDL 970
            Y+ E V D+  ++   E + +   + V K + +  + +L  T +   D  NERYS+R D+
Sbjct: 988  YDTETVDDMTSLTVHAERIKISFNDPVMKSQSVVTAESLLFTLI---DFENERYSQRIDV 1044

Query: 971  SIPELLFGI--YRGDSESTCLGAFSTGVTVTLFERFEQFARCRVLQRKHILVNDAPFHRC 1028
             IP+L+  +    GD   T    F T +  T FE+++   + R  QR++I  +D+P+HRC
Sbjct: 1045 KIPKLIISLSCVMGDGVDTSFLKFETKLRFTNFEQYKDIDKKRSEQRRYITAHDSPYHRC 1104

Query: 1029 SFMLPPEYKKMPIYRSLYGCXXXXXXXXXXXXXXXADNFEVIFEKLLGEI---------Y 1079
             F+LP  Y+    Y+ LYG                 D  + I E ++GE          +
Sbjct: 1105 PFLLPLFYQDSDTYQKLYGAIAPSSSIPTLPLPTLPDTIDFIIEDIVGEYATLLETTNPF 1164

Query: 1080 QEYASDSSYQITDDSISSTEHDYHNQTVNAAIGTSSSLFIRSQNHQQTLSSFIVEFDPID 1139
            ++  +++   +     SSTE D  N      +      F   +NHQ+   +++++   I 
Sbjct: 1165 KDIFAETPSTVEPSRASSTEDD--NDERADPLEFKPIAFTEGRNHQR--GNYVIDVSYIL 1220

Query: 1140 GYLDLSATEFMLEIYKYLTEVSLDEAIDSLEIGIINQFIQTFGEDNGIS--EVRVLCPNI 1197
              +D     F   + K      + + +D +EIGI+ Q          IS  +V +   N+
Sbjct: 1221 LDVDPLLFVFTKSLLKEFYSEDMVQVLDDIEIGIVKQLSNLQEGITSISNIDVHIAYMNL 1280

Query: 1198 SLSATNKQSKFSMFKLSSKIKNLDITSRIKSSDPNLKPDPEKTTLCYKIDYIRANIVQDG 1257
                T ++  F ++     +  +D     KS + N      +     +I  +R  + Q  
Sbjct: 1281 IWQETGEEG-FELY-----LDRIDYQMSEKSLEKNRTSKLLEVATLARIKTVRVTVNQKR 1334

Query: 1258 IVVPPKQPSQLFSCSIELLEGYLSYDKLSLLDNNVQSCSVTLSPGTDKLLFEFLNPFIST 1317
                 +      S  +E  E + S +   +   N+ S  +T+     + LFE+ +     
Sbjct: 1335 NPDLSEDRPPALSLGLEGFEVWSSTEDRQVNSLNLTSSDITIDESQMEWLFEYCS---DQ 1391

Query: 1318 FDLLQRELSSF---EDTLLASKREFLLNILRGGRDYEIQHDPPVITKPANITRFSNRHIR 1374
             +L+Q  L+SF   + T ++SK E +  +      Y+I HDP VITKPA I R S  H+R
Sbjct: 1392 GNLIQEALNSFHSIQSTRISSKTELISKLTAASEYYQISHDPYVITKPAFIMRLSKGHVR 1451

Query: 1375 SAESWRIIMRLRHILNYLPQEWHQSFTRHLGTQDFTSPEEAGKEFLSIFSDWRSWEPTDV 1434
               SW+II RLRHIL YLP +W  +  + L  + +TS ++A   F+S+FS WR+WE +DV
Sbjct: 1452 ENRSWKIITRLRHILTYLPDDWQDNIEKVLKERKYTSAKDAKNIFMSVFSTWRNWEFSDV 1511

Query: 1435 QGSFVHEKVFT 1445
              S+++ K+F+
Sbjct: 1512 ARSYIYGKLFS 1522

 Score =  546 bits (1408), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 390/1273 (30%), Positives = 627/1273 (49%), Gaps = 73/1273 (5%)

Query: 1645 IDWKARKFHIDSSSATTKDLT------ESLPYVRDEIKYLVEALVPELFAEPPIERESS- 1697
            I+ +    H  + S T + +T      ES+  ++D IK+           +P  ++ S  
Sbjct: 1722 INNQCADLHFRAMSTTEQTVTVITEIRESVLKIKDRIKF-----------KPKSKKRSQF 1770

Query: 1698 -GNKIHAVLFQGQVANITLKLQILSPFIILYCAENFEL--QAESTDSVIFDLNSGESYME 1754
             G KI+ VL     +N++ ++  LSPF I + A+  ++      ++ V+  +   + +M 
Sbjct: 1771 VGPKINIVL-SCYFSNVSSEIMPLSPFYIRHEAKQLDIYFNKFGSNEVLLSIWDTDFFM- 1828

Query: 1755 ISSAKQKLDYFKYTHTCLKLSGTSSSARLFEHISCDIGI--LKLSVFDLKTRITDLLQDI 1812
             +S + K  Y +++   +++ G  S    +  I+ DI I  +KL+  + +  +   LQD 
Sbjct: 1829 -TSHQTKEQYLRFSFGDIEIKGGISKED-YSLINVDISISMIKLTFSEPRRIVNSFLQDE 1886

Query: 1813 KAALFSMKSLSDILNISQSS--PTASAFGSWFSILPDNLSLQATYAGLLLGFGHTLYILE 1870
            K A   +  LS + ++  +S  P      +   ++   L    TY G+L+    T ++ E
Sbjct: 1887 KLASQGINLLSSLKSLLFTSGLPKKKKKKAPARMINWTLDTSITYFGILVPVASTYFVFE 1946

Query: 1871 FNNF--EAKHTRDG-LPDAITPRPCFKVDHSIESASFLIKDRRIDDRLAKVVDFAVNFNM 1927
             +       +T +G LP+       F    SIE+  FLIK+R +   L+K++DF++  + 
Sbjct: 1947 LHMLLLSLTNTNNGMLPEEAKVTGQF----SIENILFLIKERSLPIGLSKLLDFSIKVST 2002

Query: 1928 VHDTDLCIQSVQIESTHLKITLAPMTVVRLLSLINEFGIIRKQFTEESIYTPSSAHNNST 1987
            +  T    QS Q+ES+H ++ L+P +++RL+   ++   +   ++    + P+       
Sbjct: 2003 LQRTVDTEQSFQVESSHFRVCLSPDSLLRLMWGAHKLLDLGHYYSRR--HAPNIWDIKMF 2060

Query: 1988 ATECLEPSVWRLIIKSGHILSHDFSIVWLFDIPNSSADGLICGYDRLFSVYEKPYGKLTL 2047
              +  +P    +  +S HILS+ F I WLF     S  GL+ GY+RLFS YEK +GK T+
Sbjct: 2061 TGKSDKPKEIPINFRSIHILSYKFCIGWLFQYGAGSDPGLMLGYNRLFSAYEKDFGKFTV 2120

Query: 2048 LNAYFSAAKILASEADFYSSVVRKQRINTSYLSDMQLRYWFTEDSENTDLFIRIHGAKLA 2107
            ++A+FS A    S + F+S    K + N S+L +MQ+ YWF    E  D F R HG  L 
Sbjct: 2121 VDAFFSVANGNKS-STFFSEGNEKDKYNRSFLPNMQISYWFKRCGELKDWFFRFHGEALD 2179

Query: 2108 VDISAEIVTLLEETIQSIQTFNNLKKALVDPFRTKKQDSDISKEPY------NWNNQLAT 2161
            V+     + +++ T+QS++ F  LKK ++D       + D    PY      + +N LA 
Sbjct: 2180 VNFVPSFMDVIDSTLQSVRAFQELKKNILDVSEDSHMEDD---NPYATSSMESASNSLAP 2236

Query: 2162 ---GVRSLNCIINYAGVTLKLHSHDG-RGDASP-LELTSPSYKVAIDYKYFPNLEKTHRF 2216
                +RS+N    Y G   +++++D     + P  E+ SP   +   YK+  N  K HR 
Sbjct: 2237 FLDNIRSVNSNFKYDGGVFRVYTYDDIEAKSEPSFEIKSPVVTINCTYKHNENEAKPHRI 2296

Query: 2217 RTLITATPTHNTFYSTSAFLIHDLCYRFXXXXXXXXXXXXXXXXXXXXXIKVEGSDNSTL 2276
            R LI   PT NT Y+  A L+ +    F                        +  D   L
Sbjct: 2297 RILIAVDPTLNTLYAGCAPLLME----FSESLQKMIKKHSTDDKPSFTKPSSQNVDYKRL 2352

Query: 2277 LGSIDLVIILNVGKQEVTFSCEPKAKVQATVGXXXXXXXXXXXXXXXXXSLCLAIEIENL 2336
            L   D+ + L   KQ+++ SCEPKAKVQA VG                  L  ++ ++  
Sbjct: 2353 LDQFDVAVKLTSAKQQLSLSCEPKAKVQADVGFESFLFSMTTNEFDSEQPLEFSLTLQQT 2412

Query: 2337 MTNSRHIYSREVCASLKLRHISMVFDIMGSQVRRIYGSTLISSPLFYFNMKQLQDLKLFI 2396
              + RHI+SREV  S ++  + +        V  +YG++L+S    +FN+KQLQ+L LF+
Sbjct: 2413 KASIRHIFSREVSTSFEVGFMDLTLLFTHPDVISMYGTSLVSDLSVFFNVKQLQNLYLFL 2472

Query: 2397 DQWFPQKTPMNTGSYPEGVLVDDISRXXXXXXXXXXXXXXXXXXXXVIVAGSCAEIELGP 2456
            D W  + + +      +G +  +I                      +I      +++LGP
Sbjct: 2473 DIW--RFSSILHTRPVQGSISKEIDMSSLTSTNYVDVGAEIPWCFTLIFTNVSGDVDLGP 2530

Query: 2457 SLGVLNVTSEDVWAISKQQVDWSQQLDLNMGKLDVTSSGRLGGNFLVRNAHLSLELKWPN 2516
            SLGV+++ ++  W  +    +  Q L      + +TS GRL G F V NA    E+KW  
Sbjct: 2531 SLGVISLRTQRTWLATDHYSEKRQLLHAFTDGVSLTSEGRLSGLFEVANASWISEVKWSL 2590

Query: 2517 PKDFFQVPLVCVKLGSDTVDTKLSFDYHTFFISSLKQGYASLFNERDEDGSLADLLSVTV 2576
             K     PLV   L  D V  K +FDYH F I ++      L NE+D  G L DLL V+ 
Sbjct: 2591 EKSKNSHPLVSTSLNIDDVAVKAAFDYHMFLIGTINNIQFQLHNEKDAKGILPDLLQVSF 2650

Query: 2577 SFESVNIFLTALAAANISDIKNSITRLKKDNELSYLSSFLASDQ-PSDEPEEDGGIFDXX 2635
            S + + +  TAL AANI DI N+I R+++DN++SY+ +   S+   S +P     I    
Sbjct: 2651 SSDEITLSSTALVAANILDIYNTIVRMRQDNKISYMETLRDSNPGESKQPILYKDILRSL 2710

Query: 2636 XXXXXXXXXXXGVFRLQISPTSLFDSDVLILTATKMMANTGIQADIKIKTDLHWQLDDVS 2695
                          ++QISP SLFD +VL++    +   +   +  K+KTDL  Q+ DVS
Sbjct: 2711 KLLRTDLSLNISSLKVQISPISLFDVEVLVVRIKNVSIRSETHSGKKLKTDLQLQVLDVS 2770

Query: 2696 LALLPFNNSLDESYLATMEVGKYIELSSTIQGGAIFSAPSIVVNMTTWQEPQSNVIELLY 2755
             AL      LDE   A++ +  YI  +S I GG I   P + V+MTT QE ++N IE L+
Sbjct: 2771 AALSTSKEELDEEIGASIAIDDYIHYASKIVGGTIIDIPKLAVHMTTLQEEKTNNIEYLF 2830

Query: 2756 STSFGGTVKIRWNLGPISFIKDMWQAHMNAMQLREGYYHGLAESGVAVTPLNSKAVPLEM 2815
            + SF   + ++WNLGP++FIK+MW  H+ A+ +R        +S +A          LE 
Sbjct: 2831 ACSFSDKISVKWNLGPVNFIKEMWTTHVKALAVR--------QSQIANVSFGQTEEELEE 2882

Query: 2816 HLG-----SDYQYLPLQEPDIEMPRIKDLGDATPPIEWFGVNRTKFPGFTHQFVIVPLQK 2870
             +      S + Y+ L+EP I++P+I+DLGDATPP+EWFGVNR +FP FTHQ  ++P+QK
Sbjct: 2883 SIKTKETTSKFNYIALEEPQIQVPQIRDLGDATPPMEWFGVNRKRFPKFTHQTAVIPVQK 2942

Query: 2871 LARTAEKEYEKIL 2883
            L   AEK+Y KIL
Sbjct: 2943 LVYLAEKQYVKIL 2955

>YLR087C Chr12 complement(306855..315731) [8877 bp, 2958 aa] {ON}
            CSF1Protein required for fermentation at low temperature;
            the authentic, non-tagged protein is detected in highly
            purified mitochondria in high-throughput studies
          Length = 2958

 Score =  815 bits (2105), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 483/1520 (31%), Positives = 783/1520 (51%), Gaps = 104/1520 (6%)

Query: 6    IFYVGRVLGYIVSKAANLVLWKQYRVTVSIQSLVFSPLAGKVHFKNVSVTSQDQLISVLK 65
            IFY+GR+  Y+VS     +LWK+ ++ +++++L  S L G++HFKN+SV  +D  ISVL+
Sbjct: 37   IFYMGRIYAYLVSFILEWLLWKRAKIKINVETLRVSLLGGRIHFKNLSVIHKDYTISVLE 96

Query: 66   GTITWRYWLIGRYR-------RSGTADGAR-RCRFALKFEGFEYFVYNRNGVYDRIAREL 117
            G++TW+YWL+   +       +S +   A+  C+ +++ EG E F+YNR   YD +   L
Sbjct: 97   GSLTWKYWLLNCRKAELIENNKSSSGKKAKLPCKISVECEGLEIFIYNRTVAYDNVINLL 156

Query: 118  ----------------------DGE--DXXXXXXXXXXXXXXXIAELQDD---------- 143
                                  DG   D                A + +D          
Sbjct: 157  SKDERDKFEKYLNEHSFPEPFSDGSSADKLDEDLSESAYTTNSDASIVNDRDYQETDIGK 216

Query: 144  -PLIRRFLPVEFLHNKGAIVLGNKQTHSVAIMNYEKLAGTVSIEVPDDTRAPSSFRTEAK 202
             P +  FLP+E   ++G+++LGNK T SV I++YE   G + +  P +       +T+ +
Sbjct: 217  HPKLLMFLPIELKFSRGSLLLGNKFTPSVMILSYESGKGIIDVLPPKERLDLYRNKTQME 276

Query: 203  ISNCTVAIKPNISYEVDNPVKIYVEPKRTARLWKKYKTLLGTVLEATLHAKRKKEQHQTP 262
              N  ++IK NI Y+    +K  ++  + ++LWK +  +   V +  +  K KK    + 
Sbjct: 277  FKNFEISIKQNIGYDDAIGLKFKIDRGKVSKLWKTFVRVFQIVTKPVVPKKTKKSAGTSD 336

Query: 263  -KWYDNWRGLSMYDV---NXXXXXXXXVKFDIEHHEYAKCTTVLKADQMDVTYSYGMPGT 318
              +Y  W+GLS+Y     +        V+FD+ +HEYAK T++LK  ++ + Y   +PG 
Sbjct: 337  DNFYHKWKGLSLYKASAGDAKASDLDDVEFDLTNHEYAKFTSILKCPKVTIAYDVDVPGV 396

Query: 319  ARVTDSDNAENPLLERPEL-------DHSVDILVYDANCTYGPWANRQVQQCLRVFSPTV 371
              V    +   P ++ P++       D ++D+ ++  +  YGPWA RQV    RV SP V
Sbjct: 397  --VPHGAHPTIPDIDGPDVGNNGAPPDFALDVQIHGGSICYGPWAQRQVSHLQRVLSPVV 454

Query: 372  CRNFKLRTPEEIAQQTEPAAFKLSVTIMEDSVLRVPMKESSKDAAFLEKYKQTRDETRPF 431
             R  K         +     F+++++IMED+  R+P +ESSKD  FL+ YK+T +E RPF
Sbjct: 455  SRTAKPIKKLPPGSRRIYTLFRMNISIMEDTTWRIPTRESSKDPEFLKHYKETNEEYRPF 514

Query: 432  GWIDIRIAKESNITVRMAAYPTENGFENILHANLVDTTISTSVNHDTLLKAKSHDITVDF 491
            GW+D+R  K++     ++  PT  GF+N  H + ++T I +SVNHD LLK+K  DI  D 
Sbjct: 515  GWMDLRFCKDTYANFNISVCPTVQGFQNNFHVHFLETEIRSSVNHDILLKSKVFDIDGDI 574

Query: 492  SYPYGWQDKAEWNFNVCSTQAELFVLRDHVYLISDLVTDFSGGEEVLYEQFRPFDYRFRW 551
             YP GW  KA W  N+ S Q E F+LR+H+ L++D ++DFS G+   YE FRPF Y+  W
Sbjct: 575  GYPLGWNSKAIWIINMKSEQLEAFLLREHITLVADTLSDFSAGDPTPYELFRPFVYKVNW 634

Query: 552  DIRGYSAYLNVNDANIINNPIDFGENCYLSVHGDDAEITFSLPITSIIQKYVTVDFNIFT 611
            ++ GYS YLNVND NI+NNP+DF ENCYLS+HGD   I  ++P  SI+  Y  + + I T
Sbjct: 635  EMEGYSIYLNVNDHNIVNNPLDFNENCYLSLHGDKLSIDVTVPRESILGTYTDMSYEIST 694

Query: 612  PHFSLFLNAPPWHTFSELLHYKEIGRSKNFNIKGSYTSYSEVDVDNVDALNIACETDYIV 671
            P F + LN PPW+T +E + +KE+GR+ +F IKGSY  YSE+D+DNVD L I C +   V
Sbjct: 695  PMFRMMLNTPPWNTLNEFMKHKEVGRAYDFTIKGSYLLYSELDIDNVDTLVIECNSKSTV 754

Query: 672  VLCYGVILKCMLNVKVNYFGEMVHFRTTEEYVEELQRRNKQNPSTCRPFNSDGNVHDSDV 731
            + CYG +++ + NVK+NYFGE  +F T+EEY   L  R   + +T        +  DS  
Sbjct: 755  LHCYGFVMRYLTNVKMNYFGEFFNFVTSEEYTGVLGAREVGDVTTKSSVADLASTVDS-- 812

Query: 732  VATESNEIIDASFDAFGGPPTIKKSALKRSINELDVWFTFISKGGCFFFPENIYKFDACL 791
               +++ + + S D   GP  +K+S LKR+ NE D+WFTF    G    PE IY FD C+
Sbjct: 813  -GYQNSSLKNESEDK--GP--MKRSDLKRTTNETDIWFTFSVWDGALILPETIYSFDPCI 867

Query: 792  GFYFDNLEASLRFLNYYVDAAVSLDSIYFKRHTDIDARTLFKVIEDIGIPIDASDAYLSQ 851
              +F  L    R  NYY+D    L+    KRH       +F  I       +     LS 
Sbjct: 868  ALHFAELVVDFRSCNYYMDIMAVLNGTSIKRHVSKQINEVFDFIRRNNGADEQEHGLLSD 927

Query: 852  FSFRLHKMLGIMPSEESYACEFDVRVDTLDVHCDLAVLKAFVNTLRNLAFGFKDVENSLQ 911
             +   H+M G+ P+E +Y C++D+ +  L +  D+  +K F N+   + FG+ D+EN L 
Sbjct: 928  LTIHGHRMYGLPPTEPTYFCQWDINLGDLCIDSDIEFIKGFFNSFYKIGFGYNDLENILL 987

Query: 912  YEREQVFDLNKISCVIENVTVKLQN-VDKDEDIWLSLNLPVTTLTSFDLANERYSRRSDL 970
            Y+ E + D+  ++  +E + + L++ V K + +   ++      T  D  NE+YS+R D+
Sbjct: 988  YDTETINDMTSLTVHVEKIRIGLKDPVMKSQSV---ISAESILFTLIDFENEKYSQRIDV 1044

Query: 971  SIPELLFGI--YRGDSESTCLGAFSTGVTVTLFERFEQFARCRVLQRKHILVNDAPFHRC 1028
             IP+L   +    GD   T    F T +  T FE+++   + R  QR++I ++D+P+HRC
Sbjct: 1045 KIPKLTISLNCVMGDGVDTSFLKFETKLRFTNFEQYKDIDKKRSEQRRYITIHDSPYHRC 1104

Query: 1029 SFMLPPEYKKMPIYRSLYGCXXXXXXXXXXXXXXXADNFEVIFEKLLGEI---------Y 1079
             F+LP  Y+    Y++LYG                 D  + I E ++GE          +
Sbjct: 1105 PFLLPLFYQDSDTYQNLYGAIAPSSSIPTLPLPTLPDTIDYIIEDIVGEYATLLETTNPF 1164

Query: 1080 QEYASDSSYQITDDSISSTEHDYHNQTVNAAIGTSSSLFIRSQNHQQ-----TLSSFIVE 1134
            +   +++   +     S +E D   +   ++    +  F   +NH++      +S  +++
Sbjct: 1165 KNIFAETPSTMEPSRASFSEDDNDEEADPSSFKPVA--FTEDRNHERDNYVVDVSYILLD 1222

Query: 1135 FDPIDGYLDLSATEFMLEIYKYLTEVSLDEAIDSLEIGIINQFIQTFGEDNGISEVRVLC 1194
             DP+   L + A   + ++Y      ++ + +D +EIGI+ +          IS + +  
Sbjct: 1223 VDPL---LFIFAKSLLEQLYSE----NMVQVLDDIEIGIVKRLSNLQEGITSISNIDIHI 1275

Query: 1195 PNISLS-ATNKQSKFSMFKLSSKIKNLDITSRIKSSDPNLKPDPEKTTLCYKIDYIRANI 1253
              ++L      +  F ++     +  +D     KS + N      +     K+  +R  +
Sbjct: 1276 AYLNLIWQETGEEGFELY-----LDRIDYQMSEKSLEKNRTNKLLEVAALAKVKTVRVTV 1330

Query: 1254 VQDGIVVPPKQPSQLFSCSIELLEGYLSYDKLSLLDNNVQSCSVTLSPGTDKLLFEFLNP 1313
             Q       +      S  IE  E + S +   +   N+ S  +T+     + LFE+ + 
Sbjct: 1331 NQKKNPDLSEDRPPALSLGIEGFEVWSSTEDRQVNSLNLTSSDITIDESQMEWLFEYCS- 1389

Query: 1314 FISTFDLLQRELSSF---EDTLLASKREFLLNILRGGRDYEIQHDPPVITKPANITRFSN 1370
                 +L+Q   +SF   ++T   SK E +  +      Y+I HDP VITKPA I R S 
Sbjct: 1390 --DQGNLIQEVCTSFNSIQNTRSNSKTELISKLTAASEYYQISHDPYVITKPAFIMRLSK 1447

Query: 1371 RHIRSAESWRIIMRLRHILNYLPQEWHQSFTRHLGTQDFTSPEEAGKEFLSIFSDWRSWE 1430
             H+R   SW+II RLRHIL YLP +W  +    L  + +TS ++A   F+S+FS WR+WE
Sbjct: 1448 GHVRENRSWKIITRLRHILTYLPDDWQSNIDEVLKEKKYTSAKDAKNIFMSVFSTWRNWE 1507

Query: 1431 PTDVQGSFVHEKVFTKKRSR 1450
             +DV  S+++ K+FT +  +
Sbjct: 1508 FSDVARSYIYGKLFTAENEK 1527

 Score =  550 bits (1416), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 378/1209 (31%), Positives = 603/1209 (49%), Gaps = 53/1209 (4%)

Query: 1700 KIHAVLFQGQVANITLKLQILSPFIILYCAENFELQAESTDSVIFDLNSGESYMEISSAK 1759
            KI+ VL     +N++ ++  LSPF I + A+  ++      S    L+  ++   ++S +
Sbjct: 1774 KINTVL-SCYFSNVSSEVMPLSPFYIRHEAKQLDIYFNKFGSNEILLSIWDTDFFMTSHQ 1832

Query: 1760 QKLDYFKYTHTCLKL-SGTSSSARLFEHISCDIGILKLSVFDLKTRITDLLQDIKAA--- 1815
             K  Y +++   +++  G S       ++   I ++KL+  + +  +   LQD K A   
Sbjct: 1833 TKEQYLRFSFGDIEIKGGISREGYSLINVDISISMIKLTFSEPRRIVNSFLQDEKLASQG 1892

Query: 1816 ---LFSMKSLSDILNISQSSPTA-SAFGSWFSILPDNLSLQATYAGLLLGFGHTLYILEF 1871
               L+S+K L    N+ +    A S   +W       L    TY G+L+    T ++ E 
Sbjct: 1893 INLLYSLKPLFFSSNLPKKEKQAPSIMINW------TLDTSITYFGVLVPVASTYFVFEL 1946

Query: 1872 NNF--EAKHTRDG-LPDAITPRPCFKVDHSIESASFLIKDRRIDDRLAKVVDFAVNFNMV 1928
            +       +T +G LP+       F    SIE+  FLIK+R +   L+K++DF++  + +
Sbjct: 1947 HMLLLSLTNTNNGMLPEETKVTGQF----SIENILFLIKERSLPIGLSKLLDFSIKVSTL 2002

Query: 1929 HDTDLCIQSVQIESTHLKITLAPMTVVRLLSLINEFGIIRKQFTEESIYTPSSAHNNSTA 1988
              T    QS Q+ES+H ++ L+P +++RL+   ++   +   ++    + P+  +     
Sbjct: 2003 QRTVDTEQSFQVESSHFRVCLSPDSLLRLMWGAHKLLDLSHYYSRR--HAPNIWNTKMFT 2060

Query: 1989 TECLEPSVWRLIIKSGHILSHDFSIVWLFDIPNSSADGLICGYDRLFSVYEKPYGKLTLL 2048
             +  +     +  +S HILS+ F I W+F     S  GL+ GY+RLFS YEK +GK T++
Sbjct: 2061 GKSDKSKEMPINFRSIHILSYKFCIGWIFQYGAGSNPGLMLGYNRLFSAYEKDFGKFTVV 2120

Query: 2049 NAYFSAAKILASEADFYSSVVRKQRINTSYLSDMQLRYWFTEDSENTDLFIRIHGAKLAV 2108
            +A+FS A    S + F+S    K + N S+L +MQ+ YWF    E  D F R HG  L V
Sbjct: 2121 DAFFSVANGNTS-STFFSEGNEKDKYNRSFLPNMQISYWFKRCGELKDWFFRFHGEALDV 2179

Query: 2109 DISAEIVTLLEETIQSIQTFNNLKKALVD---PFRTKKQDSDISKEPYNWNNQLAT---G 2162
            +     + ++E T+QS++ F  LKK ++D     R +  +S  S    + ++ LA     
Sbjct: 2180 NFVPSFMDVIESTLQSMRAFQELKKNILDVSESLRAENDNSYASTSVESASSSLAPFLDN 2239

Query: 2163 VRSLNCIINYAGVTLKLHSH-DGRGDASP-LELTSPSYKVAIDYKYFPNLEKTHRFRTLI 2220
            +RS+N    Y G   +++++ D    + P  E+ SP   +   YK+  +  K H+FRTLI
Sbjct: 2240 IRSVNSNFKYDGGVFRVYTYEDIETKSEPSFEIKSPVVTINCTYKHDEDKVKPHKFRTLI 2299

Query: 2221 TATPTHNTFYSTSAFLIHDLCYRFXXXXXXXXXXXXXXXXXXXXXIKVEGSDNSTLLGSI 2280
            T  PTHNT Y+  A L+ +    F                        +  D   LL   
Sbjct: 2300 TVDPTHNTLYAGCAPLLME----FSESLQKMIKKHSTDEKPNFTKPSSQNVDYKRLLDQF 2355

Query: 2281 DLVIILNVGKQEVTFSCEPKAKVQATVGXXXXXXXXXXXXXXXXXSLCLAIEIENLMTNS 2340
            D+ + L   KQ+++ SCEPKAKVQA VG                  L  ++ +E+   + 
Sbjct: 2356 DVAVKLTSAKQQLSLSCEPKAKVQADVGFESFLFSMATNEFDSEQPLEFSLTLEHTKASI 2415

Query: 2341 RHIYSREVCASLKLRHISMVFDIMGSQVRRIYGSTLISSPLFYFNMKQLQDLKLFIDQWF 2400
            +HI+SREV  S ++  + +        V  +YG+ L+S    +FN+KQLQ+L LF+D W 
Sbjct: 2416 KHIFSREVSTSFEVGFMDLTLLFTHPDVISMYGTGLVSDLSVFFNVKQLQNLYLFLDIW- 2474

Query: 2401 PQKTPMNTGSYPEGVLVDDISRXXXXXXXXXXXXXXXXXXXXVIVAGSCAEIELGPSLGV 2460
             + + +      +  +  +I                      +I      +++LGPSLG+
Sbjct: 2475 -RFSSILHTRPVQRTVNKEIEMSSLTSTNYADAGTEIPWCFTLIFTNVSGDVDLGPSLGM 2533

Query: 2461 LNVTSEDVWAISKQQVDWSQQLDLNMGKLDVTSSGRLGGNFLVRNAHLSLELKWPNPKDF 2520
            +++ ++  W  +    +  Q L      + +TS GRL G F V NA    E+KWP  K  
Sbjct: 2534 ISLRTQRTWLATDHYNEKRQLLHAFTDGISLTSEGRLSGLFEVANASWLSEVKWPPEKSK 2593

Query: 2521 FQVPLVCVKLGSDTVDTKLSFDYHTFFISSLKQGYASLFNERDEDGSLADLLSVTVSFES 2580
               PLV   L  D +  K +FDYH F I ++   +  L NE+D  G L DLL V+ S + 
Sbjct: 2594 NTHPLVSTSLNIDDIAVKAAFDYHMFLIGTISNIHFHLHNEKDAKGVLPDLLQVSFSSDE 2653

Query: 2581 VNIFLTALAAANISDIKNSITRLKKDNELSYLSSFLASDQ-PSDEPEEDGGIFDXXXXXX 2639
            + +  TAL  ANI DI N+I R+++DN++SY+ +   S+   S +P     I        
Sbjct: 2654 IILSSTALVVANILDIYNTIVRMRQDNKISYMETLRDSNPGESRQPILYKDILRSLKLLR 2713

Query: 2640 XXXXXXXGVFRLQISPTSLFDSDVLILTATKMMANTGIQADIKIKTDLHWQLDDVSLALL 2699
                      ++QISP SLFD +VL++   K+   +   +  K+KTDL  Q+ DVS AL 
Sbjct: 2714 TDLSVNISSSKVQISPISLFDVEVLVIRIDKVSIRSETHSGKKLKTDLQLQVLDVSAALS 2773

Query: 2700 PFNNSLDESYLATMEVGKYIELSSTIQGGAIFSAPSIVVNMTTWQEPQSNVIELLYSTSF 2759
                 LDE   A++ +  Y+  +S I GG I   P + V+MTT QE ++N +E L++ SF
Sbjct: 2774 TSKEELDEEVGASIAIDDYMHYASKIVGGTIIDIPKLAVHMTTLQEEKTNNLEYLFACSF 2833

Query: 2760 GGTVKIRWNLGPISFIKDMWQAHMNAMQLREGYYHGLAESGVAVTPLNSKAVPLEMHL-- 2817
               + +RWNLGP+ FIK+MW  H+ A+ +R         S VA          LE  +  
Sbjct: 2834 SDKISVRWNLGPVDFIKEMWTTHVKALAVR--------RSQVANISFGQTEEELEESIKK 2885

Query: 2818 ---GSDYQYLPLQEPDIEMPRIKDLGDATPPIEWFGVNRTKFPGFTHQFVIVPLQKLART 2874
                S + Y+ L+EP IE+P+I+DLGDATPP+EWFGVNR KFP FTHQ  ++P+QKL   
Sbjct: 2886 EEAASKFNYIALEEPQIEVPQIRDLGDATPPMEWFGVNRKKFPKFTHQTAVIPVQKLVYL 2945

Query: 2875 AEKEYEKIL 2883
            AEK+Y KIL
Sbjct: 2946 AEKQYVKIL 2954

>Suva_10.171 Chr10 complement(311672..320548) [8877 bp, 2958 aa] {ON}
            YLR087C (REAL)
          Length = 2958

 Score =  813 bits (2099), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 477/1520 (31%), Positives = 777/1520 (51%), Gaps = 103/1520 (6%)

Query: 5    AIFYVGRVLGYIVSKAANLVLWKQYRVTVSIQSLVFSPLAGKVHFKNVSVTSQDQLISVL 64
             IFY+GR+  Y+VS     +LWK+ ++ +++++L  S L G+++FK++SV  +D  IS+L
Sbjct: 36   TIFYMGRIYAYLVSFILEWLLWKRAKIKINVETLRISLLGGRIYFKHLSVIHKDYTISIL 95

Query: 65   KGTITWRYWL--------IGRYRRSGTADGARRCRFALKFEGFEYFVYNRNGVYDRI--- 113
            +G++TW+YWL        I   + S   +    C+F L+ EG EYF+YNR   YD +   
Sbjct: 96   EGSLTWKYWLLNCRKAELIENEKNSSGKNIELPCKFLLECEGLEYFIYNRTLAYDNVINL 155

Query: 114  ---------------------------ARELDGEDXXXXXXXXXXXXXXXIAELQDD--- 143
                                       A +LD +                  + Q+    
Sbjct: 156  LSKDERDKFEKYLNEHSFPEPFSDGSSADKLDEDLSESAYTTNSDSSIINDRDYQETNIG 215

Query: 144  --PLIRRFLPVEFLHNKGAIVLGNKQTHSVAIMNYEKLAGTVSIEVPDDTRAPSSFRTEA 201
              P    F P+E   N+G+++LGNK T SV I++YE   G + +  P +       +T  
Sbjct: 216  KYPKGLSFFPIELKLNRGSLLLGNKFTPSVMILSYENGEGIIDVLPPKERLDLYRNKTHL 275

Query: 202  KISNCTVAIKPNISYEVDNPVKIYVEPKRTARLWKKYKTLLGTVLEATLHAKRKKEQHQT 261
            ++ N  ++IK NI Y+    +K  ++  + ++LWK +  +L  V +  +  + KK     
Sbjct: 276  ELKNFEISIKQNIGYDDAIGLKFKLDTGKVSKLWKTFVRVLRVVTKPVIPRRGKKAGPSD 335

Query: 262  PKWYDNWRGLSMYDV---NXXXXXXXXVKFDIEHHEYAKCTTVLKADQMDVTYSYGMPGT 318
              ++  W+GLS+Y     +        ++FD   HEYAK T++LK  ++ ++Y   +PG 
Sbjct: 336  DAFFQKWKGLSLYKASAGDAKTSDLDDIEFDFTSHEYAKFTSILKCPKVTLSYDVDVPGV 395

Query: 319  ARVTDSDNAENPLLERPEL-------DHSVDILVYDANCTYGPWANRQVQQCLRVFSPTV 371
              V    +   P ++ P++       D ++D+ ++  +  YGPWA RQV    RV SP V
Sbjct: 396  --VPHGAHPTIPDIDGPDVGNNGAPPDFALDVQIHGGSICYGPWAQRQVSHLQRVLSPVV 453

Query: 372  CRNFKLRTPEEIAQQTEPAAFKLSVTIMEDSVLRVPMKESSKDAAFLEKYKQTRDETRPF 431
             R  K         +     F++++ IMED+  R+P +ESSKDA FL+ YK+T +E RPF
Sbjct: 454  SRTAKPIKKLPPGSRRVYTLFRMNILIMEDTTWRIPTRESSKDAEFLQHYKKTSEEYRPF 513

Query: 432  GWIDIRIAKESNITVRMAAYPTENGFENILHANLVDTTISTSVNHDTLLKAKSHDITVDF 491
            GW+D+R  K++     ++  PT  GF+N  H + V+T I +SVNHD LLK+K  D+  D 
Sbjct: 514  GWMDLRFCKDTYANFNISVCPTVEGFKNDFHVHFVETEIRSSVNHDILLKSKVFDLDGDI 573

Query: 492  SYPYGWQDKAEWNFNVCSTQAELFVLRDHVYLISDLVTDFSGGEEVLYEQFRPFDYRFRW 551
             YP GW     W  N+ S Q E F+LR+H+ L++D ++DFS G+   YE FRPF Y+  W
Sbjct: 574  GYPLGWNSNTIWIINMKSEQLEAFLLREHITLVADTLSDFSAGDPTPYELFRPFVYKMNW 633

Query: 552  DIRGYSAYLNVNDANIINNPIDFGENCYLSVHGDDAEITFSLPITSIIQKYVTVDFNIFT 611
            ++ GYS YLNVND NI+NNP+DF ENCYLS+HGD   I  ++P  SI+  Y  + + I T
Sbjct: 634  EMDGYSIYLNVNDHNIVNNPLDFNENCYLSLHGDKLTIDITVPRESILGTYTDMSYEIST 693

Query: 612  PHFSLFLNAPPWHTFSELLHYKEIGRSKNFNIKGSYTSYSEVDVDNVDALNIACETDYIV 671
            P F + LN PPW+T +E + +KE+GRS +F IKG Y  YSE+D+DNVD+L I C ++  V
Sbjct: 694  PMFRMMLNTPPWNTLNEFMKHKEVGRSYDFTIKGCYLLYSELDIDNVDSLTINCTSNSTV 753

Query: 672  VLCYGVILKCMLNVKVNYFGEMVHFRTTEEYVEELQRRNKQNPSTCRPFNSDGNVHDSDV 731
            + CYG +++ ++NVK+NYFGE  +F T+EEY   L  R      T             D+
Sbjct: 754  LHCYGFVMRYLINVKMNYFGEFFNFVTSEEYTGVLGAREVGEVVTKSSV--------VDL 805

Query: 732  VATESNEIIDASF--DAFGGPPTIKKSALKRSINELDVWFTFISKGGCFFFPENIYKFDA 789
             +T  +E  + S   DA    P +K+S LKR+ NE D+WFTF    G    PE IY FD 
Sbjct: 806  ASTLDSEYQNGSMKNDAEDNGP-MKRSDLKRTTNETDIWFTFSVWNGALILPETIYSFDP 864

Query: 790  CLGFYFDNLEASLRFLNYYVDAAVSLDSIYFKRHTDIDARTLFKVIEDIGIPIDASDAYL 849
            C+  +F  L    R  NYY+D    L+    KRH       +F  I       +     L
Sbjct: 865  CIALHFTELVVDFRSCNYYMDIMAVLNGTSIKRHVSKQINEVFDFIRRNNGADEQEHGVL 924

Query: 850  SQFSFRLHKMLGIMPSEESYACEFDVRVDTLDVHCDLAVLKAFVNTLRNLAFGFKDVENS 909
            S  +   H+M G+ P+E +Y C++D+ +  L+++ D+  LK F  +   + FG+ D+EN 
Sbjct: 925  SDLTIHGHRMYGLPPTEPTYFCQWDINLGELNINSDIEFLKGFFTSFYKVGFGYNDLENI 984

Query: 910  LQYEREQVFDLNKISCVIENVTVKLQN-VDKDEDIWLSLNLPVTTLTSFDLANERYSRRS 968
            L Y+ E + D+  ++   E + + L + V K + I   +++     T  D  NERYS+R 
Sbjct: 985  LLYDTETINDMTSLTVHAERINISLNDPVMKSQSI---VSVESLLFTLIDFENERYSQRI 1041

Query: 969  DLSIPELLFGI--YRGDSESTCLGAFSTGVTVTLFERFEQFARCRVLQRKHILVNDAPFH 1026
            D+ +P+L   +    GD  +T    F T +  T F +++   + R  QR++I++ND+P+H
Sbjct: 1042 DIKVPKLTVSLSCVMGDGTNTSFLNFETKLRFTNFGQYKDSDKKRSEQRRYIMMNDSPYH 1101

Query: 1027 RCSFMLPPEYKKMPIYRSLYGCXXXXXXXXXXXXXXXADNFEVIFEKLLGEI-------- 1078
            RC F+LP  Y+    Y+ LYG                 D  + I E ++GE         
Sbjct: 1102 RCPFLLPLFYQDSDTYQKLYGAIAPSSSIPTLPLPTLPDTIDYIIEDIVGEYATLLEATN 1161

Query: 1079 -YQEYASDSSYQITDDSISSTEHDYHNQTVNAAIGTSSSLFIRSQNHQQ-----TLSSFI 1132
             +++  +++   +     S TE D  ++     +      F    NH++      +S  +
Sbjct: 1162 PFKDLFAETPSTVEPLRASFTEDD--DEEAADPLEFKPVAFTEEINHERDNYVIDVSYIL 1219

Query: 1133 VEFDPIDGYLDLSATEFMLEIYKYLTEVSLDEAIDSLEIGIINQFIQTFGEDNGIS--EV 1190
            ++ DP    L    T+ +LE  ++ +E  + + +D +EIGI+ +          IS  ++
Sbjct: 1220 LDIDP----LLFVFTKSLLE--QFYSE-DMVQVLDDIEIGIVKRLSNLQEGIVSISNIDI 1272

Query: 1191 RVLCPNISLSATNKQSKFSMFKLSSKIKNLDITSRIKSSDPNLKPDPEKTTLCYKIDYIR 1250
             V   N+    T ++  F ++     +  ++     KS + N      +  +  K+  +R
Sbjct: 1273 HVAYLNLIWQETGEEG-FELY-----LDRINYQMSEKSLEKNRTSKSLEVAVLAKVKTVR 1326

Query: 1251 ANIVQDGIVVPPKQPSQLFSCSIELLEGYLSYDKLSLLDNNVQSCSVTLSPGTDKLLFEF 1310
            A + Q       +      S  +E  E + S +   +   N+ S  +T+     + LFE+
Sbjct: 1327 ATVNQKKNPELSEDRPPALSLGLEGFEVWSSTEDRQVNSLNLTSSDITIDESQMEWLFEY 1386

Query: 1311 LNPFISTFDLLQRELSSFEDTLLASKREFLLNILRGGRDYEIQHDPPVITKPANITRFSN 1370
             +   +    +   ++S ++T  ++K E +  +      Y+I HDP VITKPA I R S 
Sbjct: 1387 CSDQGNLIQEVFTSVNSIQNTRSSTKTELISKLTAASEYYQISHDPYVITKPAFIMRLSK 1446

Query: 1371 RHIRSAESWRIIMRLRHILNYLPQEWHQSFTRHLGTQDFTSPEEAGKEFLSIFSDWRSWE 1430
             H+R   SW+II RLRHIL YLP +W  +  + L  + ++  ++A   F+S+FS WR+WE
Sbjct: 1447 GHVRENRSWKIITRLRHILTYLPDDWQTNIDKVLKERKYSFAKDAKNIFMSVFSTWRNWE 1506

Query: 1431 PTDVQGSFVHEKVFTKKRSR 1450
             +DV  S+++ K+F    ++
Sbjct: 1507 FSDVARSYIYGKLFLADHAK 1526

 Score =  560 bits (1444), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 388/1255 (30%), Positives = 621/1255 (49%), Gaps = 72/1255 (5%)

Query: 1665 TESLPYVRDEIKYLVEALVPELFAEPPIERESS--GNKIHAVLFQGQVANITLKLQILSP 1722
            TE +     EIK  V  +  ++  +P  + +S   G++I+ VL     +N++ ++  LSP
Sbjct: 1736 TEQMVNAITEIKESVLKVKEQIKFKPKSKNKSQFVGSRINTVL-SCYFSNVSSEIMPLSP 1794

Query: 1723 FIILYCAENFELQAESTDSVIFDLNSGESYMEISSAKQKLDYFKYTHTCLKLSGT-SSSA 1781
            F I + A+  ++      S    L+  ++   ++S + K  Y +++   +++ G  S  A
Sbjct: 1795 FYIRHEAKQLDIYFNKFGSNEILLSIWDTDFFMTSHQTKEQYLRFSFGDIEIKGGFSKEA 1854

Query: 1782 RLFEHISCDIGILKLSVFDLKTRITDLLQDIKAA---------LFSMKSLSDILNISQSS 1832
                ++   I ++KL+  + +  +   LQD K A         L S+   +D +N  + +
Sbjct: 1855 YSLINVDISISMIKLTFSEPRRIVNSFLQDEKLASQGINLLSSLNSLFLTTDPMNAKKET 1914

Query: 1833 PTASAFGSWFSILPDNLSLQATYAGLLLGFGHTLYILEFNNF--EAKHTRDGLPDAITPR 1890
            P  +   +W       L    +Y G+L+    T ++ E +       +T +GL   +  +
Sbjct: 1915 P--AKMINW------TLDTNISYFGILVPVASTYFVFELHMLLLSLTNTNNGL---LPEQ 1963

Query: 1891 PCFKVDHSIESASFLIKDRRIDDRLAKVVDFAVNFNMVHDTDLCIQSVQIESTHLKITLA 1950
                   SIE+  FLIK+R +   L+K++DF++  + +  T    QS Q+ES+H ++ L+
Sbjct: 1964 TRLTGQLSIENILFLIKERSLPIGLSKLLDFSIKVSTLQRTADTEQSFQVESSHFRVCLS 2023

Query: 1951 PMTVVRLLSLINEFGIIRKQFTEESIYTPSSAHNNSTATECLEPSVWRLIIKSGHILSHD 2010
            P +++RL+    +   + + +++   + P+  +      +  +P    +  +S HILS+ 
Sbjct: 2024 PDSLLRLIWGAYKLLDMVQYYSKR--HAPNIWNIRMFTGKSDKPKEIPINFRSIHILSYK 2081

Query: 2011 FSIVWLFDIPNSSADGLICGYDRLFSVYEKPYGKLTLLNAYFSAAKILASEADFYSSVVR 2070
            F I WLF        GL+ GY+RLFS YEK +GK T+++A+FS +    S + F+S    
Sbjct: 2082 FCIGWLFQYGAGDDPGLMFGYNRLFSAYEKDFGKFTIVDAFFSVSNGNTS-STFFSEGNE 2140

Query: 2071 KQRINTSYLSDMQLRYWFTEDSENTDLFIRIHGAKLAVDISAEIVTLLEETIQSIQTFNN 2130
            K++ N S+L +MQ+ YWF    E  D F R HG  L V+     + +++ T+QSI+ F  
Sbjct: 2141 KEKYNRSFLPNMQISYWFKRCGELKDWFFRFHGEALDVNFLPSFMDVIDSTLQSIRAFQE 2200

Query: 2131 LKKALVD-PFRTKKQDS--DISKEPYNWNNQLAT---GVRSLNCIINYAGVTLKLHSHDG 2184
            LKK ++D P  +  ++S  D +    N +N LA     +RS+NC   Y G   +++++D 
Sbjct: 2201 LKKNILDMPHESNMENSSPDAAPNTENASNSLAPFLDNIRSVNCNFKYDGGVFRVYTYDD 2260

Query: 2185 -RGDASP-LELTSPSYKVAIDYKYFPNLEKTHRFRTLITATPTHNTFYSTSAFLIHDLCY 2242
                + P  EL SP   +   YK+  +  K HR RTLIT  PTHNT Y+  A L+ +   
Sbjct: 2261 IEAKSEPSFELKSPVVTINCTYKHDESKAKPHRIRTLITVDPTHNTLYAGCAPLLMEFSE 2320

Query: 2243 RFXXXXXXXXXXXXXXXXXXXXXIKVEGSDNSTLLGSIDLVIILNVGKQEVTFSCEPKAK 2302
                                     V   D   LL   D+ + L   KQ+++ SCEPKAK
Sbjct: 2321 SLQNMIKKHSTGEKKPNFTKPSTQNV---DYKRLLDQFDVAVKLTSAKQQLSLSCEPKAK 2377

Query: 2303 VQATVGXXXXXXXXXXXXXXXXXSLCLAIEIENLMTNSRHIYSREVCASLKLRHISMVFD 2362
            VQA VG                  L  ++ +E    + +HI+SREV  S ++  + +   
Sbjct: 2378 VQADVGFESFLFSMTTNEFDSEQPLGFSLTLEQTKASIKHIFSREVSTSFEVGFMDLTLL 2437

Query: 2363 IMGSQVRRIYGSTLISSPLFYFNMKQLQDLKLFIDQWF--------PQKTPMNTGSYPEG 2414
                 V  +YG++L+S    +FN+KQLQ+L LF+D W         P + P N       
Sbjct: 2438 FTHPDVISMYGTSLVSDVSVFFNVKQLQNLYLFLDIWRFSSILHTRPTQRPNNK------ 2491

Query: 2415 VLVDDISRXXXXXXXXXXXXXXXXXXXXVIVAGSCAEIELGPSLGVLNVTSEDVWAISKQ 2474
                +++                     +I      +++LGPSLGV+++ S+  W  +  
Sbjct: 2492 ----EVNMSTLSSNSNVDVGTEIPWCFTLIFTNLSGDVDLGPSLGVISLRSQRTWLATDH 2547

Query: 2475 QVDWSQQLDLNMGKLDVTSSGRLGGNFLVRNAHLSLELKWPNPKDFFQVPLVCVKLGSDT 2534
              +  Q L      + +TS GRL G F V NA    E+KWP        PLV   L  D 
Sbjct: 2548 YDEKRQLLHAFTDGISLTSEGRLSGLFEVANASWVSEVKWPLENSKNTHPLVSTSLNIDD 2607

Query: 2535 VDTKLSFDYHTFFISSLKQGYASLFNERDEDGSLADLLSVTVSFESVNIFLTALAAANIS 2594
            V  K +FDYH F I ++      L NE+D  G L DLL V+ S + + +  TAL AANI 
Sbjct: 2608 VAVKAAFDYHMFLIGTINNIRFHLHNEKDSKGILPDLLQVSFSSDEITLSSTALVAANIL 2667

Query: 2595 DIKNSITRLKKDNELSYLSSFLASD-QPSDEPEEDGGIFDXXXXXXXXXXXXXGVFRLQI 2653
            DI N+I R+++DN++SY+ +   S+   S +P     I                  ++QI
Sbjct: 2668 DIYNTIVRMRQDNKISYMETLRDSNPSESKQPILYKDILRSLKLLRTDLSVNISSLKVQI 2727

Query: 2654 SPTSLFDSDVLILTATKMMANTGIQADIKIKTDLHWQLDDVSLALLPFNNSLDESYLATM 2713
            SP SLFD +VL++   K+   +   +  K+KTDL  Q+ DVS AL      LDE   A++
Sbjct: 2728 SPISLFDVEVLVVRIDKVSIRSETHSGKKLKTDLQLQVLDVSAALSTSKEELDEEIGASI 2787

Query: 2714 EVGKYIELSSTIQGGAIFSAPSIVVNMTTWQEPQSNVIELLYSTSFGGTVKIRWNLGPIS 2773
             +  Y+  +S I GG I   P + V+MTT QE ++N +E L++ SF   + +RWNLGPI+
Sbjct: 2788 AIDDYMHYASKIVGGTIIDIPKLAVHMTTLQEEKTNNLEYLFACSFSDKISVRWNLGPIN 2847

Query: 2774 FIKDMWQAHMNAMQLREGYYHGLAESGVAVTPLNSKAVPLEMHL-----GSDYQYLPLQE 2828
            FIK+MW  H+ A+ +R         S  A          LE  +      S + Y+ L+E
Sbjct: 2848 FIKEMWTTHVKALAVR--------RSQTANISFGQTEEELEESIKREENASKFNYIALEE 2899

Query: 2829 PDIEMPRIKDLGDATPPIEWFGVNRTKFPGFTHQFVIVPLQKLARTAEKEYEKIL 2883
            P IE+P+I+DLG+ATPP+EWFGVNR + P FTHQ  ++P+QKL   AEK+Y KIL
Sbjct: 2900 PQIEVPQIRDLGEATPPMEWFGVNRKRLPKFTHQTAVIPVQKLVYLAEKQYVKIL 2954

>CAGL0L12210g Chr12 complement(1315265..1324210) [8946 bp, 2981 aa]
            {ON} similar to uniprot|Q12150 Saccharomyces cerevisiae
            YLR087c
          Length = 2981

 Score =  813 bits (2099), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 500/1547 (32%), Positives = 776/1547 (50%), Gaps = 148/1547 (9%)

Query: 1    MVIFAIFYVGRVLGYIVSKAANLVLWKQYRVTVSIQSLVFSPLAGKVHFKNVSVTSQDQL 60
            + +  +FY+ R   Y V+     +LWKQ +V VSI +L  S LAG+V FKN+++  +D+ 
Sbjct: 35   LTLATLFYLSRAFAYGVTFILEWLLWKQAKVKVSIGALRISLLAGRVFFKNLTIIDKDRT 94

Query: 61   ISVLKGTITWRYWLI----GRYR----------RSGTADGARR--------------CRF 92
            I++L+G+ITWRYWLI      YR           SG ++   +              CRF
Sbjct: 95   ITILEGSITWRYWLIRTRKSEYRVAQMAHASAGSSGNSEDDTKFDIANYMEKQLKLPCRF 154

Query: 93   ALKFEGFEYFVYNRNGVYDRIARELDG----------------------------EDXXX 124
              + EGFE F+YNR   YD I   L                              E+   
Sbjct: 155  LFECEGFEMFIYNRTYAYDNIVNVLSKVEREKFEKFMAENDFLDPSSDGSSDDKIEETSS 214

Query: 125  XXXXXXXXXXXXIAELQDD-----PLIRRFLPVEFLHNKGAIVLGNKQTHSVAIMNYEKL 179
                            Q+D     P     LP+E L NKG+I++GNK T  V I+++E  
Sbjct: 215  ATNSTDEETIANDRTFQNDTRKTLPRYLEALPIEALLNKGSILIGNKFTPCVLILSFES- 273

Query: 180  AGTVSIEVPDDTRAPSSF-----RTEAKISNCTVAIKPNISYEVDNPVKIYVEPKRTARL 234
                ++ + D   APS       + E ++ N  + +K NI Y+ +       +  + +RL
Sbjct: 274  ----AVALQDVGEAPSKLDLYRMKYEVRLKNLEIMMKQNIDYDNEKSRNFEFDKGKLSRL 329

Query: 235  WKKYKTLLGTVLEATLHAKRKKEQHQTPKWYDNWRGLSMY--DVNXXXXXXXXVKFDIEH 292
            W ++  +   V       +RK++ H    +   W+GLSMY  D+         ++FDI  
Sbjct: 330  WHRFTRIFKLVPFPFKSNRRKEQPHDN--FMQKWKGLSMYRNDMFGEFDEFDDIEFDISS 387

Query: 293  HEYAKCTTVLKADQMDVTYSYGMPGTARVTDSDNAENPLLERPELDHSV-------DILV 345
            HEYAK T++LK+ ++ + + Y MPG   V    +  +   + P++ +++       +I +
Sbjct: 388  HEYAKFTSLLKSPRVTIHHDYDMPGW--VPHGAHPPSSYADGPDVGNNMAPPQYIFEINI 445

Query: 346  YDANCTYGPWANRQVQQCLRVFSPTVCRNFKLRTPEEIAQQTEPAAFKLSVTIMEDSVLR 405
            +     YGPWA RQ      + SP+V R  K     +   +      KL++  MED   R
Sbjct: 446  FGGTVCYGPWAQRQTNHLQSLLSPSVSRTAKPIKKLKPGSKRIYTVLKLTINAMEDVTWR 505

Query: 406  VPMKESSKDAAFLEKYKQTRDETRPFGWIDIRIAKESNITVRMAAYPTENGFENILHANL 465
            +P +ESSKD  FL  YK+T D+ RPFGWIDI+++++S     +A  PT  GF+N +   L
Sbjct: 506  IPTRESSKDVEFLMHYKETNDDYRPFGWIDIKVSRDSCGIFDLAMCPTSKGFKNTIDVQL 565

Query: 466  VDTTISTSVNHDTLLKAKSHDITVDFSYPYGWQDKAEWNFNVCSTQAELFVLRDHVYLIS 525
            VDT I +SVNHD  LK+KS     D  YP GW  +A W   + S Q ELF+LR+HV LI+
Sbjct: 566  VDTEIRSSVNHDIFLKSKSFSFNCDIGYPLGWNAEANWTIIMDSNQLELFLLREHVTLIA 625

Query: 526  DLVTDFSGGEEVLYEQFRPFDYRFRWDIRGYSAYLNVNDANIINNPIDFGENCYLSVHGD 585
            D +TDFS GE V YE FRPF Y  +W+++GYS YLNVND NI+NNP+DF ENCYLS+HGD
Sbjct: 626  DTLTDFSSGEPVPYELFRPFVYHIKWNMKGYSFYLNVNDHNIVNNPLDFNENCYLSIHGD 685

Query: 586  DAEITFSLPITSIIQKYVTVDFNIFTPHFSLFLNAPPWHTFSELLHYKEIGRSKNFNIKG 645
            D  +   +P  +I  ++  + ++I+TP F L LN PPW+T +E +  KE+GRS +F +KG
Sbjct: 686  DLTMNVMVPKKTITSRFTNMTYDIYTPMFRLLLNTPPWNTLNEFMRNKEVGRSHDFRLKG 745

Query: 646  SYTSYSEVDVDNVDALNIACETDYIVVLCYGVILKCMLNVKVNYFGEMVHFRTTEEYVEE 705
            SY  YSE+D+DNVD L + C +    +  YG +++ ++NVK+NYFGE  HF T+EEY   
Sbjct: 746  SYLIYSELDIDNVDTLTVECSSRGTALHIYGFVIRYLINVKMNYFGEFFHFVTSEEYT-- 803

Query: 706  LQRRNKQNPSTCRPFNSDGNVHDSDVVATESNEIIDASFDAF------------GGP--- 750
                              GN   +D+    S +  D  F ++              P   
Sbjct: 804  ------------------GNTRPTDLENIISEDRRDDDFSSYESVSRISSNSSDKNPKAK 845

Query: 751  --PTIKKSALKRSINELDVWFTFISKGGCFFFPENIYKFDACLGFYFDNLEASLRFLNYY 808
               ++KKS LKR+ NE D+WFTF    G    PE IY  D C+  +F  L   LR  NYY
Sbjct: 846  KKHSLKKSDLKRTSNETDIWFTFSVWDGALILPETIYNADPCIALHFAELIVDLRSCNYY 905

Query: 809  VDAAVSLDSIYFKRHTDIDARTLFKVIEDIGIPIDASDAYLSQFSFRLHKMLGIMPSEES 868
            +D   +   I  KR+    A  +++ +             LS      H+M G+ P+E +
Sbjct: 906  MDILATACDINLKRYVGKRADEIYEYVHLNNGKDHEVHGTLSDIYIHGHRMYGLPPTEPT 965

Query: 869  YACEFDVRVDTLDVHCDLAVLKAFVNTLRNLAFGFKDVENSLQYEREQVFDLNKISCVIE 928
            Y C++D+    L++  ++  L+        + FG+KD+EN L YE E + D+  ++  I 
Sbjct: 966  YFCQWDMDFGHLNIDSNMFFLQGLFGAFYKIGFGYKDLENILLYETEIIDDMTSLTIFIN 1025

Query: 929  NVTVKLQNVDKDEDIWLSLNLPVTTLTSFDLANERYSRRSDLSIPELLFGIYRGDSESTC 988
             + ++L +VD      L L     TL  F+  NERYS+R D+ IP L F I+  +     
Sbjct: 1026 TIDIRLNDVDTTAHADLKLERFCFTLIDFE--NERYSKRMDIKIPSLEFNIFSNEDNDLS 1083

Query: 989  LGAFSTGVTVTLFERFEQFARCRVLQRKHILVNDAPFHRCSFMLPPEYKKMPIYRSLYGC 1048
            L  F   +  T F + + F + R +QR +I++NDAP+HRC+F+LP  Y+K  IY  L+G 
Sbjct: 1084 LLNFKVDMNFTNFVQNQDFNKHRKIQRDYIVLNDAPYHRCAFLLPESYQKSRIYNELFGA 1143

Query: 1049 XXXXXXXXXXXXXXXADNFEVIFEKLLGEIYQEYASDSSYQITDDSISSTEHDYHNQTVN 1108
                           AD  E + E LL +    +  + +Y I + S+ + E      T  
Sbjct: 1144 IAPSSSLPPLPIPLTADTIEYVLEDLLEDYMGLF--EGNYDIKESSVENLELSAIEAT-R 1200

Query: 1109 AAIGTSSSLFIRSQNHQQTLSSFIVEFDP---------IDGYLDLSATEFMLEIYKYLTE 1159
            A  G  +    R+ ++  TLS + VE D          ID    L  T  + ++ K++ +
Sbjct: 1201 AITGIGAE---RTHSNPITLSDYAVESDNYVVKVESIVIDINPALYTT--IEKLLKHIYD 1255

Query: 1160 VSLDEAIDSLEIGIINQFIQTFGEDNGISEVRVLCPNISLSATNKQS-KFSMFKLSSKIK 1218
                + ID +EIGI+ +          ++ V+V   + +L    K+S   SMF       
Sbjct: 1256 QDAVQIIDGIEIGIVKRLSSIHDGVTTMTNVKVQIKHFNLFWGEKESDNVSMF-----FD 1310

Query: 1219 NLDITSRIKSSDPNLKPDPEKTTLCYKIDYIRANIVQDGIVVPPKQPSQLFSCSIELLEG 1278
             +D     K+ + N + +  + T+  KI  +R  +VQ   ++P ++     +  +E  E 
Sbjct: 1311 KMDFALTEKTLEQNSEKNLLEMTVLAKIKAVRLTVVQQPGLIPTQERPPAITVGVEGFEF 1370

Query: 1279 YLSYDKLSLLDNNVQSCSVTLSPGTDKLLFEFLNPFISTF-DLLQRELSSFEDTLLASKR 1337
            + +  +  +   +V S  +T+     +  F+++      F D+LQ   +  ++  + S++
Sbjct: 1371 WSTAIEKQVNSISVSSADITVDDAQVEWFFKYIVRQKYFFLDMLQ-SYNRIQNNRIESQK 1429

Query: 1338 EFLLNILRGGRDYEIQHDPPVITKPANITRFSNRHIRSAESWRIIMRLRHILNYLPQEWH 1397
            E +  +      Y+I HDP VITKPA I R S  H+R  +SW+II RLRHIL YLP++W+
Sbjct: 1430 ELISRLTAASEYYQISHDPYVITKPAFIMRLSRGHVRENKSWKIITRLRHILTYLPKDWY 1489

Query: 1398 QSFTRHLGTQDFTSPEEAGKEFLSIFSDWRSWEPTDVQGSFVHEKVF 1444
             +  + L  + F   ++A   F+SIFS+WRSWE +DV  S+++ K+F
Sbjct: 1490 LNVGQPLRDRKFDPSQDARSIFMSIFSNWRSWEFSDVARSYIYGKLF 1536

 Score =  538 bits (1385), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 382/1275 (29%), Positives = 624/1275 (48%), Gaps = 64/1275 (5%)

Query: 1643 YSIDWKARKFHIDSSSATTKDLTESLPYVRDEIKYLVEALVPE--LFAEPPIERESSGNK 1700
            Y I  K+   H   + A T+ L E++  ++ +I  + E L  E  L   P +   +  N 
Sbjct: 1739 YLIHSKSSSIHF-RTMAKTERLVEAIKDIKLKIDQISEQLELERRLTQHPTVYDPNKSNV 1797

Query: 1701 IHAVLFQGQVANITLKLQILSPFIILYCAE--NFELQAESTDSVIFDLNSGESYMEISSA 1758
            I + LF    +N+++ +  +SPF +   A+  +F      +DS +  L   + ++     
Sbjct: 1798 IASCLF----SNVSMDIMPVSPFALKNSAKQIDFFYNKFDSDSWLIKLKDTDFFLTSDQT 1853

Query: 1759 KQKLDYFKYTHTCLKLSGTSSSARLFEHISCDIGILKLSVFDLKTRITDLLQDIKAA--- 1815
            K++          ++++ +SS  +L + I+    ++KL+  + K  +   L+D + A   
Sbjct: 1854 KEQYMRLSMKKLQIRVNVSSSKPKLVD-INLSTNLVKLTFSEPKNIVYSFLKDERVASES 1912

Query: 1816 ---LFSMKSLSDILNISQSSPTASAFGSWFSILPDNLSLQATYAGLLLGFGHTLYILEFN 1872
               L ++K L  I +  +S+P +    + +     +L     Y G+L+    T Y++EF+
Sbjct: 1913 VHLLQTLKPLFSISDDKESTPQSYQEKTEYLW---SLDSSIDYFGILIPMTSTYYVMEFH 1969

Query: 1873 NFEAK-HTRDGLPDA---ITPRPCFKVDHSIESASFLIKDRRIDDRLAKVVDFAVNFNMV 1928
            ++ +     +G P     IT         S+E+  FLIK+  + D L+KV+D AVN + +
Sbjct: 1970 SYVSSISNANGAPSGNLDITGH------MSVENILFLIKESSLPDGLSKVIDIAVNVSTL 2023

Query: 1929 HDTDLCIQSVQIESTHLKITLAPMTVVRLLSLINEFGIIRKQFTE-------ESIYTPSS 1981
               D   +S+Q+ES+H +I L+P +++RLL   N+   + + + +       +S      
Sbjct: 2024 QRVDDNSRSIQVESSHARICLSPDSLLRLLWGFNQGHKLSEHYLKYHSKSLWQSFAKSDD 2083

Query: 1982 AHNNSTATECLEPSVWRLIIKSGHILSHDFSIVWLFDIPNSSADGLICGYDRLFSVYEKP 2041
               ++ + +  E S +   I S H LS++  + WLF+       GLI GY RLFS YE  
Sbjct: 2084 KQQDTNSIKSNETSFFS-SINSIHFLSYNLCVGWLFEYELGPPKGLITGYSRLFSAYENC 2142

Query: 2042 YGKLTLLNAYFSAAKILASEADFYSSVVRKQRINTSYLSDMQLRYWFTEDSENTDLFIRI 2101
             GKLT++++YF+AA+   S + FY     K+  N  YL +MQ+ +W+       D+++R 
Sbjct: 2143 MGKLTVIDSYFAAAQGNTS-STFYPETNVKELFNRFYLPNMQILFWWKVIEGMKDVYVRF 2201

Query: 2102 HGAKLAVDISAEIVTLLEETIQSIQTFNNLKKALVDPFRTKKQDSDISKE--PYNWNNQL 2159
             G  L V   ++ +  +E T+ SI+ F  LKK L+    T K++    KE  P N +N +
Sbjct: 2202 TGETLDVKYLSDFMLTIESTLHSIKMFQKLKKELI--VETPKREVVHIKEDKPVNSSNNI 2259

Query: 2160 ATGVRSLNCIINYAGVTLKLHS-HDGRGDASP-LELTSPSYKVAIDYKYFPNLEKTHRFR 2217
               ++S+NC   Y G T  + +  DG  + +P +E+ SP   V + YK+     K H  R
Sbjct: 2260 LKNIKSVNCHFKYDGGTYSVFNISDGSLNPTPAIEIKSPVISVDVLYKHEKQNTKHHSIR 2319

Query: 2218 TLITATPTHNTFYSTSAFLIHDLCYRFXXXXXXXXXXXXXXXXXXXXXIKVEGSDNSTLL 2277
             L+   PTHN  Y+T A L+ +                            V+  D   LL
Sbjct: 2320 CLVNIDPTHNVLYATCAPLVKNFV---EDVRSIFGRYESENKHSETTPTSVQNIDYEKLL 2376

Query: 2278 GSIDLVIILNVGKQEVTFSCEPKAKVQATVGXXXXXXXXXXXXXXXXXSLCLAIEIENLM 2337
               DL I +   KQ+++ SCEPKAKVQA VG                  L  +  I++  
Sbjct: 2377 EDYDLAITVTSAKQQLSLSCEPKAKVQADVGFEALTVSMTTNPFDIDEPLAFSFSIKDTK 2436

Query: 2338 TNSRHIYSREVCASLKLRHISMVFDIMGSQVRRIYGSTLISSPLFYFNMKQLQDLKLFID 2397
             + +H++SRE   S  + ++ +      +     YG++LIS    YFN+KQLQ+L LF+D
Sbjct: 2437 ASIKHLFSRETSTSFGVGYLDLTLLFTHTNRINTYGTSLISDIDLYFNVKQLQNLYLFLD 2496

Query: 2398 QWFPQKTPMNTGSYPEGVLVDDISRXXXXXXXXXXXXXXXXXXXXVIVAGSCAEIELGPS 2457
             W   +      S  E V+  D  +                      V G   +I+LGPS
Sbjct: 2497 IWQLSELLNPVTSSQEQVIRKDKKKSVDKPIHNESQLPWCFTLIFTNVKG---DIDLGPS 2553

Query: 2458 LGVLNVTSEDVWAISKQQVDWSQQLDLNMGKLDVTSSGRLGGNFLVRNAHLSLELKWPNP 2517
            LG++++     W  +       Q L   +  L + S GRL G   +  A    E+ W   
Sbjct: 2554 LGLISLRLSRTWLATDHFSGKRQILHAFVDDLLLISEGRLSGVVNIDGASWVSEVIWLQD 2613

Query: 2518 KDFFQVPLVCVKLGSDTVDTKLSFDYHTFFISSLKQGYASLFNERDEDGSLADLLSVTVS 2577
                 +PLV + L +D ++ K +FDYH F I ++      L +ERD  G   DLL V+ S
Sbjct: 2614 SKRDNIPLVALSLNTDKIEIKAAFDYHMFLIGTVNNILFQLHSERDMVGVAPDLLKVSFS 2673

Query: 2578 FESVNIFLTALAAANISDIKNSITRLKKDNELSYLSSFLASDQPSDEPE-EDGGIFDXXX 2636
             E + +  TAL AANI DI N+I R+++D ++SY+ +   S+  +++       I     
Sbjct: 2674 CEEIKLCSTALVAANILDIYNTIIRMRQDTKISYIETLKDSNMETNKQTLAYRDILKSLQ 2733

Query: 2637 XXXXXXXXXXGVFRLQISPTSLFDSDVLILTATKMMANTGIQADIKIKTDLHWQLDDVSL 2696
                         +LQISP SLFD +V+++    + A +   ++ K+ T L+ ++ D +L
Sbjct: 2734 LLRTDLTVSICSLQLQISPISLFDVEVVVINVVSVSARSETHSEAKLTTSLNMEVYDATL 2793

Query: 2697 ALLPFNNSLDESYLATMEVGKYIELSSTIQGGAIFSAPSIVVNMTTWQEPQSNVIELLYS 2756
            +L      LDE  L+ + V  Y+  +S I+GG I   P + V MTTWQE +S+++E LYS
Sbjct: 2794 SLSTAKQELDEDALSKITVADYMTYASKIRGGTIIEIPRMGVQMTTWQEEKSDILEYLYS 2853

Query: 2757 TSFGGTVKIRWNLGPISFIKDMWQAHMNAMQLREGYYHGLAESGVAVTPLNSKAVPLEMH 2816
              F   V +RWNLGP++F+K+MW  H+ A+ +R         S V     N     +E  
Sbjct: 2854 CKFHDKVAVRWNLGPVNFMKEMWTTHVKAIAVR--------RSQVLTGSFNVSEKDVEKR 2905

Query: 2817 LGSD-----YQYLPLQEPDIEMPRIKDLGDATPPIEWFGVNRTKFPGFTHQFVIVPLQKL 2871
            +  +       Y+P++EP I+MP+IKDLGDATPP+EWFGVNR +FP FTHQ  +VP+Q L
Sbjct: 2906 IKEEENITKLNYVPVEEPQIDMPQIKDLGDATPPVEWFGVNRKRFPAFTHQTAVVPVQNL 2965

Query: 2872 ARTAEKEYEKILGRA 2886
               A+K+Y K LGR+
Sbjct: 2966 VYLAQKQYAKTLGRS 2980

>Kwal_56.23810 s56 (712732..721023) [8292 bp, 2763 aa] {OFF} YLR087C
            (CSF1) -  [contig 172] PARTIAL
          Length = 2763

 Score =  789 bits (2038), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 455/1342 (33%), Positives = 717/1342 (53%), Gaps = 84/1342 (6%)

Query: 144  PLIRRFLPVEFLHNKGAIVLGNKQTHSVAIMNYEKLAGTVSIEVPDDTRAPSSFRTEAKI 203
            P   R LP+E+   KGA+++GNK+T SV + ++EKL G +    PD        + ++ I
Sbjct: 23   PSFLRLLPLEYSVQKGALIIGNKKTSSVMVSSFEKLKGHLDACAPDTKIDLYKIKLQSDI 82

Query: 204  SNCTVAIKPNISYEVDNPVKIYVEPKRTARLWKKYKTLLGTVLEATLHAKRKKEQHQTP- 262
            +   ++++PN+ Y+ D P+K   +  R  +L  KY      V +  L    K E  +   
Sbjct: 83   TKFQMSLRPNLCYDNDEPLKNLPKANRLPKLLHKYYETFLRVRKRYLSRGSKTESTRKDL 142

Query: 263  -KWYDNWRGLSMYDVNXXXXXXXXVKFDIEHHEYAKCTTVLKADQMDVTYSYGMPGTARV 321
                + WRGL +Y             F++  HEYA+ + V+K + M + YS+  PG    
Sbjct: 143  RNPLERWRGLGLYWKENDPAWDDVFHFELPKHEYARYSKVMKCEHMLIEYSHDTPGVV-- 200

Query: 322  TDSDNAENPLLE---RPEL-------DHSVDILVYDANCTYGPWANRQVQQCLRVFSPTV 371
                +   P LE    P++       D S+DI V+ AN  YGPWA+ ++    +VFSP V
Sbjct: 201  ---PHGAFPTLEPLDGPDVGNGGAPPDFSLDIQVFGANIHYGPWAHHEIMPIQKVFSPVV 257

Query: 372  CRNFKLRTPEEIAQQTEPAAF---KLSVTIMEDSVLRVPMKESSKDAAFLEKYKQTRDET 428
             R+     P E         F   ++S+ IM DS+ R+P +E SKD  FL++YK+T D+T
Sbjct: 258  SRD---SHPTERLSAGSTRVFTRLRISIMIMSDSIWRIPTREPSKDLDFLKRYKETEDDT 314

Query: 429  RPFGWIDIRIAKESNITVRMAAYPTENGFENILHANLVDTTISTSVNHDTLLKAKSHDIT 488
            RPFGW+++ +A+ S + + +A  PT  GF+N L  + +   I TSVNHD LL A++HDI 
Sbjct: 315  RPFGWLELSLAEGSEVRLNIAMCPTSTGFDNKLDLHFIKPEIRTSVNHDILLSAETHDIE 374

Query: 489  VDFSYPYGWQDKAEWNFNVCSTQAELFVLRDHVYLISDLVTDFSGGEEVLYEQFRPFDYR 548
                YP GW  KA+WNF++ S QA +F+L+DH+ L+ D+++DF  G+   Y+ FRPF Y 
Sbjct: 375  AQIGYPLGWNAKAKWNFDLKSHQARMFILKDHITLLGDILSDFGTGDPTPYDLFRPFIYE 434

Query: 549  FRWDIRGYSAYLNVNDANIINNPIDFGENCYLSVHGDDAEITFSLPITSIIQKYVTVDFN 608
            F W++ GYS YLNVNDANI+NNP+DF ENCYLS HGDD  I+F +P  SI     T+D+N
Sbjct: 435  FNWELTGYSMYLNVNDANIVNNPVDFNENCYLSFHGDDLRISFRVPQDSIAGNSTTIDYN 494

Query: 609  IFTPHFSLFLNAPPWHTFSELLHYKEIGRSKNFNIKGSYTSYSEVDVDNVDALNIACETD 668
            ++TP F L +N P W+T  E +  KE+GR+ +F++ GSY  +S++DV+N+D + I C++ 
Sbjct: 495  LYTPLFRLNMNTPSWNTLHEFMKDKEVGRACDFSLAGSYLFHSKLDVENIDTIIIECKSR 554

Query: 669  YIVVLCYGVILKCMLNVKVNYFGEMVHFRTTEEYVEELQRRNKQNPSTCRPFNSDGNVHD 728
               + CYG +++ ++ VK+NYFG+ VHF+TTEEY+EEL R     P      NS+ + + 
Sbjct: 555  MTTLKCYGYVVRFLVGVKMNYFGDFVHFKTTEEYMEEL-RDAYVEPKA----NSEQSANS 609

Query: 729  SD-VVATESNEIIDASFDAFGGPPTIKKSALKRSINELDVWFTFISKGGCFFFPENIYKF 787
            ++   A E  +  +A  +    P   KK +LKR +NE DVWFTFI + GC   P+N+Y  
Sbjct: 610  TETTTAGEGEDKQNAPKNHTTDPVMAKKLSLKRMVNEKDVWFTFIVEDGCLILPKNLYDC 669

Query: 788  DACLGFYFDNLEASLRFLNYYVDAAVSLDSIYFKRHTDIDARTLFKVIEDIGIPIDASDA 847
            +AC  F FD+L+  LR++NYY+D   +L  +  +  +D D   LF   E    P  A+  
Sbjct: 670  NACFAFEFDSLDIDLRYINYYMDLQAALSPVIVRNLSDCDPAHLFSGSEG-RCPSRANFG 728

Query: 848  YLSQFSFRLHKMLGIMPSEESYACEFDVRVDTLDVHCDLAVLKAFVNTLRNLAFGFKDVE 907
             +S      H+M G+ P EE+Y C++D  +  LD+  DL+ + +F +    LAF FKD E
Sbjct: 729  SISDLHIHAHRMFGLPPDEETYFCKWDFSMGVLDISSDLSCILSFGDAWSKLAFSFKDYE 788

Query: 908  NSLQYEREQVFDLNKISCVIENVTVKLQNVDKDEDIWLSLNLPVTTLTSFDLANERYSRR 967
            N + Y+   + D+  I      + VK+ +V    D ++ + +   T    D  NERYS R
Sbjct: 789  NIMNYKIVPILDMTSIIFHAGEIRVKINDVAV--DYYIIVEVENVTARGVDFENERYSSR 846

Query: 968  SDLSIPELLFGIYRGDSESTCLGAFSTGVTVTLFERFEQFARCRVLQRKHILVNDAPFHR 1027
            +D+ I  +   +  G  + + +G FS+ + +T F + + F    + Q+ HI  NDAPFHR
Sbjct: 847  ADVDIHSITVQVKEGGKDGSLIGDFSSSLKITKFCQLKNFLVHSMQQKSHIATNDAPFHR 906

Query: 1028 CSFMLPPEYKKMPIYRSLYGCXXXXXXXXXXXXXXXADNFEVIFEKLL-GE--------- 1077
            CSF+LP   ++   YR L G                 +N  +I ++ L GE         
Sbjct: 907  CSFLLPLAIQRSDNYRKLLGSIVPGVSIPGMVEPITPENVTMILDEFLKGEKNSLQMGNE 966

Query: 1078 --IYQEYASDSSYQITDDSISSTEHDYHNQTVNAAIGTSSSLFIRSQNHQQTLSSFIVEF 1135
                ++     ++      +SSTE+D + +        S SL ++    Q ++S+  ++ 
Sbjct: 967  HFCSKKEEDGYAFNFASGLMSSTENDSNVE--------SESLVVKLIKPQASISACCIK- 1017

Query: 1136 DPIDGYLDLSATEFMLEIYKYLTEVSLDEAIDSLEIGIINQFIQTFGEDNGISEVRVLCP 1195
             P   + D + + F            +++ IDS EI ++  FI+T  +      V+V  P
Sbjct: 1018 -PFRSFSDQAYSNF------------VEQLIDSNEIEVVLHFIETTLKRKQCKNVKVFSP 1064

Query: 1196 NISLSATNKQSKFSMFKLSSKIKNLDITSRIKSSDPNLKPDP-----EKTTL-----CYK 1245
               ++ +N    F    +S     +DI  +  S D +++ +P     EK+T+       K
Sbjct: 1065 TFEMTLSN----FGSDNISQTSDTVDIVIKEISVDISMREEPSPNSSEKSTVQDITALVK 1120

Query: 1246 IDYIR---ANIVQDGIVVPPKQPSQLFSCSIELLEGYLSYDKLSLLDNNVQSCSVTLSPG 1302
            ++ +    +N  ++G +    +  QL S SI+ LE +++ + +     N  S    +   
Sbjct: 1121 VESLALCVSNTSRNGPLENIHE-DQLCSTSIKDLEFWMTSEDIRKSSFNATSIDTWVHSD 1179

Query: 1303 TDKLLFEFLNPFISTFDLLQRELSSFEDTLLASKREFLLNILRGGRDYEIQHDPPVITKP 1362
              +L   FL    +  D +   +S  ++ L  ++R+F   I     +Y+I HDPPVITKP
Sbjct: 1180 KTELCCIFLKNTAANIDTITEVVSVHKERLQKAQRDFFYRISTASDEYQIIHDPPVITKP 1239

Query: 1363 ANITRFSNRHIRSAESWRIIMRLRHILNYLPQEWHQSFTRHLGTQDFTSPEEAGKEFLSI 1422
            A ITR  N+H+R  +SW+II RLRHILNYLP          L +  F +P  AG+ FL+I
Sbjct: 1240 AYITRLPNQHVRENKSWKIITRLRHILNYLPPSLLAEIYGALKSASFEAPTNAGEIFLNI 1299

Query: 1423 FSDWRSWEPTDVQGSFVHEKVF 1444
            FS WRSWE +DV+  +++ K F
Sbjct: 1300 FSKWRSWESSDVEQCYMYRKAF 1321

 Score =  597 bits (1540), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 401/1204 (33%), Positives = 616/1204 (51%), Gaps = 45/1204 (3%)

Query: 1704 VLFQGQVANITLKLQILSPFIILYCAENFELQAESTDSVIFDLNSGESYMEISSAKQKLD 1763
            V F+  V + T ++  LSP  I    +   +Q E   +    L      +++ S      
Sbjct: 1584 VAFEAHVDDFTSEISALSPLSISKRFKGLTVQFEKEANSSLRLKVENFDLDLLSEMTAQQ 1643

Query: 1764 YFKYTHTCLKLSGT--SSSARLFEHISCDIGILKLSVFDLKTRITDLLQDIKAALFSMKS 1821
            Y K + + ++L+        ++   +  +  + K  + D +  I  L QD+  A  +++ 
Sbjct: 1644 YLKVSQSQVELTAKIHDKIEKVASKMQLESALTKFKLCDPREIIETLTQDLVNAKQNLEQ 1703

Query: 1822 LS-DILNISQSSPTASAFGSWFS--ILPDNL--SLQATYAGLLLGFGHTLYILEFNNFEA 1876
            L   +L +     T S     F+  + P      L   Y GLL+  G T YI E N   +
Sbjct: 1704 LKIHLLALGALFGTDSTDEEVFAGALWPREWLWQLDMKYVGLLVPLGTTSYISEINELSS 1763

Query: 1877 KHTRDGLPDAITPRPCFKVDHSIESASFLIKDRRIDDRLAKVVDFAVNFNMVHDTDLCIQ 1936
              + D    A    P    + S+   SFLI D+ + + L+KV++FA    +    +  ++
Sbjct: 1764 SLSCDEA--AEFSFPLVHGELSVAGISFLINDKELPEDLSKVLEFAFRIKLAKVAENSMK 1821

Query: 1937 SVQIESTHLKITLAPMTVVRLLSLINEFGIIRKQFTEESIYTPSSAHNNSTATECLEPSV 1996
            S+QIESTH +I L P +++R+LSL  E   +      +++   +   ++  A +    S 
Sbjct: 1822 SLQIESTHFRIALCPFSLIRILSLAYEATHLSGL---QALKDNAGVKSSDDAKDFFNISQ 1878

Query: 1997 WRLIIKSGHILSHDFSIVWLFDIPNSSADGLICGYDRLFSVYEKPYGKLTLLNAYFSAAK 2056
                  S  ILS+DF + W+F+   +S  GL  GY RLF+ +EKPYGKLTLL+AYF  A+
Sbjct: 1879 ---TFHSIQILSYDFCLGWIFNNDGASNSGLTWGYQRLFAAHEKPYGKLTLLDAYFFIAR 1935

Query: 2057 ILASEADFYSSVVRKQRINTSYLSDMQLRYWFTEDSENTDLFIRIHGAKLAVDISAEIVT 2116
               S  DFY       R N S L  MQ+ YWF  +    +LF+RI+G +L V   ++ + 
Sbjct: 1936 GSTSN-DFYIQPDEVDRPNRSSLPSMQICYWFETNGSEDELFVRINGERLDVSFLSKSIG 1994

Query: 2117 LLEETIQSIQTFNNLKKALVDPFRTKK------QDSDISKEPYNWNNQLATGVRSLNCII 2170
            +     +S+  F  LK+  +DPF+ ++        S  SK P      + + +  +NC +
Sbjct: 1995 IAGGFARSLHLFQELKRQYLDPFKPEEPVKRVPAGSAFSKLP------ILSSISHVNCKV 2048

Query: 2171 NYAGVTLKLHSHD--GRGDASPLELTSPSYKVAIDYKYFPNLEKTHRFRTLITATPTHNT 2228
             YAG   KL+S D   R      +L SPS  V  +Y      ++ H  R L++   +HNT
Sbjct: 2049 RYAGGVFKLYSLDDIKRKTGPSFQLESPSVDVIFEYTKMLTGKRKHLLRALMSVDSSHNT 2108

Query: 2229 FYSTSAFLIHDLCYRFXXXXXXXXXXXXXXXXXXXXXIKVEGSDNSTLLGSIDLVIILNV 2288
             + T   +I ++                            EG +  +LL  +D+  ++N+
Sbjct: 2109 LFPTCVPIISEMALDIRQLLKDLNKSSVETPRTSNMQ---EGINYRSLLQDVDISFMMNI 2165

Query: 2289 GKQEVTFSCEPKAKVQATVGXXXXXXXXXXXXXXXXXSLCLAIEIENLMTNSRHIYSREV 2348
             KQ+++ SCEPKAKVQA VG                  L L+++I N+   SRHI+SREV
Sbjct: 2166 DKQQISLSCEPKAKVQADVGFEKFAMKLFTNDFDVLEPLSLSLDIHNITATSRHIFSREV 2225

Query: 2349 CASLKLRHISMVFDIMGSQVRRIYGSTLISSPLFYFNMKQLQDLKLFIDQWFPQKTPMNT 2408
              SL +  +S VF +        YG   I +   YFN+KQLQDL +FI+ W   K     
Sbjct: 2226 STSLNIECLSFVFMLTHPDTIHTYGIANIPTIDVYFNIKQLQDLNVFINIW---KLDSKI 2282

Query: 2409 GSYPE-----GVLVDDISRXXXXXXXXXXXXXXXXXXXXVIVAGSCAEIELGPSLGVLNV 2463
             S PE      +   ++ +                    VI++    EI+LG SLGVL++
Sbjct: 2283 LSQPELDNKFVIGPTNLEKPLTSKYKKVISNSSFPWNFVVILSRIRGEIDLGISLGVLSL 2342

Query: 2464 TSEDVWAISKQQVDWSQQLDLNMGKLDVTSSGRLGGNFLVRNAHLSLELKWPNPKDFFQV 2523
            T+E +WA++    DW+Q L L + KL ++S GRLGG FL++N     ++KWP  +  F+ 
Sbjct: 2343 TTEKIWAVTDHYSDWTQTLSLQLDKLSLSSDGRLGGTFLLQNFRWMSQIKWPLNEGSFES 2402

Query: 2524 PLVCVKLGSDTVDTKLSFDYHTFFISSLKQGYASLFNERDEDGSLADLLSVTVSFESVNI 2583
            PLV + +  D    KL+FDYH   I+S+++   SLFN+RD  G + +LLSV++S +S  +
Sbjct: 2403 PLVVLNIFLDETAVKLTFDYHLVLIASVEKLSLSLFNKRDPRGVIRNLLSVSLSSDSTQV 2462

Query: 2584 FLTALAAANISDIKNSITRLKKDNELSYLSSFLASDQPSDEPEEDGGIFDXXXXXXXXXX 2643
            FLTALA ANI D+ N+I R++KDN  SYL +   S+    +                   
Sbjct: 2463 FLTALAPANIFDVYNTILRMRKDNRKSYLETLGDSNTRDTKGSSSSHEILSSLSFLRTEL 2522

Query: 2644 XXXGVF-RLQISPTSLFDSDVLILTATKMMANTGIQADIKIKTDLHWQLDDVSLALLPFN 2702
                 F  +Q+ P++LFD +V+   A      +  +   K+KT L  ++ +V LAL  + 
Sbjct: 2523 SVMLKFVHIQVYPSTLFDMEVMTFKARDFSTFSQTEGSKKLKTQLKLKVHNVKLALSTYK 2582

Query: 2703 NSLDESYLATMEVGKYIELSSTIQGGAIFSAPSIVVNMTTWQEPQSNVIELLYSTSFGGT 2762
            + L E   + + V +YIE +S + GG I S P+I++ MTTW +  +N +ELLYS SFGG 
Sbjct: 2583 SQLHERVASQIGVKEYIEHASKVDGGTILSTPAILIGMTTWHDVATNKVELLYSNSFGGK 2642

Query: 2763 VKIRWNLGPISFIKDMWQAHMNAMQLREGYYHGLAESGVAVTPLNSKAVPLEMHLGSDYQ 2822
            + +RWNLG I+F+++MW  H  AM LR   ++G ++S      L  K    ++ LG +Y 
Sbjct: 2643 IGVRWNLGSINFLREMWATHARAMALRRS-HNGQSKSFFEDEHLGDKLK--DVDLGDEYT 2699

Query: 2823 YLPLQEPDIEMPRIKDLGDATPPIEWFGVNRTKFPGFTHQFVIVPLQKLARTAEKEYEKI 2882
            Y+PL+EP IE+P+ KDLG+ATPP+EWFGVNR +FPG THQ VIVPLQKLA  AE E+ +I
Sbjct: 2700 YIPLEEPHIEIPQTKDLGEATPPVEWFGVNRKQFPGLTHQGVIVPLQKLAHLAESEWARI 2759

Query: 2883 LGRA 2886
            LGRA
Sbjct: 2760 LGRA 2763

>NDAI0B01980 Chr2 complement(483519..492398) [8880 bp, 2959 aa] {ON}
            Anc_8.260 YLR087C
          Length = 2959

 Score =  776 bits (2004), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 476/1522 (31%), Positives = 753/1522 (49%), Gaps = 95/1522 (6%)

Query: 1    MVIFAIFYVGRVLGYIVSKAANLVLWKQYRVTVSIQSLVFSPLAGKVHFKNVSVTSQDQL 60
            + +F IFY+ R L Y +S      LWK+  V ++I+S+  SPL G+V FKNV +  QD  
Sbjct: 32   VTLFVIFYLSRTLAYGISFILEWFLWKRSNVKINIESIRISPLGGRVFFKNVVIIHQDYT 91

Query: 61   ISVLKGTITWRYWLIGRYRRSG----------TADGARR-CRFALKFEGFEYFVYNRNGV 109
            IS L+  +TWRYWL+   R+SG          +A+  +  CRF L+FEG E FVYNR   
Sbjct: 92   ISFLEANVTWRYWLLN-VRKSGYDTPELPDKASANSVKLPCRFFLEFEGLEIFVYNRGVA 150

Query: 110  YDRIARELDGEDXXX-----------------------------------XXXXXXXXXX 134
            YD I  +   E+                                                
Sbjct: 151  YDNIIGQFSKEERNQFEKFLNEQVFTDSKAEVSNSESNSEEDTFESAGTFKSDSSTTNDR 210

Query: 135  XXIAELQDDPLIRRFLPVEFLHNKGAIVLGNKQTHSVAIMNYEKLAGTVSIEVPDDTRAP 194
                EL + P    FLP++F  + G++++GNK T S+ I +     G + +  P +    
Sbjct: 211  VFQEELSERPQFLDFLPIDFKVSHGSLIIGNKFTPSLMIGSCSSCTGMIDVCQPSEKLDL 270

Query: 195  SSFRTEAKISNCTVAIKPNISYEVDNPVKIYVEPKRTARLWKKY-KTLLGTVLEATLHAK 253
               R         + IK NI +  +  +K  ++  R +++W+++ K LL       L   
Sbjct: 271  YKLRFLLDFKTFAIDIKQNIGFNEEFSMKFKIDRNRVSKMWQQFNKVLLTCYSHMKLSHL 330

Query: 254  RKKEQHQTPKWYDNWRGLSMYD---VNXXXXXXXXVKFDIEHHEYAKCTTVLKADQMDVT 310
            R  +  +   +Y+ WRGLS+Y              + FD  +HEYAK +++++  Q   T
Sbjct: 331  RSNKVSEEDPFYEKWRGLSLYRGTIFGKSNDDINDIDFDFANHEYAKFSSIVRTPQAIFT 390

Query: 311  YSYGMPG--------TARVTDSDNAENPLLERPELDHSVDILVYDANCTYGPWANRQVQQ 362
            +   +PG        T   TD  +  N     PE   S++I +   +  +GPWA RQ+  
Sbjct: 391  FECDIPGIVPHGAHPTLTATDGPDVGNSGAP-PEF--SLEIQISGGSICFGPWAQRQLNS 447

Query: 363  CLRVFSPTVCRNFKLRTPEEIAQQTEPAAFKLSVTIMEDSVLRVPMKESSKDAAFLEKYK 422
             +R+ SP   RN K               FK +++  E++  R+P +ESSKD  FL+ Y+
Sbjct: 448  LIRLLSPIASRNAKPTKRLTPGCTRIYTQFKTTISTTEETTWRIPTRESSKDPEFLQHYR 507

Query: 423  QTRDETRPFGWIDIRIAKESNITVRMAAYPTENGFENILHANLVDTTISTSVNHDTLLKA 482
            +T +E RPFGWID++ +K++ I   +A  PT+ GF+N L  +L D  I +SVNHD LLK 
Sbjct: 508  ETNEEYRPFGWIDLKFSKDTYICSTVAQCPTKEGFKNTLDIHLGDNEIRSSVNHDILLKC 567

Query: 483  KSHDITVDFSYPYGWQDKAEWNFNVCSTQAELFVLRDHVYLISDLVTDFSGGEEVLYEQF 542
            KS +  +D  +P GW ++A W  ++ STQ E F+LR+H+ LI+D +TDFS GE   YE F
Sbjct: 568  KSFNFVMDIGFPLGWNEEATWTIDLESTQLEAFILREHITLIADTLTDFSSGEPTPYELF 627

Query: 543  RPFDYRFRWDIRGYSAYLNVNDANIINNPIDFGENCYLSVHGDDAEITFSLPITSIIQKY 602
            RPF YR  W I GYS YLNVND NI+NNP+DF ENCYLS HGD  +I   +P   +   +
Sbjct: 628  RPFVYRINWKINGYSLYLNVNDHNIVNNPLDFNENCYLSFHGDILQIDLVVPKREVSAGF 687

Query: 603  VTVDFNIFTPHFSLFLNAPPWHTFSELLHYKEIGRSKNFNIKGSYTSYSEVDVDNVDALN 662
              V + I+TP F L LN PPW+T +E +  KE+GRS +F I GSY  YSE+D+DNVD + 
Sbjct: 688  TEVSYTIYTPMFRLVLNTPPWNTLNEFMKNKEVGRSHDFKITGSYLIYSELDIDNVDTII 747

Query: 663  IACETDYIVVLCYGVILKCMLNVKVNYFGEMVHFRTTEEYVEELQRRNKQNPSTCRPFNS 722
            I C +   V+ CYG +++ + NVK+NYFG+  HF T+EEY  E++    QN  T R    
Sbjct: 748  IECSSQSTVLQCYGFVIRYLTNVKMNYFGDFFHFVTSEEYTGEIRANEVQNQFTDRQLYE 807

Query: 723  DGNVHDSDVVATESNEIIDASFDAFGGPPTIKKSALKRSINELDVWFTFISKGGCFFFPE 782
            D     + + + ES E      +   G   IK+S LKR+ NE D+WFTF    G    PE
Sbjct: 808  D----KASLSSYESIETSSVRKEQ-TGDSKIKRSDLKRATNETDLWFTFTVWEGAILLPE 862

Query: 783  NIYKFDACLGFYFDNLEASLRFLNYYVDAAVSLDSIYFKRHTDIDARTLFKVIEDIGIPI 842
             IY  D C+G +F  L    R  NYY+D   S++ I  +R+       +++ +       
Sbjct: 863  TIYNCDPCIGLHFGELLIDFRSCNYYMDLLASMNDISLRRYIGKQQNEIYESVRQDNGCG 922

Query: 843  DASDAYLSQFSFRLHKMLGIMPSEESYACEFDVRVDTLDVHCDLAVLKAFVNTLRNLAFG 902
            +     LS      H+M G+ P E +Y C++D  + TLD++CD++ L+ F+ +   ++FG
Sbjct: 923  NKKYGSLSDMVIHAHRMYGLPPLEPTYFCQWDFSLGTLDLNCDISFLEGFITSFNKISFG 982

Query: 903  FKDVENSLQYEREQVFDLNKISCVIENVTVKLQNVDKDEDIWLSLNLPVTTLTSFDLANE 962
              D+EN L YE+E + D+  ++  ++ +++ ++  + + D +L         ++ +  NE
Sbjct: 983  LVDLENILLYEKEVIDDMTSLTVDVKKISIMIR--ESEMDTFLLCTAEELYFSNINFENE 1040

Query: 963  RYSRRSDLSIPEL-LFGIYRGDSESTCLGAFSTGVTVTLFERFEQFARCRVLQRKHILVN 1021
            +Y  R DL IP   LF      ++   L  F T V ++ FE+    A  +  Q+++I ++
Sbjct: 1041 KYCTRLDLRIPIFNLFMYTMNGAKKEKLFEFETKVNLSNFEKPNDIATHKSKQQEYITLH 1100

Query: 1022 DAPFHRCSFMLPPEYKKMPIYRSLYGCXXXXXXXXXXXXXXXADNFEVIFEKLLGEIYQE 1081
            DAP+HRC+F+LPP  +   IY+ L+G                    + I + LLG   + 
Sbjct: 1101 DAPYHRCAFILPPSLQDSEIYQDLFGSIAPSSSLPPLPIPLLPATIDYIVDDLLGCFPEI 1160

Query: 1082 YASDSSYQITDDSISS-----------TEHDYHNQTVNAAIGTSS-SLFIRSQNHQQTLS 1129
              S++ ++I     +S           TE D     +     TS  S    S N    +S
Sbjct: 1161 LESENPFRIPFSPATSPKLGNPFEGSDTESDEELDPLEFKTETSGDSETFASDNFVIDIS 1220

Query: 1130 SFIVEFDP-IDGYLDLSATEFMLEIYKYLTEVSLDEAIDSLEIGIINQFIQTFGEDNGIS 1188
               +  +P +  YLD     F  +         + + +D +EIGI+N             
Sbjct: 1221 YCSLSINPRLWSYLDNCREHFCSQ--------DIVQILDDIEIGIVNHLSDLQEGIETAR 1272

Query: 1189 EVRVLCPNISLSATNKQSKFSMFKLSSKIKNLDITSRIKSSDPNLKPDPEKTTLCYKIDY 1248
             +++    + L   ++Q+      +S  +  +D+    K  + N +    + T   KI  
Sbjct: 1273 NIKLQILYLDLFWGDRQNA----GISLYLDRIDLEMCQKMLEENNETKITEVTFLNKIRS 1328

Query: 1249 IRANIVQDGIVVPPKQPSQLFSCSIELLEGYLSYDKLSLLDNNVQSCSVTLSPGTDKLLF 1308
            +RA I +   V    +     S  IE  E +       +   N+ S  +T+       LF
Sbjct: 1329 VRATINEASSVGKADERPPALSLVIEGSEIWSCITNAQVNSLNILSADITIDEAQIDWLF 1388

Query: 1309 EFLNPFISTFDLLQRELSSFEDTLLASKREFLLNILRGGRDYEIQHDPPVITKPANITRF 1368
            ++++  ++    +   L S +++   ++++ +  +      Y+I HDP VITKPA ITR 
Sbjct: 1389 QYIDKQLTLSQEIASALQSIQESRSTTRKQLVSKLAVASEYYQISHDPYVITKPAFITRL 1448

Query: 1369 SNRHIRSAESWRIIMRLRHILNYLPQEWHQSFTRHLGTQDFTSPEEAGKEFLSIFSDWRS 1428
            S  H+R   SW+II RLRHIL YLP +W +        QD  +  + G  F+S+FS+WR+
Sbjct: 1449 SRGHVRENRSWKIITRLRHILTYLPIDWLRVIDEMRNQQDSHTLPDPGNAFISVFSNWRN 1508

Query: 1429 WEPTDVQGSFVHEKVFTKKRSR 1450
            WE +D+  S+++  +F++  S+
Sbjct: 1509 WEFSDIARSYIYRNMFSEGHSK 1530

 Score =  561 bits (1445), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 376/1209 (31%), Positives = 600/1209 (49%), Gaps = 55/1209 (4%)

Query: 1700 KIHAVLFQGQVANITLKLQILSPFIILYCAENFELQAESTDSVIFDLNSGESYMEISSAK 1759
            KI+ VL      N+ L++  LSPF   + A+  ++      S    L+  ++ + + S  
Sbjct: 1778 KINMVL-TCYFTNVNLEIMPLSPFSFRHNAKQLDIYFNRLGSNDLVLSVWDTDLFLISHL 1836

Query: 1760 QKLDYFKYTHTCLKLSGTS-SSARLFEHISCDIGILKLSVFDLKTRITDLLQDIKAALFS 1818
             K +YF+++   ++L G    +     +I     I+KL++ D++  I   LQD K  + S
Sbjct: 1837 TKEEYFRFSFGNIQLKGNILENPNYTINIDVSASIVKLTLGDIRRLIPSFLQDEKILIES 1896

Query: 1819 MKSLSDILNISQSSPTASAFGSWFSILPDNLSLQATYAGLLLGFGHTLYILEFNNFEAKH 1878
            ++  S +    +  P  S   S  ++   +L     Y GLL+    T +ILE +      
Sbjct: 1897 LEQFSSLKLFQRKKPAPSTEKSGRTVTW-SLESNINYFGLLVPISSTYFILELHMLLM-- 1953

Query: 1879 TRDGLPDAITPRPCFKVDHSIESASFLIKDRRIDDRLAKVVDFAVNFNMVHDTDLCIQSV 1938
            + + +    +         SI++  FL+K++ +   L+K++DF++  + +    +  +S 
Sbjct: 1954 SLNKIQGISSKYNGLSGQFSIDNVCFLLKEKSLPADLSKILDFSIKVSTLQKLKVTPRSF 2013

Query: 1939 QIESTHLKITLAPMTVVRLLSLINEFGIIRKQFTEESIYTPSSA-----HNNSTATECLE 1993
            QIES H ++ L+P ++  +L   N+     + + E +             NNS   +   
Sbjct: 2014 QIESPHFRVCLSPGSLAHMLWRGNQALTNIRYYKEHTSVAWEKVINFKNTNNSAEVQADF 2073

Query: 1994 PSVWRLIIKSGHILSHDFSIVWLFDIPNSSADGLICGYDRLFSVYEKPYGKLTLLNAYFS 2053
            PS         H+LS++F + WLF     +  GLI GY RLFS YEK +GKLTL++AYFS
Sbjct: 2074 PSF--------HVLSYNFCVGWLFSPEFDNEPGLIIGYSRLFSAYEKNFGKLTLIDAYFS 2125

Query: 2054 AAKILASEADFYSSVVRKQRINTSYLSDMQLRYWFTEDSENTDLFIRIHGAKLAVDISAE 2113
             A    S+  F+S    K R N SYL +MQ+ YW   +    D+++R HG  L V+  A 
Sbjct: 2126 VANGKTSDT-FFSKGHEKDRYNRSYLPNMQISYWLKNEGLLRDVYLRFHGEALDVNFLAS 2184

Query: 2114 IVTLLEETIQSIQTFNNLKKALVDPFRT-KKQDSDISKEPYNWNNQLATGVRSLNCIINY 2172
             + ++E +++SIQ F  LK+ LV      K+Q    ++EP    +   TG+RS+NC   Y
Sbjct: 2185 FIDVIESSLESIQKFQELKRDLVGTASNIKEQTQSTTQEPIGDISPFFTGIRSINCQFQY 2244

Query: 2173 AGVTLKLHSH-DGRGDASP-LELTSPSYKVAIDYKYFPNLEKTHR---FRTLITATPTHN 2227
             G   K+ S  +      P  E+ SP+  + ++YKY  N +KT      RTLIT   THN
Sbjct: 2245 DGGVFKVFSSAEASNHLKPSFEIKSPNVIIDMNYKY--NEKKTQTPTWIRTLITINSTHN 2302

Query: 2228 TFYSTSAFLIHDLCYRFXXXXXXXXXXXXXXXXXXXXXIKVEGSDNSTLLGSIDLVIILN 2287
            T ++  A LI +    F                     I  +  D   +L S D+ + + 
Sbjct: 2303 TLFAKCAPLIAE----FSEGIQKMVKRHSSDREPSGTNISKQNIDYKRMLDSFDVAVEVI 2358

Query: 2288 VGKQEVTFSCEPKAKVQATVGXXXXXXXXXXXXXXXXXSLCLAIEIENLMTNSRHIYSRE 2347
              KQ ++  CEP+AKVQA +G                  L  A+ +E    + +HI+SRE
Sbjct: 2359 SAKQLLSLCCEPRAKVQADIGFQSFTFTVTTNDYDPEEPLIFALSVEKTEASIKHIFSRE 2418

Query: 2348 VCASLKLRHISMVFDIMGSQVRRIYGSTLISSPLFYFNMKQLQDLKLFIDQW----FPQK 2403
               S  +  I +           I G+ LIS    +FN+KQLQ+L LF+D W        
Sbjct: 2419 ASTSFGVDFIDLTVMFTHPNSINILGTGLISDVHVFFNVKQLQNLYLFLDIWKLSNLLNS 2478

Query: 2404 TPMNTGSYPEGVLVDDISRXXXXXXXXXXXXXXXXXXXXVIVAGSCAEIELGPSLGVLNV 2463
             PMN       V+                          +I +    +++LGP+LGVL++
Sbjct: 2479 KPMNE------VVKSRTDLKSLSSVQSKDTDSTIPWCFTLIFSNINGDVDLGPTLGVLSL 2532

Query: 2464 TSEDVWAISKQQVDWSQQLDLNMGKLDVTSSGRLGGNFLVRNAHLSLELKWPNPKDFFQV 2523
              +  W  +       + L      + +TS GRL G   +  A    E+ WP  ++    
Sbjct: 2533 HFKRTWFATDHYKSTRKVLHAYTKGITLTSKGRLSGILELDGASWISEVNWPIYENINDY 2592

Query: 2524 PLVCVKLGSDTVDTKLSFDYHTFFISSLKQGYASLFNERDEDGSLADLLSVTVSFESVNI 2583
            PLV + L  D V+TK++FDYH F + ++      + +E+D +G   DLL V V  E++ +
Sbjct: 2593 PLVSISLNIDRVETKVAFDYHMFLVGAINNIDVHIHSEKDINGIKPDLLKVNVICEAIKL 2652

Query: 2584 FLTALAAANISDIKNSITRLKKDNELSYLSSFLASDQPSDEPEED---GGIFDXXXXXXX 2640
              TAL AANI DI N++ RL++DN++SY+ +   S+  + EP +      I         
Sbjct: 2653 CSTALVAANILDIYNTVMRLRQDNKISYIETLKESN--TSEPRQALDYKDILRSLNLIQT 2710

Query: 2641 XXXXXXGVFRLQISPTSLFDSDVLILTATKMMANTGIQADIKIKTDLHWQLDDVSLALLP 2700
                      +QISP SLFD+++L++    + A +   A  K+KT+L  Q+ D S+AL  
Sbjct: 2711 DVSVDIYTLNIQISPISLFDAEILVVNIENISARSETHAGNKLKTELEMQVYDASVALST 2770

Query: 2701 FNNSLDESYLATMEVGKYIELSSTIQGGAIFSAPSIVVNMTTWQEPQSNVIELLYSTSFG 2760
                LDE  +AT+ V  Y+  +  I GG I  AP +++ MTT+Q+ +S+++E LY+ SFG
Sbjct: 2771 SKEELDEDIIATISVEDYMHYAGRISGGVIIEAPRLLIAMTTYQKEKSDILEYLYTCSFG 2830

Query: 2761 GTVKIRWNLGPISFIKDMWQAHMNAMQLREGYYHGLAESGVAVTPLNSKAVPLEMHLG-- 2818
              + +RWNLGP++FIK+MW  H+ AM +R       ++  V   P++ + V   +     
Sbjct: 2831 DKISVRWNLGPVNFIKEMWATHVRAMAVRR------SQIDVTFGPVSEEDVGKRIKKEEE 2884

Query: 2819 -SDYQYLPLQEPDIEMPRIKDLGDATPPIEWFGVNRTKFPGFTHQFVIVPLQKLARTAEK 2877
             S +QY+PL+EP I+MP+I+DLGDATPP+EWFG+NR +FP FTHQ  ++ +QKL  TAEK
Sbjct: 2885 FSRFQYVPLEEPRIDMPQIRDLGDATPPLEWFGLNRKRFPAFTHQTAVILVQKLVHTAEK 2944

Query: 2878 EYEKILGRA 2886
            EY  ILG +
Sbjct: 2945 EYGSILGHS 2953

>TDEL0F03870 Chr6 complement(713797..722625) [8829 bp, 2942 aa] {ON}
            Anc_8.260 YLR087C
          Length = 2942

 Score =  762 bits (1968), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 484/1537 (31%), Positives = 758/1537 (49%), Gaps = 133/1537 (8%)

Query: 1    MVIFAIFYVGRVLGYIVSKAANLVLWKQYRVTVSIQSLVFSPLAGKVHFKNVSVTSQDQL 60
            + +  IFY+GR+  Y ++      LWK ++V +S++SL  +PL+G + F+N+ +  +DQ 
Sbjct: 32   VTLTVIFYLGRLFAYAITLVLEWFLWKHWKVKISVESLRIAPLSGSILFRNLCIIGKDQT 91

Query: 61   ISVLKGTITWRYWLIGRYRR-----SGTADG--------------ARRCRFALKFEGFEY 101
            IS+LKG++ WRY L+   R      S   DG                 CRF L  EGFE 
Sbjct: 92   ISILKGSLRWRYRLLATRRSQYEEASSQKDGLGVGEEDVNSMKNITLPCRFVLFCEGFEI 151

Query: 102  FVYNRNGVYDRIARELDGEDXXXXXXXXXXXXXXXI----AELQDDP------------- 144
            F+YNR   Y+ I +    E+               +    +E  DD              
Sbjct: 152  FIYNRTVAYENIIQMFSREERVQFEKFMSKQEMSELFHCHSERSDDKGSTDSVLSSSVSD 211

Query: 145  ------------------LIRRFLPVEFLHNKGAIVLGNKQTHSVAIMNYEKLAGTVSIE 186
                              +  RFLP+E   ++G+IVLGNK T S+ I +     G V + 
Sbjct: 212  VPNINDRVFDEVHNQKKSIFMRFLPMELQLSRGSIVLGNKFTPSLLIASCTSGRGVVDLC 271

Query: 187  VPDDTRAPSSFRTEAKISNCTVAIKPNISYEVDNPVKIYVEPKRTARLWKKYKTLLGTVL 246
             P +         +    +  ++I+ NI Y   N  K   +  + +R+W  +  +L    
Sbjct: 272  QPKEKLDLYKMHFQVDFIDIDISIRQNIEY---NRKKATFKNGKLSRMWATFVKVLHIPF 328

Query: 247  EATLHAKRKKEQHQTPKWYDNWRGLSMYD---VNXXXXXXXXVKFDIEHHEYAKCTTVLK 303
                H  +  E   +  +   W+GL +Y     +        V FD  +HEYAK + ++K
Sbjct: 329  YNKSHNNKGTE---SEPFMTKWKGLGLYKGLTFDRDGEDYDEVHFDFANHEYAKVSNIIK 385

Query: 304  ADQMDVTYSYGMPGTARVTDSDNAENPLLERPELDHS-------VDILVYDANCTYGPWA 356
            + +  +TYSY +PG        +  +P LE PE+ ++       +D+  Y     YGPWA
Sbjct: 386  SPRTVLTYSYDIPGVV-----PHGAHPTLEGPEVGNNGAPPEFGIDLQFYGVTICYGPWA 440

Query: 357  NRQVQQCLRVFSPTVCRN---FKLRTPEEIAQQTEPAAFKLSVTIMEDSVLRVPMKESSK 413
             R++Q  LR+ SPTV R+    K  +P     +     FK +  +++ S  R+P +E SK
Sbjct: 441  QREIQHLLRMISPTVARSSVPIKTLSP---GSRRIYTVFKTTFRVLDGSSWRIPTRERSK 497

Query: 414  DAAFLEKYKQTRDETRPFGWIDIRIAKESNITVRMAAYPTENGFENILHANLVDTTISTS 473
            D  FL+K+K T +E RPFGW+D++ A +S  +V     P E GF N ++ +  +   ++S
Sbjct: 498  DQEFLKKFKATSEEYRPFGWLDLKFAMDSYGSVTTVLCPKEEGFPNKMYIHFAEMEATSS 557

Query: 474  VNHDTLLKAKSHDITVDFSYPYGWQDKAEWNFNVCSTQAELFVLRDHVYLISDLVTDFSG 533
            VNHD +LK    D+  D  YP GW   A W  N+ STQ E F+LR+HV L++D+ TDFS 
Sbjct: 558  VNHDVMLKCNCFDVAGDVGYPLGWNSSATWTINLHSTQLETFLLREHVTLVADIFTDFSS 617

Query: 534  GEEVLYEQFRPFDYRFRWDIRGYSAYLNVNDANIINNPIDFGENCYLSVHGDDAEITFSL 593
            GE   YE FRPF Y+  W I GYS YLNVND NI+NNP+DF ENCYLS+HG++  I  + 
Sbjct: 618  GEPTPYELFRPFIYQINWIIDGYSIYLNVNDHNIVNNPLDFNENCYLSLHGEELLIDVTA 677

Query: 594  PITSIIQKYVTVDFNIFTPHFSLFLNAPPWHTFSELLHYKEIGRSKNFNIKGSYTSYSEV 653
            P  SI   Y+ V + I TP F L LN PPW+T +E +  KE+GRS +F + G YT YSE+
Sbjct: 678  PNDSITGAYMDVPYKISTPMFRLLLNTPPWNTLNEFMKNKEVGRSYSFAVCGLYTVYSEL 737

Query: 654  DVDNVDALNIACETDYIVVLCYGVILKCMLNVKVNYFGEMVHFRTTEEYVEELQRRNKQN 713
            D+DNVD L++ C +    + CYG +++ ++NVK+NYFG+  HF T+EEY   ++ + K++
Sbjct: 738  DIDNVDTLSVECTSTGTTLHCYGFVMRYLMNVKMNYFGDFFHFITSEEYTGVIRAKEKES 797

Query: 714  PSTCRPFNSDGNVHDSDVVATESNEIIDASFDAFGGPPTIKKSALKRSINELDVWFTFIS 773
                   +   N   S  ++T+S  + D        PP + +S +KR+ NE D+WFTF  
Sbjct: 798  VGKTEEESLRDN---STNLSTDSGGLSDPYVRLRADPP-VSRSDVKRTTNETDIWFTFSV 853

Query: 774  KGGCFFFPENIYKFDACLGFYFDNLEASLRFLNYYVDAAVSLDSIYFKRHTDIDARTLFK 833
              G    PE IY  D C+  +F  L   LR  NYY+D   ++ S   KR+    +  LF+
Sbjct: 854  WEGALVLPETIYNCDPCVALHFGELIVDLRSCNYYMDLLATMSSTSIKRYVSRQSHELFE 913

Query: 834  VIEDIGIPIDASDAYLSQFSFRLHKMLGIMPSEESYACEFDVRVDTLDVHCDLAVLKAFV 893
             I       +     L+  +   H+M G+ P E +Y C++ + +D L ++ D    K F 
Sbjct: 914  SIRRDNGRTEKEHGSLAALTIHGHRMYGLPPIEPTYFCQWGIDLDGLTINSDAEFAKGFF 973

Query: 894  NTLRNLAFGFKDVENSLQYEREQVFDLNKISCVIENVTVKLQNVDKDEDIWLSLNLPVTT 953
                 + FG+ ++EN+L Y+ E   D+  ++  + ++ V ++N D    +   +++P  T
Sbjct: 974  TLFAGIGFGYTNLENTLLYDVETPDDMTSVTVRVRDMNVVVEN-DSSRAV---VDVPNLT 1029

Query: 954  LTSFDLANERYSRRSDLSIPEL--LFGIYRGDSESTCLGAFSTGVTVTLFERFEQFARCR 1011
             TS D  NERYS+R DL +P L  L      DSE   L   +T V +T F +   FA+ R
Sbjct: 1030 FTSIDFENERYSQRIDLKVPSLSILLLTSEDDSEPIRLMDLTTKVYLTDFIQKRDFAKHR 1089

Query: 1012 VLQRKHILVNDAPFHRCSFMLPPEYKKMPIYRSLYGCXXXXXXXXXXXXXXXADNFEVIF 1071
              QR +I +ND+PF+RCSF+LP   ++ P+Y+SL G                A+  + I 
Sbjct: 1090 SKQRDYITLNDSPFYRCSFLLPCYLQESPLYKSLLGSISPSSSLPPLPMPLLAETIDFII 1149

Query: 1072 EKLLGEIYQEYASDSSYQIT-DDSISSTEHDYHNQTVNAAIGTSSSLF-----IRSQNHQ 1125
            E LLGE       D   Q T DD  S +E    +Q            F     I S N  
Sbjct: 1150 EDLLGEFAAGLKCDYDTQRTVDDPDSPSESFDTSQEHEGPDDVRYDRFAQLPKILSPNPL 1209

Query: 1126 QTLSSFIVEFDPIDGYLDLSATEFMLEIYKYLTEVSLDEAIDSLEIGIINQFIQTFGEDN 1185
            +   + I++   +   LD     ++  +     +V+  + ID +E+ I+ +  Q +  + 
Sbjct: 1210 EQYDNVIIDVKFLAVDLDPLICSYVDGLLGEFWKVNTVDIIDEIEMSIVKRLGQLWN-NT 1268

Query: 1186 GISEVRVLCPNISLSATNKQSKFS-------MFKLSSKIKNLDITSRIKSSDPNLKPDPE 1238
             +  +++   +I+    +K +K          F L  + ++LD  + +           E
Sbjct: 1269 CVLNLKLYVVDINFFWGDKNAKVVDLYFDKLDFDLGQRTRDLDGETIVS----------E 1318

Query: 1239 KTTLCYKIDYIRANIVQDGIVVPPKQPSQLFSCSIELLEGYLSYDKLSLLDNNVQSCSVT 1298
            K TL  K+  +RA +    I    ++     S ++E  E Y    +  +   ++ S  +T
Sbjct: 1319 KITLS-KLRSVRATVFDRSITEGVEERPPALSLAVEGWEAYSWMREKIVGSVSLLSTDIT 1377

Query: 1299 LSPGTDKLLFEFLNPFIS-TFDLLQRELSSF---EDTLLASKREFLLNILRGGRDYEIQH 1354
            +    D+   E+L+ +I+   DL++  L+SF    +    ++R+ L +I      Y+I H
Sbjct: 1378 V----DESQLEWLSVYIAEQRDLIKNMLTSFTKLHEYWQGTRRDLLRDITTASEHYQISH 1433

Query: 1355 DPPVITKPANITRFSNRHIRSAESWRIIMRLRHILNYLPQEWHQSFTRHLG-TQDFTSPE 1413
            +P VITKPA I R SN H+R   SWRII RLRHIL YLP EW  +    +  T D T   
Sbjct: 1434 EPYVITKPAFIMRLSNGHVRENPSWRIITRLRHILTYLPNEWRNNSAIQVSPTVDSTDA- 1492

Query: 1414 EAGKEFLSIFSDWRSWEPTDVQGSFVHEKVFTKKRSR 1450
                   S+ S WR WE +D+  S+++  +F   +S+
Sbjct: 1493 -------SVASHWRRWEISDITRSYIYRTIFLSDQSK 1522

 Score =  545 bits (1405), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 393/1301 (30%), Positives = 630/1301 (48%), Gaps = 103/1301 (7%)

Query: 1625 IDIDMFSVLLHYLPGQGCYSIDWKARKFHIDSSSATTKDLTESLPYVRDEIKYLVEALVP 1684
            + + M + L  Y+P     SI+ +    HI + ++T + L  S+  + + I  L      
Sbjct: 1703 LSLTMTAELWSYMPS---LSINIQCSNSHIRAMTST-ELLVNSIKQIMESISELKRHFAM 1758

Query: 1685 ELFAEPPIERESSGNKI--HAVLFQGQVANITLKLQILSPFIILYCAENFELQAESTDSV 1742
            E    P ++  S+   I           +++T +L  L+PF++ +  +   L      S 
Sbjct: 1759 EK-TTPNVQGTSTNLSIPLQNTALTVSFSDVTAELMPLTPFVVRHEMKQLGLYLNRVQSN 1817

Query: 1743 IFDLNSGESYMEISSAKQKLDYFKYTHTCLKLSG---TSSSARLFEHISCDIGILKLSVF 1799
               ++  ++ + + S +    YF +    L++     T SSA L  ++     ++KL++ 
Sbjct: 1818 EILISIWDANIILKSHQTTEQYFNFALGDLQVKCNLPTESSAIL--NVGLSTSLMKLTLS 1875

Query: 1800 DLKTRITDLLQD---IKAALFSMKSLSDILNISQSSPTASAFGSWFSILPDNLSLQATYA 1856
            + +  ++  LQD   I  +L  +K L  + +    + T S+   W      +L     Y 
Sbjct: 1876 EPRRILSSFLQDEKLIGESLGYIKGLLQLFSPLARNKTQSSALRW------SLDANLNYF 1929

Query: 1857 GLLLGFGHTLYILEFNNFEA--KHTRDGLPDAITPRPCFKVDH------SIESASFLIKD 1908
            G+L+    T ++ E +   A   +  DG  +          DH      SIE+   LIK+
Sbjct: 1930 GILVPMASTFFVFEIHMLLAAMNNASDGQDEG---------DHHVTGQVSIENCLLLIKE 1980

Query: 1909 RRIDDRLAKVVDFAVNFNMVHDTDLCIQSVQIESTHLKITLAPMTVVRLL-------SLI 1961
              +   L+K++DF++            QS QIES+H ++ L+P ++V++L       SL+
Sbjct: 1981 PSLPADLSKLLDFSIRVMSSQKVPNSPQSYQIESSHFRVCLSPGSLVQVLWGTHQLQSLL 2040

Query: 1962 NEFGIIRKQFTEESIYTPSSAHNNSTATECLEPSVWRLIIKSGHILSHDFSIVWLFDIPN 2021
              F   RK   ++   +P S  + S + +       ++  +S HILS++  I W+F + +
Sbjct: 2041 EYF---RKHRKQDKAISPFSLFDGSASADR------QIDFRSIHILSYNLCIGWMFQLGD 2091

Query: 2022 SSADGLICGYDRLFSVYEKPYGKLTLLNAYFSAAKILASEADFYSSVVRKQRINTSYLSD 2081
                GLI G+DRLFS YEK YGKLTL++ YFS A   +++  FYS    KQR N S+LS+
Sbjct: 2092 DVKTGLIIGFDRLFSAYEKHYGKLTLIDGYFSVANGQSTDT-FYSQGSEKQRYNRSFLSN 2150

Query: 2082 MQLRYWFTEDSENTDLFIRIHGAKLAVDISAEIVTLLEETIQSIQTFNNLKKALVDPFRT 2141
            +Q+ YW  E     DLFIR++G  L V + +    ++E T+ SIQ F  LKK      R 
Sbjct: 2151 VQITYWLKEIDSMKDLFIRVNGEALEVSLLSNSFDIIESTLASIQKFQTLKKE-----RM 2205

Query: 2142 KKQDSDISKEPYNWNNQ------LATGVRSLNCIINYAGVTLKLHSHD--GRGDASPLEL 2193
             K+DS   +   N  N         + +R+++C   Y G  LK++S D   R +   LE+
Sbjct: 2206 HKRDSG-PRNKLNLENTSNNISPFLSHIRTIDCQFKYVGGVLKIYSLDDLNRAEGPSLEI 2264

Query: 2194 TSPSYKVAIDYKYFPNLEKTHRFRTLITATPTHNTFYSTSAFLIHDLCYRFXXXXXXXXX 2253
             SP   +A+ Y +     + HR R L++  PTHN  YS    +++D+             
Sbjct: 2265 KSPGVVIALKYNHNEAERRPHRIRCLVSIDPTHNILYSQCVPILNDIV----------EA 2314

Query: 2254 XXXXXXXXXXXXIKVEGS---DNSTLLGSIDLVIILNVGKQEVTFSCEPKAKVQATVGXX 2310
                          +E S   D  +LL S D+   +  G+Q+++ SCEP+AKVQA VG  
Sbjct: 2315 SQRMVQKHSPDETPLESSQSIDYKSLLDSFDIAFKVTSGRQQLSLSCEPRAKVQADVGFD 2374

Query: 2311 XXXXXXXXXXXXXXXSLCLAIEIENLMTNSRHIYSREVCASLKLRHISMVFDIMGSQVRR 2370
                              +++ +E + ++ RHI+SRE  AS  +  +          V  
Sbjct: 2375 SFTFGVTTNDLVDGNPTGVSLSVEKIQSSVRHIFSRETSASFSVDFVDFTSIFTHPDV-- 2432

Query: 2371 IYGSTLISSPLFYFNMKQLQDLKLFIDQWFPQKTPMNTGSYPEGVLVDDISRXXXXXXXX 2430
             +G  L+S    +FNMKQLQ+L LF+D W       N G   +    DD  +        
Sbjct: 2433 -FGVALVSDINVFFNMKQLQNLNLFLDIWQLNGKLNNKGRAKD----DDRKKQTKSMTLS 2487

Query: 2431 XXXXXXXXX--XXXVIVAGSCAEIELGPSLGVLNVTSEDVWAISKQQVDWSQQLDLNMGK 2488
                          +I      +++LGPSLGVL++     W  +       + L     +
Sbjct: 2488 KRTSTPTSICWSFTLIFTNVKGDVDLGPSLGVLSLRLSRTWFATDHYGAQRRVLHAFADE 2547

Query: 2489 LDVTSSGRLGGNFLVRNAHLSLELKWPNPKDFFQVPLVCVKLGSDTVDTKLSFDYHTFFI 2548
            L + S GRL G F ++NA    E+ +P          + + L    V  K +FDYH F I
Sbjct: 2548 LSIKSEGRLSGVFDLKNATWISEVNYPAAGSIKGSSEMSLSLSVGRVAIKTAFDYHMFLI 2607

Query: 2549 SSLKQGYASLFNERDEDGSLADLLSVTVSFESVNIFLTALAAANISDIKNSITRLKKDNE 2608
             ++ +    L +E D  G L DLL V +S + ++   TAL AANI DI N+ITR+++DN 
Sbjct: 2608 GTIDEMKFHLRSESDLYGILPDLLVVALSCKEMDFCATALTAANILDIYNTITRMRQDNR 2667

Query: 2609 LSYLSSFLASDQPSDEPEED---GGIFDXXXXXXXXXXXXXGVFRLQISPTSLFDSDVLI 2665
            +SY+ +   S+  S E         I                 F+ QISP SLFD +VL+
Sbjct: 2668 ISYIETLRESN--STEARVTLLYDDILQSLNLLRTDLSFDITTFKAQISPISLFDVEVLV 2725

Query: 2666 LTATKMMANTGIQADIKIKTDLHWQLDDVSLALLPFNNSLDESYLATMEVGKYIELSSTI 2725
            L    + A +  Q+  K+KT+LH Q+ +  ++L      LDE  +A + +  Y+  +S I
Sbjct: 2726 LNIDNVSARSETQSGEKLKTELHLQVSNAKVSLSTSKEELDEERVAKISIEDYMLYASKI 2785

Query: 2726 QGGAIFSAPSIVVNMTTWQEPQSNVIELLYSTSFGGTVKIRWNLGPISFIKDMWQAHMNA 2785
             GG I   P ++V+MTTWQ+P+S++IE L++  F   V ++WNLGPI+FIK+MW  H+ +
Sbjct: 2786 SGGTIVKVPRLLVSMTTWQKPKSDLIEYLFTCRFFDRVAVKWNLGPINFIKEMWSTHIKS 2845

Query: 2786 MQLREGYYHGLAESGVAVTPLNSKA-VPLEMHLGSDYQYLPLQEPDIEMPRIKDLGDATP 2844
            + +R+       +S   ++  + +A +  E  + +  QY+PL EP IEMP+IKDLGDATP
Sbjct: 2846 LAVRQ------TQSNKTMSEKDKQADLDPEEEIKAKLQYVPLDEPYIEMPQIKDLGDATP 2899

Query: 2845 PIEWFGVNRTKFPGFTHQFVIVPLQKLARTAEKEYEKILGR 2885
            P+EWFGV+R + P  THQ  IV +QKL   AEKEY K+ GR
Sbjct: 2900 PMEWFGVHRKRLPAATHQLAIVLIQKLVHAAEKEYAKVQGR 2940

>KAFR0B02720 Chr2 complement(549702..558650) [8949 bp, 2982 aa] {ON}
            Anc_8.260 YLR087C
          Length = 2982

 Score =  724 bits (1868), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 436/1333 (32%), Positives = 690/1333 (51%), Gaps = 50/1333 (3%)

Query: 138  AELQDDPLIRRFLPVEFLHNKGAIVLGNKQTHSVAIMNYEKLAGTVSIEVPDDTRAPSSF 197
            A+   D L  +  PVE   ++ ++  GNK T S+ I++ E   G +    P +       
Sbjct: 231  AKSDKDSLFLQTFPVEIEVHRASLAFGNKFTPSLVIISSEHGTGIIDYCQPKEKLDLYKM 290

Query: 198  RTEAKISNCTVAIKPNISYEVDNPVKIYVEPKRTARLWKKYKTLLGTVLEATLHAKRKKE 257
            +   +  N  V +KPNI Y+ +  +K  ++  + +RLWK++  + G +       +RKK+
Sbjct: 291  KLAIETHNFAVTVKPNIGYKEEMLLKFKIDRGKLSRLWKRFTPITGIITRPLGLTQRKKK 350

Query: 258  QHQTPKWY-DNWRGLSMYD---VNXXXXXXXXVKFDIEHHEYAKCTTVLKADQMDVTYSY 313
            +++ P  +   W+GLS+Y              ++FD  +HEYAK ++V+K  +   TY Y
Sbjct: 351  RNEPPDLFIQKWQGLSLYKGTIFEPTTDDLDDIQFDFLNHEYAKFSSVVKCPKAIFTYEY 410

Query: 314  GMPGTARVTDSDNAENPLLERPELD-------HSVDILVYDANCTYGPWANRQVQQCLRV 366
             +PG   V    +  N  ++ P++        HS+DI ++  +  YGPW  RQ+     +
Sbjct: 411  DIPGC--VPHGAHPTNSEIDGPDVGNNGAPPTHSLDIQIFGGSICYGPWTQRQMNFIHSM 468

Query: 367  FSPTVCRN---FKLRTPEEIAQQTEPAAFKLSVTIMEDSVLRVPMKESSKDAAFLEKYKQ 423
             +P V R     K R P      T   A KLS++IM+D+  R+  +E SKD  FL+ YK+
Sbjct: 469  LAPAVSRTESPVKRRVPGSTRIYT---ATKLSISIMDDTTWRIATREPSKDNIFLKHYKE 525

Query: 424  TRDETRPFGWIDIRIAKESNITVRMAAYPTENGFENILHANLVDTTISTSVNHDTLLKAK 483
            T D+ RPFGWID+R +KES      A  PT  GF+N ++ +L    I +SVNHD L+K K
Sbjct: 526  TNDDYRPFGWIDLRFSKESYAYFTFALVPTTEGFKNDINIHLAQNEIRSSVNHDILMKCK 585

Query: 484  SHDITVDFSYPYGWQDKAEWNFNVCSTQAELFVLRDHVYLISDLVTDFSGGEEVLYEQFR 543
              D  +D SYP  W D+A W  ++ S Q E F+LR+H+ LI+D +TDF+ GE   YE FR
Sbjct: 586  FFDFDIDVSYPLVWNDRATWTIDMNSNQLETFLLREHITLIADTLTDFTSGEPTPYELFR 645

Query: 544  PFDYRFRWDIRGYSAYLNVNDANIINNPIDFGENCYLSVHGDDAEITFSLPITSIIQKYV 603
            P +    W +  Y  YLNVND NI+NNP+DF ENCYLS+HGDD  I  ++P   I  ++ 
Sbjct: 646  PSETFINWKMDAYFIYLNVNDHNIVNNPLDFNENCYLSLHGDDLLINVTIPSEDITAQFN 705

Query: 604  TVDFNIFTPHFSLFLNAPPWHTFSELLHYKEIGRSKNFNIKGSYTSYSEVDVDNVDALNI 663
             + +NI TP F L LN PPW+T +E + YKE+GRS +F+ KGSY  YSE+DVDNVD ++I
Sbjct: 706  EITYNITTPMFRLLLNTPPWNTLNEFMKYKEVGRSYDFSAKGSYLLYSELDVDNVDTISI 765

Query: 664  ACETDYIVVLCYGVILKCMLNVKVNYFGEMVHFRTTEEYVEELQRRNKQNPSTCRPFNSD 723
             CE+    + CYG +++ + NVK+NYFG+  +F T+EEY      R+++        N  
Sbjct: 766  ICESRGTTLQCYGFVIRYLANVKMNYFGDFFNFITSEEYTG--ITRDEELEEELISSNLS 823

Query: 724  GNVHDSDVVATESNEIIDASFDAFGGPPTIKKSALKRSINELDVWFTFISKGGCFFFPEN 783
             N  + DV +   + + DA         T+K+S L+R+ NE D++ TF    G    PE 
Sbjct: 824  DNEDNGDVYSDGESGMDDAISQEIPERTTLKRSDLRRTANETDLFLTFSVWDGAIILPET 883

Query: 784  IYKFDACLGFYFDNLEASLRFLNYYVDAAVSLDSIYFKRHTDIDARTLFKVIEDIGIPID 843
            IY  D C    F  L   LR  NYY+D   SL+    +R+T+     +FK +        
Sbjct: 884  IYNCDNCTALKFGELIIDLRSSNYYMDLLASLEDTVMERYTEKSPIDIFKSVLHDNRESS 943

Query: 844  ASDAYLSQFSFRLHKMLGIMPSEESYACEFDVRVDTLDVHCDLAVLKAFVNTLRNLAFGF 903
             +  +LS  S   H+M G+ P+E +Y C++D  +  L+V+ +   LK F+ +   + FGF
Sbjct: 944  EAQGFLSDLSIHGHRMFGLPPNEPTYFCKWDFDIGVLNVNSEFDFLKGFLTSFSRIGFGF 1003

Query: 904  KDVENSLQYEREQVFDLNKISCVIENVTVKLQNVDKDEDIWLSLNLPVTTLTSFDLANER 963
            KD+EN L Y +E + D+  ++   + ++V L+N  +   I ++L       TS D  +  
Sbjct: 1004 KDLENILLYSKEVINDMTSLTVNAQEISVNLKN--EVSGIDMALKTQHVNFTSIDFESAN 1061

Query: 964  YSRRSDLSIPELLFGIY--RGDSESTCLGAFSTGVTVTLFERFEQFARCRVLQRKHILVN 1021
            YS R DL IP L   +Y    D +   L  F+T V +T F + + F R R +QR +I +N
Sbjct: 1062 YSSRLDLIIPSLKMSMYGLDIDGKKARLFNFTTKVHLTDFAQKKNFKRHRSMQRNYITLN 1121

Query: 1022 DAPFHRCSFMLPPEYKKMPIYRSLYGCXXXXXXXXXXXXXXXADNFEVIFEKLLGEIYQE 1081
            DA FHR SF+LP  ++K  +Y  LYG                    + I E  LGE    
Sbjct: 1122 DAAFHRTSFLLPQSFQKKELYNELYGSIVPSSSLPVLALPILPKTVDFILEDFLGEYVSL 1181

Query: 1082 YASDSSYQITDDSISS-TEHDYHNQTVNAAIGTSSSLFIRSQNHQQTLSSFIVEFDPIDG 1140
                + +++   S ++  +   H++     +  S+S     +N+Q    + +++ + I  
Sbjct: 1182 LDDRTIFRMPFGSTNTPNQASTHHEEDMDPLEFSNSTVSTEKNYQ--CDNLVIDIEYISV 1239

Query: 1141 YLDLSATEFMLEIYKYLTEVSLDEAIDSLEIGIINQFIQTFGEDNGISEV-----RVLCP 1195
             ++ S + ++  +   + E ++ + ID +EI  I + + TF E  G S +     RVL  
Sbjct: 1240 EINPSISTYIESLSSTVYEENIVQVIDDIEIETI-KILSTFQE--GTSSITNIKLRVLYS 1296

Query: 1196 NISLSATNKQSKFSMFKLSSKIKNLDITSRIKSSDPNLKPDPEK----TTLCYKIDYIRA 1251
            +I     ++      + +   +  LD     + S  N++ D EK     T+  K   IRA
Sbjct: 1297 DIYWGERDR------YGIELYLDKLD----FEMSQRNIEKDREKGLLEITMLAKTRSIRA 1346

Query: 1252 NIVQDGIVVPPKQPSQLFSCSIELLEGYLSYDKLSLLDNNVQSCSVTLSPGTDKLLFEFL 1311
            +I ++G     K+     S  +E  E + +  +  +   +  S  +T+     + LF F+
Sbjct: 1347 SISEEGSTKNEKERPPALSLVVEGCELWSATAEKQVNSIDTISTDITIDESQLEWLFLFV 1406

Query: 1312 NPFISTFDLLQRELSSFEDTLLASKREFLLNILRGGRDYEIQHDPPVITKPANITRFSNR 1371
            N        +   L+S +     S+R+ +  +      Y+I HDP VITKPA ITR S  
Sbjct: 1407 NEQNQNLQNIITTLNSVQAEHTVSRRKLISKLTAANDFYQISHDPYVITKPAFITRLSKG 1466

Query: 1372 HIRSAESWRIIMRLRHILNYLPQEWHQSFTRHLGTQDFTSPEEAGKEFLSIFSDWRSWEP 1431
            H+R   SW+II RLRHIL Y+P +W      +L  +     +EA K F+S+FS+WR+WE 
Sbjct: 1467 HVRENRSWKIITRLRHILTYIPSDWESGVENYLKEKSLNDQDEAKKVFMSVFSNWRNWEF 1526

Query: 1432 TDVQGSFVHEKVF 1444
            +DV  S+++ ++F
Sbjct: 1527 SDVARSYIYGRLF 1539

 Score =  541 bits (1393), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 379/1260 (30%), Positives = 605/1260 (48%), Gaps = 59/1260 (4%)

Query: 1652 FHIDSSSATTKDLTESLPYVRDEIKYLVEAL-VPELFAEPPIERESSGNKIHAVLFQ--G 1708
            FHI  S A T  L  S+  +   +K + + L + +  AE   E +S   K+  V  +   
Sbjct: 1750 FHI-KSMAKTATLVNSVKEMVQTVKNIDKQLSISDRLAEG--ENKSPKKKLKDVEIEVVC 1806

Query: 1709 QVANITLKLQILSPFIILYCAENFELQAE--STDSVIFDLNSGESYMEISSAKQKLDYFK 1766
            Q++N++ ++  +SPF I +  + F+L+ +   + +V+ D+   + ++     KQ+  YF+
Sbjct: 1807 QLSNVSFEIMPISPFYIRHETKKFDLKFKQFGSQNVMIDVWDTDFFLRSDLTKQQ--YFR 1864

Query: 1767 YTHTCLKLSGTSSSAR-LFEHISCDIGILKLSVFDLKTRITDLLQDIKAALFSMKSLSDI 1825
             +    +++        +    +    ++KL+  +    ++  LQD + A  S K L  +
Sbjct: 1865 ISFGDFQITYNLIEGEFIIVDANVSASMIKLTFSEPNRILSSFLQDERTASESFKLLKAL 1924

Query: 1826 LNI------SQSSPTASAFGSWFSILPDNLSLQATYAGLLLGFGHTLYILEFNNFEAKHT 1879
                      +  P  +    W       L     Y G+L+    T ++ E +      +
Sbjct: 1925 KPFLLPQTEGRLQPATTKEMRWL------LDTDIKYFGILVPISTTYFVFETHALVLSMS 1978

Query: 1880 RDGLPDAITPRPCFKVDHSIESASFLIKDRRIDDRLAKVVDFAVNFNMVHDTDLCIQSVQ 1939
             D   +  T +   +   SIE+  FLIKDR I   L++++DF+++F+ +        S Q
Sbjct: 1979 -DIDTEKYTEKDETQSQVSIENVVFLIKDRGIPSALSRMLDFSISFSTIQKMMELDTSFQ 2037

Query: 1940 IESTHLKITLAPMTVVRLLSLINEFGIIRKQFTEESIYTPSSAHNNSTATECLEPSVWRL 1999
            +ES H +I L+P ++VRL+    +F  +   + E+          +    E    S   +
Sbjct: 2038 VESNHFRIFLSPYSLVRLVWGGQQFLGLANYYKEQRGTDLWDIKASKLKKEKKGSSSIGM 2097

Query: 2000 IIKSGHILSHDFSIVWLFDIPNSSADGLICGYDRLFSVYEKPYGKLTLLNAYFSAAKILA 2059
             + S H+LS++F I W+F   N+SA G++ G+ RLFS YE  YGKLTL++A+FS A+  A
Sbjct: 2098 NMSSFHVLSYNFCIGWMFPEANASAPGIMLGFSRLFSAYEGGYGKLTLVDAFFSVAR-GA 2156

Query: 2060 SEADFYSSVVRKQRINTSYLSDMQLRYWFTEDSENTDLFIRIHGAKLAVDISAEIVTLLE 2119
            + A FY      + +N SYL +MQ+ YW  +     D+FIR HG  L V      +T++E
Sbjct: 2157 TSATFYPRESELESVNRSYLPNMQIAYWVKKSGLMKDVFIRFHGEALDVSFLTTFITVIE 2216

Query: 2120 ETIQSIQTFNNLKKALVDPFRTKKQDSDISK----EPYNWNNQLATGVRSLNCIINYAGV 2175
              +QS Q F  LK +L+ P  +  +++   K     P+       + ++S+NC   Y G 
Sbjct: 2217 SMLQSFQVFQELKTSLIQPNTSTTENNTEPKIKSLAPF------LSNIKSVNCQFKYDGG 2270

Query: 2176 TLKLHS-HDGRGDASP-LELTSPSYKVAIDYKYFPNLEKTHRFRTLITATPTHNTFYSTS 2233
              K+ S  D      P  EL +P   +  +YK+     K H  R L+    THNT ++  
Sbjct: 2271 VFKVFSFEDIESHLEPSFELKTPGVIIDFNYKHNIGSLKPHWIRALVAIGSTHNTLFAVC 2330

Query: 2234 AFLIHD-LCYRFXXXXXXXXXXXXXXXXXXXXXIKVEGSDNSTLLGSIDLVIILNVGKQE 2292
            A LI + L +                          +  D   LL   D+   L   +Q+
Sbjct: 2331 APLIAEFLEHIHEMVKKHSSNTKHESIATNLSKAPSQNIDYKRLLDGFDIAFKLTSSEQK 2390

Query: 2293 VTFSCEPKAKVQATVGXXXXXXXXXXXXXXXXXSLCLAIEIENLMTNSRHIYSREVCASL 2352
            ++ SCEPKAKVQA VG                  L  ++ I+    + +HI+S+E   S 
Sbjct: 2391 LSLSCEPKAKVQADVGFDSFIIGIVTNNLDETEPLTFSLSIKKTKASIKHIFSKETSTSF 2450

Query: 2353 KLRHISMVFDIMGSQVRRIYGSTLISSPLFYFNMKQLQDLKLFIDQW----FPQKTPM-- 2406
             L  I + F      +  +YG+ LIS    YFN+KQLQ+L LFID W    F +  P   
Sbjct: 2451 GLDLIDLNFMFTHPDIINMYGTGLISEVDLYFNVKQLQNLYLFIDIWKLSSFIRPGPKGK 2510

Query: 2407 -NTGSYPEGVLVDDISRXXXXXXXXXXXXXXXXXXXXVIVAGSCAEIELGPSLGVLNVTS 2465
             N G      L                          +I        +LGPSLGVL++  
Sbjct: 2511 SNNGKRENKHLT---------LPQPSNLYGEIPWSFTLIFTNINGSADLGPSLGVLSLKL 2561

Query: 2466 EDVWAISKQQVDWSQQLDLNMGKLDVTSSGRLGGNFLVRNAHLSLELKWPNPKDFFQVPL 2525
            +  W  S    D  Q +      L   S GRL G F +  A    E+ WP  K     PL
Sbjct: 2562 KRTWVASDHYQDKRQVIRAFTDYLSFVSKGRLSGIFELDGASWMSEVSWPKEKRTHNYPL 2621

Query: 2526 VCVKLGSDTVDTKLSFDYHTFFISSLKQGYASLFNERDEDGSLADLLSVTVSFESVNIFL 2585
            V V +  D +  K +FDYH F I ++     SL +E+D  G++ DLL V  + E +NI  
Sbjct: 2622 VNVSVNIDNLSLKAAFDYHMFLIGTISTAKFSLHSEKDIVGTMPDLLKVNFTCEMINICS 2681

Query: 2586 TALAAANISDIKNSITRLKKDNELSYLSSFLASD--QPSDEPEEDGGIFDXXXXXXXXXX 2643
            TAL AANI D+ N++ R+++DN++ YL +   SD  +    P+    I            
Sbjct: 2682 TALVAANILDLYNTVMRMRQDNKILYLETLRESDTLETRGNPDNYRDILRSLNLLQTDVS 2741

Query: 2644 XXXGVFRLQISPTSLFDSDVLILTATKMMANTGIQADIKIKTDLHWQLDDVSLALLPFNN 2703
                V +LQ+SP +LFD +VL++    + A  G  A  K+KT L  ++ D  +AL     
Sbjct: 2742 TNIHVLKLQVSPIALFDLEVLVINIENISARAGTFAGEKLKTILELEVYDGYVALSTSKR 2801

Query: 2704 SLDESYLATMEVGKYIELSSTIQGGAIFSAPSIVVNMTTWQEPQSNVIELLYSTSFGGTV 2763
             +DE  ++ + V  Y+E +S I GG I   P + + MT+WQE  S+++E LY  +F   +
Sbjct: 2802 EIDEDTVSAISVADYMEYASKISGGTIIEVPKLNIAMTSWQEENSDILEYLYKCTFEDKI 2861

Query: 2764 KIRWNLGPISFIKDMWQAHMNAMQLREGYYHGLAESGVAVTPLNSKAVPLEMHLGSDYQY 2823
             ++WNLGP++FIK+MW  H+ A+ +R      + ++ +       K +  E ++ S  +Y
Sbjct: 2862 AVKWNLGPVNFIKEMWTTHVKALAVRRS--QNVLDTDMQTDEEVQKRIKEEENI-SKLKY 2918

Query: 2824 LPLQEPDIEMPRIKDLGDATPPIEWFGVNRTKFPGFTHQFVIVPLQKLARTAEKEYEKIL 2883
            +P++EP I+MP+I+DLGDATPP+EWFGVNR + P FTHQ V+VP+QKL   AEK+Y  +L
Sbjct: 2919 VPIEEPRIDMPQIRDLGDATPPLEWFGVNRKRLPAFTHQTVVVPVQKLVHAAEKQYASLL 2978

 Score =  102 bits (253), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 53/133 (39%), Positives = 74/133 (55%), Gaps = 12/133 (9%)

Query: 1   MVIFAIFYVGRVLGYIVSKAANLVLWKQYRVTVSIQSLVFSPLAGKVHFKNVSVTSQDQL 60
           + +  IFYVGR + YI S     +LWK+  + V+I+SL  S L G++ FKNV++  +D  
Sbjct: 32  LCLSVIFYVGRAIAYITSLILEWLLWKRAHIKVNIESLRISLLGGRIFFKNVTIIHKDYT 91

Query: 61  ISVLKGTITWRYWLIGRYR-----RSGTADGARR-------CRFALKFEGFEYFVYNRNG 108
           IS+L+GT+TWRYWL+   +      S  ++G          CRF L  EG E FVYNR  
Sbjct: 92  ISLLQGTLTWRYWLLKTRKPSYHLESKDSNGVTMKKNEQLPCRFVLHCEGAEIFVYNRTW 151

Query: 109 VYDRIARELDGED 121
            YD I      E+
Sbjct: 152 SYDNIINLFSKEE 164

>Kpol_392.7 s392 (10369..19356) [8988 bp, 2995 aa] {ON} (10369..19356)
            [8988 nt, 2996 aa]
          Length = 2995

 Score =  721 bits (1862), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 456/1536 (29%), Positives = 740/1536 (48%), Gaps = 125/1536 (8%)

Query: 5    AIFYVGRVLGYIVSKAANLVLWKQYRVTVSIQSLVFSPLAGKVHFKNVSVTSQDQLISVL 64
             IFY+ RV G I +   +  +WK+Y+V ++I+S+  S L G V  KN+S+ +QD  +S L
Sbjct: 36   VIFYLPRVFGAIFTFILHWSIWKKYKVKINIESIRVSFLGGTVFIKNMSIINQDFTLSFL 95

Query: 65   KGTITWRYWLIG----RYR--------RSGTADGARR----------CRFALKFEGFEYF 102
            +  I WRYWL+      Y+        +S  +D +            C   ++ +GFE F
Sbjct: 96   ECRIKWRYWLLNSREVEYKVQANLSSEQSQGSDASNSMTIEKNSKLPCTILIECKGFEVF 155

Query: 103  VYNRNGVYDRIAR--------------------ELDGEDXXXXXXXXXXXXXXXIAELQD 142
            VYNR   Y+ + R                    ++  ED                    +
Sbjct: 156  VYNRKAAYENVLRLFTKEEREKFSSFLNEHDLGDIVSEDTNVNSMDKDYFESVTTENSSE 215

Query: 143  DPLIR----------------RFLPVEFLHNKGAIVLGNKQTHSVAIMNYEKLAGTVSIE 186
              +I                  FLP++     GA+ LGN+ T S+ + +YE   G + + 
Sbjct: 216  STVINDRTYKKNKDERKSILFNFLPIQLRLIHGAVTLGNRFTPSLVVASYENCNGVLDVS 275

Query: 187  VPDDTRAPSSFRTEAKISNCTVAIKPNISYEVDNPVKIYVEPKRTARLWKKYKTLLGTV- 245
              ++       +   K  +  +++KPN++Y+ +   ++ ++  + +R+W  +  ++  + 
Sbjct: 276  HANEKIDLYKSKVTMKFQDVNISVKPNLAYDSEFTNELDIDKGKLSRIWNTFIDIMDMIP 335

Query: 246  --LEATLHAKRKKEQHQTPKWYDN-WRGLSMYDVNXXXXXXXXV---KFDIEHHEYAKCT 299
                   H   KK++H     + N WRGLS+Y  N        +    +D  + EYAK +
Sbjct: 336  NPFTKIYHKHMKKKEHDVESMFVNKWRGLSLYKDNLRDAGRYGLDEASYDFLNREYAKFS 395

Query: 300  TVLKADQMDVTYSYGMPGTARVTDSDNAENPLLERPELDHS-------VDILVYDANCTY 352
            ++LK     ++Y    PG   V    +  N   + P++ +S       VD+ V  A+  Y
Sbjct: 396  SILKCPNFTLSYYLDSPGI--VPHGAHQTNVKKDGPDIGNSGSPPEFLVDLQVSKASIYY 453

Query: 353  GPWANRQVQQCLRVFSPTVCRNFKLRTPEEIAQQTEPAAFKLSVTIMEDSVLRVPMKESS 412
            GPW NRQV   +R+ SP V +N       E   +     FK+SV I+++S  R+P +E S
Sbjct: 454  GPWTNRQVSYLIRMLSPVVSKNQIPIKKLEPGSRRIHTVFKMSVHIIDESSWRIPTREPS 513

Query: 413  KDAAFLEKYKQTRDETRPFGWIDIRIAKESNITVRMAAYPTENGFENILHANLVDTTIST 472
            KD  F++++ +T D+ RPFGW+D  + K +  T   +  PT +G  N    + +D  ++T
Sbjct: 514  KDKEFIKQFVKTNDDFRPFGWLDFNLNKGTQATFNFSLIPTIDGLGNNFDIHFLDMEVTT 573

Query: 473  SVNHDTLLKAKSHDITVDFSYPYGWQDKAEWNFNVCSTQAELFVLRDHVYLISDLVTDFS 532
            SVNHD LLK+K  D+  D  YP GW  +A+W F++ + Q E F+L++H+ L SD+ +DF+
Sbjct: 574  SVNHDILLKSKEFDVVADIGYPLGWNSQADWKFDIIAKQLETFLLKEHISLFSDMFSDFA 633

Query: 533  GGEEVLYEQFRPFDYRFRWDIRGYSAYLNVNDANIINNPIDFGENCYLSVHGDDAEITFS 592
              +   YE FRPF Y   WDI GYS YLNVND NI+NNP+DF ENCYLS+HGD+  I   
Sbjct: 634  SEDPTPYELFRPFTYSLNWDIEGYSIYLNVNDRNIVNNPLDFNENCYLSLHGDELHIDSL 693

Query: 593  LPITSIIQKYVTVDFNIFTPHFSLFLNAPPWHTFSELLHYKEIGRSKNFNIKGSYTSYSE 652
            +P   I Q Y  + FNI+TP F L LN PPW+T SE +  KE+GR+ +F I+GSY  YS+
Sbjct: 694  IPNLLISQPYTEIAFNIYTPMFRLLLNTPPWNTLSEFMKDKEVGRAFDFGIEGSYLIYSD 753

Query: 653  VDVDNVDALNIACETDYIVVLCYGVILKCMLNVKVNYFGEMVHFRTTEEYVEELQRRNKQ 712
            +D+DNVD + + C +    + CYGV+++ ++NV+ NYFG+ VHF T+EEY E LQ+ NK+
Sbjct: 754  LDIDNVDTITMECTSRSTTLFCYGVVIRYLMNVQANYFGDFVHFITSEEYSEILQKNNKR 813

Query: 713  NPSTCRPFNSDGNVHDSDVVATESNEIIDASFDAFGGPPTIKKSALKRSINELDVWFTFI 772
            +      F        S V  + S++ +  + +     P ++++ + R+ NELD+WFTF 
Sbjct: 814  SNDEQGSFTYSTT---SSVQNSSSDDTVLYTKEQDLSKPHVRRADVLRTENELDIWFTFR 870

Query: 773  SKGGCFFFPENIYKFDACLGFYFDNLEASLRFLNYYVDAAVSLDSIYFKRHTDIDARTLF 832
               G    PE +Y  + C    F  L  S R  NYY+D   +L  +   R  +     +F
Sbjct: 871  VWDGALILPEGLYNGNLCSSLLFSELMISFRGSNYYMDFLTNLYDMKINRFLNFSPDEIF 930

Query: 833  KVIEDIGIPIDASDAYLSQFSFRLHKMLGIMPSEESYACEFDVRVDTLDVHCDLAVLKAF 892
            + + D    ++     LS  +   H+M G+ P++ +Y C++ +   +L +  ++  L +F
Sbjct: 931  RYVRDPDHNLNIVHGTLSDVTIHAHRMFGLPPNKLTYFCQWSIDFGSLIIDSNIEFLSSF 990

Query: 893  VNTLRNLAFGFKDVENSLQYEREQVFDLNKISCVIENVTVKLQNVDKDEDIWLSLNLPVT 952
                  L FG+ ++EN L Y+ E   D+  ++   E V + +   D       SL +   
Sbjct: 991  FGLFTKLGFGYSNLENKLVYKVESSDDMTLLTLYGEKVLILVS--DDVSQKQASLEILKL 1048

Query: 953  TLTSFDLANERYSRRSDLSIPELLFGIY--RGDSESTCLGAFSTGVTVTLFERFEQFARC 1010
             L S D  NERYS+R +L IPE    I+  R  +    L  F T +  T F   E F   
Sbjct: 1049 KLNSIDFQNERYSKRINLKIPEFSISIFDVRNPTIKPILLGFKTKIDFTNFVIKEDFRNS 1108

Query: 1011 RVLQRKHILVNDAPFHRCSFMLPPEYKKMPIYRSLYGCXXXXXXXXXXXXXXXADNFEVI 1070
               QR +I ++D+P+HRC F+LP  Y++  +Y  LYG                 +  + +
Sbjct: 1109 LNGQRTYITLHDSPYHRCFFILPTMYQESFLYNELYGGITPSFSIPILPIPMLPNTIDFL 1168

Query: 1071 FEKLLGEIYQEYASDSSYQITDDSISSTEHDYHNQTVNAAIGTSSSLFIRSQNHQQTLSS 1130
             E  L E Y +   +    I   +   T   ++   V+  I   +      +N       
Sbjct: 1169 VEDFLKE-YSDLLENPFLNIRSINNLDTSSLFNEYRVDTYISEKAIFKAEEKN------- 1220

Query: 1131 FIVEFDP---IDGYLDLSATEFMLEIYKYLTEVSLDEAIDSLEIGIINQFIQTFGEDNGI 1187
              V +DP    D Y+ L+     ++I    ++      IDS+   + ++ +    ++  +
Sbjct: 1221 -TVNYDPKYEYDNYI-LNVEYIRVDINPLFSDF-----IDSMSTKLYSENMVDIIDEIEM 1273

Query: 1188 SEVRVLC--PNISLSATNKQSKFSMFKLSSKIKN----------LDITSRIKSSDPNLKP 1235
              VR L     + L  TN + K S   +    +N          LD   R +  D   + 
Sbjct: 1274 IIVRRLGSPKKVLLRETNLKLKISYVDIFWGSRNSEGIEIYLDKLDFEMRQRIFDDFNQR 1333

Query: 1236 DPEKTTLCYKIDYIRANIVQDGIVVPPKQPSQLFSCSIELLEGYLSYDKLSLLDNNVQSC 1295
              E+ T+  K+  +R +  +        +     S ++E LE +   +       N+ S 
Sbjct: 1334 SLEERTILSKLKSLRCSFSETQYEEIEYERPPALSLTVEGLEVWSCTNTAQSNSINILST 1393

Query: 1296 SVTLSPGTDKLLFEFLNPFISTF-------DLLQRELSSFEDTLLASKREFLLNILRGGR 1348
             +T+       L ++LN  +  F       DLLQ+   + + +L++        +     
Sbjct: 1394 DITVDGSQTSWLIKYLNKQVEFFYNLKGSVDLLQKRDVTLQKSLISK-------LTTASE 1446

Query: 1349 DYEIQHDPPVITKPANITRFSNRHIRSAESWRIIMRLRHILNYLPQEWHQSFTRHLGTQD 1408
             Y+I HDP VITKPA I R SN H+R   SWRI+ RLRHILNYLP+ W +S    +  + 
Sbjct: 1447 YYQIDHDPYVITKPALIMRLSNSHVRENRSWRIVTRLRHILNYLPEGWEKSSIAFVEARH 1506

Query: 1409 FTSPEEAGKEFLSIFSDWRSWEPTDVQGSFVHEKVF 1444
              S  +    FLS+FS+WR+WE +DV  S+++ +VF
Sbjct: 1507 VYSDSDPKNVFLSVFSNWRNWEVSDVARSYIYRRVF 1542

 Score =  506 bits (1303), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 369/1235 (29%), Positives = 606/1235 (49%), Gaps = 101/1235 (8%)

Query: 1706 FQGQVANITLKLQILSPFIILYCAENFEL--QAESTDSVIFDLNSGESYMEISSAKQKLD 1763
            F   + +I+ ++ ILSPF + +  +  ++    E  +  IF +   + Y+  +S +  + 
Sbjct: 1804 FDINIFDISSEIVILSPFTVKHSMKELKIVFNREGDNDTIFSILDADLYL--TSYQNGVQ 1861

Query: 1764 YFKYTHTCLKLSG--TSSSARLFEHISCDIGILKLSVFDLKTRITDLLQDIKA---ALFS 1818
            YF+ ++  + L    T S ++L   I+    ++KL++ D K     LLQD K    +L S
Sbjct: 1862 YFRLSYQDINLEAMLTDSKSKLIT-INIVTSLIKLTLADPKKITNSLLQDEKTFEQSLES 1920

Query: 1819 MKSLSDILNISQSSPTASAFGSWFSILPDNLSLQATYAGLLLGFGHTLYILEFNNFEAKH 1878
            +K+L+ + + S      SA  + +  +   ++   TY GLL     + +ILE ++  A  
Sbjct: 1921 IKTLNTLFS-SNREVRTSAVDNPYKFM---VNFDLTYFGLLFPVDTSYFILELHSLLATF 1976

Query: 1879 TRDGL-PDAITPRPCFKVDHSIESASFLIKDRRIDDRLAKVVDFAVNFNMVHDTDLCIQS 1937
            +   + P  +  +     + ++++  F+IK   ++++++KV+DF+VN +         +S
Sbjct: 1977 SNVYMNPQQLKEK--ITCNLALQNTLFMIKSPEVNNQVSKVLDFSVNLSTETKILNSKRS 2034

Query: 1938 VQIESTHLKITLAPMTVVRLLSLINEFGIIRKQFTEES-IYTPSSAHNNSTATECLEPSV 1996
             ++ES+H ++ L P +++++L  + +     K + E + +    +    S  +E L  + 
Sbjct: 2035 FEVESSHFRVCLNPESLLKILQGVFQTSSSFKYYKEHTRLQIFKTKKKASVVSENLIGA- 2093

Query: 1997 WRLIIKSGHILSHDFSIVWLFDIPNSSADGLICGYDRLFSVYEKPYGKLTLLNAYFSAAK 2056
              LI  S H LS++F I W+F+   SS  GLI GYDRLFS YE  YGKLT+++ +FS A 
Sbjct: 2094 -PLIEYSIHFLSYNFCIGWIFENSQSSYPGLIMGYDRLFSAYEDSYGKLTVVDGFFSIAN 2152

Query: 2057 ILASEADFYSSVVRKQRINTSYLSDMQLRYWFTEDSENTDLFIRIHGAKLAVDISAEIVT 2116
              +S+  FYS    K++ N SYL ++Q+ YW  E      LF+R +G  + V   +   T
Sbjct: 2153 GFSSDT-FYSQGNEKEKYNRSYLPNLQILYWLKEVDAMKQLFVRFYGETIDVRFLSNFAT 2211

Query: 2117 LLEETIQSIQTFNNLKKALVDPFRTKKQ----DSDISKEPYNWNNQLATGVRSLNCIINY 2172
            ++  TI+S+Q F  +KK  V     + +    + DIS +     +   + V+ +NC   Y
Sbjct: 2212 IINLTIESVQHFQMIKKETVREMNVEAEKKVGEDDISTK----FSLFFSKVQRINCQCIY 2267

Query: 2173 AGVTLKLHSHDGR--GDASPLELTSPSYKVAIDYKYFPNLEKTHRFRTLITATPTHNTFY 2230
             G    ++   G        +E+T+P   + +DYKY  +++K H  R+ I   PT+NT  
Sbjct: 2268 DGGVFTVYPVRGNHIDTEHAIEITTPKVIIDVDYKYRIDMKKPHWIRSFINIEPTYNTLL 2327

Query: 2231 ST-SAFL------IHDLCYRFXXXXXXXXXXXXXXXXXXXXXIKVEGSDNSTLLGSIDLV 2283
            S  ++FL      +H++  +F                           D   +L   D+ 
Sbjct: 2328 SQFASFLTEFGESVHEMVAKFSPKEQPPAPKTVSPPI-----------DYKRILEDFDVS 2376

Query: 2284 IILNVGKQEVTFSCEPKAKVQATVGXXXXXXXXXXXXXXXXXSLCLAIEIENLMTNSRHI 2343
              ++ GKQ+V+ SCEP AKV A VG                  L  ++ + ++ T+  H 
Sbjct: 2377 FSISAGKQKVSLSCEPVAKVHANVGFESFVFSIITNDDDPTEPLSCSLTVNDIKTSINHE 2436

Query: 2344 YSREVCASLKLRHISMVFDIMGSQVRRIYGSTLISSPLFYFNMKQLQDLKLFIDQW---- 2399
            +S E  AS  +  + +           IYG+TLIS    YFN+KQLQ+L +F+D W    
Sbjct: 2437 FSTEPTASFSVDFVDITTLFTHPD---IYGTTLISDVSLYFNIKQLQNLMVFLDIWNLKR 2493

Query: 2400 ----FPQKTPMNTGSYPEGVLVDDISRXXXXXXXXXXXXXXXXXXXXVIVAGSCAEIELG 2455
                 PQK+          V V                         VI+     +I LG
Sbjct: 2494 LIKLRPQKS----------VPVKKPESRVSSSTKSSSNTTIIPWSFTVIITDINGDIHLG 2543

Query: 2456 PSLGVLNVTSEDVWAISKQQVDWSQQLDLNMGKLDVTSSGRLGGNFLVRNAHLSLELKWP 2515
            PSLG L++  +  W  +    D  + L      L +TS GRLGG   V N    L +++ 
Sbjct: 2544 PSLGNLSLKLKKNWISTNHFQDRRKALRFFTDSLSLTSVGRLGGLIDVANISWILNVRYV 2603

Query: 2516 NPKDFFQVPLVCVKLGSDTVDTKLSFDYHTFFISSLKQGYASLFNERDEDGSLADLLSVT 2575
              +   Q PLV + L  + V  K +FDYH F I  +     +L +E+D  G+L DLL + 
Sbjct: 2604 ENEKLDQSPLVDITLNVENVAVKAAFDYHMFLIGRVHNILFNLESEKDLIGNLPDLLKLH 2663

Query: 2576 VSFESVNIFLTALAAANISDIKNSITRLKKDNELSYLSSFLASDQPSDEPEEDGGIFDXX 2635
            +  + ++I  TAL A+NI DI N+I+R ++D+  SY+ + L S+ P   P++    +   
Sbjct: 2664 LVCDEIDICSTALVASNILDISNTISRTRQDSRNSYIETLLESNPP---PQKSSISYTDI 2720

Query: 2636 XXXXXXXXXXXGV----FRLQISPTSLFDSDVLILTATKMMANTGIQADIKIKTDLHWQL 2691
                       G+     ++QISP SLFD +V++ T   + A +  Q+  K+ TDL  ++
Sbjct: 2721 LKSLNLLRTDVGIEIHKMQVQISPISLFDVEVIVTTVENVSARSVTQSGEKLMTDLQMKI 2780

Query: 2692 DDVSLALLPFNNSLDESYLATMEVGKYIELSSTIQGGAIFSAPSIVVNMTTWQEPQSNVI 2751
               +L+L   N  LDE  ++ + V  Y+  +  + GG I S P + V MTTWQ   S +I
Sbjct: 2781 YKATLSLSKSNEELDEEAVSEISVDDYMIYAMKLSGGKILSIPKLFVGMTTWQLENSKII 2840

Query: 2752 ELLYSTSFGGTVKIRWNLGPISFIKDMWQAHMNAMQLREGYYHGLAESGVA------VTP 2805
            E L++  F   + +RWNLGP++FIK++W  H+ ++ +R     G  E  +        +P
Sbjct: 2841 EYLFACKFHDKISVRWNLGPVNFIKEVWATHVKSLAVRRAQLKGDKEPQLVPGIIGEPSP 2900

Query: 2806 LNSKAVPLEMHLGSD----------------YQYLPLQEPDIEMPRIKDLGDATPPIEWF 2849
            L S    LEM L S+                + Y+PL+EP IEMP+IKDL DATPP+EWF
Sbjct: 2901 LVSSE-ELEM-LRSESSNADNDNNEYSEEDKFIYVPLKEPQIEMPKIKDLEDATPPLEWF 2958

Query: 2850 GVNRTKFPGFTHQFVIVPLQKLARTAEKEYEKILG 2884
            GVNR KFP  THQ  I+ +QK+   A+KEY K+LG
Sbjct: 2959 GVNRKKFPRVTHQTAIILIQKIVHVAQKEYAKVLG 2993

>ZYRO0C01694g Chr3 (121250..130270) [9021 bp, 3006 aa] {ON} similar to
            uniprot|Q12150 Saccharomyces cerevisiae YLR087C CSF1
            Protein required for fermentation at low temperature
          Length = 3006

 Score =  702 bits (1811), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 431/1328 (32%), Positives = 687/1328 (51%), Gaps = 52/1328 (3%)

Query: 148  RFLPVEFLHNKGAIVLGNKQTHSVAIMNYEKLAGTVSIEVPDDTRAPSSFRTEAKISNCT 207
            RFLP++    + ++VLGN+ T S+ +++ +   G + +  P +       + E ++ +  
Sbjct: 260  RFLPIQISTRRFSLVLGNRFTPSILVVSAKNSKGIIDLCPPKEKLDLFKIKLEKELYDVD 319

Query: 208  VAIKPNISYEVDNPVKIYVEPKRTARLWKKYKTLLGTVLEATLHAKRKKEQHQTPKWYDN 267
             ++K NI ++ D          R ++LW+K+  +    L  TL  K  + Q     + +N
Sbjct: 320  ASVKQNIGFDDDISTSFKWTRGRLSKLWQKFARIF---LLPTLGPKHLQTQEDI-TFREN 375

Query: 268  WRGLSMYDVNXXXXXXXXVKFDIEHHEYAKCTTVLKADQMDVTYSYGMPGTARVTDSDNA 327
            W+GLS+Y  N        V FD  +HEYA+  ++LK+ ++  TY Y +PG       +  
Sbjct: 376  WKGLSLYRQNMEEDELENVDFDFANHEYARVISILKSAKIVFTYEYDIPGLVPKEPEETL 435

Query: 328  ENPLLER----PELDHSVDILVYDANCTYGPWANRQVQQCLRVFSPTVCRNFKLRTPEEI 383
            + P +      PE    VDI +Y AN  YGPWA RQ+     + SP V R     TP+ I
Sbjct: 436  QGPEVGNSGAPPEF--GVDIQLYGANICYGPWAERQLSYLRALLSPVVSR-----TPKPI 488

Query: 384  AQQTEPAA-----FKLSVTIMEDSVLRVPMKESSKDAAFLEKYKQTRDETRPFGWIDIRI 438
               T  +      FK S++IME+S  R+P +E SKD  FL  Y +T++E RPFGWID++ 
Sbjct: 489  KTLTPGSQRIYTIFKTSISIMEESTWRIPTREKSKDQEFLRHYVETKEEFRPFGWIDLKF 548

Query: 439  AKESNITVRMAAYPTENGFENILHANLVDTTISTSVNHDTLLKAKSHDITVDFSYPYGWQ 498
             K+S   +     PTE G  N ++ +  +  I TSVNH+ LL+AKS D   D  YP GW 
Sbjct: 549  MKDSYGILDTVICPTEEGSPNNVNFHFSNMEIRTSVNHELLLRAKSFDFEADMGYPLGWN 608

Query: 499  DKAEWNFNVCSTQAELFVLRDHVYLISDLVTDFSGGEEVLYEQFRPFDYRFRWDIRGYSA 558
            D+A WN N+ STQ E+F+LR+H+ LISD+  DFS G+   YE FRPF YR  W++ GYS 
Sbjct: 609  DQANWNINLSSTQLEIFILREHITLISDVFADFSSGDPTPYELFRPFIYRINWNLDGYSI 668

Query: 559  YLNVNDANIINNPIDFGENCYLSVHGDDAEITFSLPITSIIQKYVTVDFNIFTPHFSLFL 618
            YLNVND NI+NNP+DF ENCYLS+HGD       +P  ++  +   + ++I TP F L L
Sbjct: 669  YLNVNDHNIVNNPLDFNENCYLSLHGDHLIFDVKIPRQTVANRCTEITYHISTPMFRLLL 728

Query: 619  NAPPWHTFSELLHYKEIGRSKNFNIKGSYTSYSEVDVDNVDALNIACETDYIVVLCYGVI 678
            N PPW+T +E +  KE+GRS NF + G YT +SE+D+DNVD +++ C +    + CYG +
Sbjct: 729  NTPPWNTLNEFMKNKEVGRSYNFQVNGLYTVFSELDIDNVDTISVECSSFGTTLHCYGFV 788

Query: 679  LKCMLNVKVNYFGEMVHFRTTEEYVEELQRRNKQNPSTCRPFNSDGNVHDSDVVATESNE 738
            ++ ++NVK+NYFG+  HF T EEY         +N +     +S  N+  ++ V T+   
Sbjct: 789  VRYLMNVKMNYFGDFSHFVTAEEYTNANHTEEPKNENLGDE-HSGFNISSTEDVETDRTN 847

Query: 739  IIDASFDAFGGPPTIKKSALKRSINELDVWFTFISKGGCFFFPENIYKFDACLGFYFDNL 798
                   A  G P  K+S LKR+ NE+D+WF F    G    PE IY  D C+  +F+ L
Sbjct: 848  --PEGRPANKGIPMPKRSELKRTENEMDIWFVFSVWEGALILPETIYNSDPCIALHFNEL 905

Query: 799  EASLRFLNYYVDAAVSLDSIYFKRHTDIDARTLFKVIEDIGIPIDASDAYLSQFSFRLHK 858
            E  LR  NYY+D   ++++   KR+       LF+ +       + S  YLS  +   H+
Sbjct: 906  EVDLRSTNYYMDLLATMNNTELKRYVSRHPHDLFECVRKDNGRQEKSHGYLSSLTIHGHR 965

Query: 859  MLGIMPSEESYACEFDVRVDTLDVHCDLAVLKAFVNTLRNLAFGFKDVENSLQYEREQVF 918
            M G+ P+E +Y C++ V +D L+++ DL   K F+     + FGFK++EN L YE   +F
Sbjct: 966  MYGLPPTEPTYFCQWGVDIDRLEINSDLEFAKGFLTCFSKIGFGFKNLENILLYETNTLF 1025

Query: 919  DLNKISCVIENVTVKLQNVDKDEDIWLSLNLPVTTLTSFDLANERYSRRSDLSIPELLFG 978
            D+  ++  ++   +K    D D      L+    T T+ D  NE YS+R D   P++ F 
Sbjct: 1026 DMTSVTVRVKE--LKFMMNDADTSSRSVLHAKKITFTAIDFENEAYSQRVDFKFPDINFL 1083

Query: 979  IYRGD---SESTCLGAFSTGVTVTLFERFEQFARCRVLQRKHILVNDAPFHRCSFMLPPE 1035
            I+  D    E   L    T +  T F + + FA  R  QR++I ++D+ ++RCSF+LP  
Sbjct: 1084 IFELDENQKEGRFLLHLKTQLNFTDFIQNQAFADHRYRQREYITLHDSAYYRCSFLLPCF 1143

Query: 1036 YKKMPIYRSLYGCXXXXXXXXXXXXXXXADNFEVIFEKLLGEIYQEYASDSSYQITDDSI 1095
            +++  +Y+ L G                A+  + I E  LGE       D S        
Sbjct: 1144 FQESVLYKELLGSISPSATLPPLPLPVLAETIDYIIEDCLGEYAPTVKPDDSSSSDTSEG 1203

Query: 1096 SSTEHDYHNQTVNAAIG-TSSSLFIRSQNHQQTLSSFIVEFDPIDGYLDLSATEFMLE-I 1153
              T     +    A  G  S  +     N++   ++++++ + ++  +  S T  +L  +
Sbjct: 1204 QRTPLTNEDTRFQANSGFFSPHMPHNPPNNRDRYNNYVLDVEYVNLEVKPSVTGVLLNYL 1263

Query: 1154 YKYLTEVSLDEAIDSLEIGIINQFIQTFGEDNGISEVRVLCPNISLSATNKQSKFSMFKL 1213
             K+ TE + D  ID  EI I+ +        + ++  R+   ++      ++       L
Sbjct: 1264 KKFYTEDTTD-IIDKNEIAIVKKLGNLQYGASFVTTSRLHVKDLHFLYDFEEGSGVELAL 1322

Query: 1214 SSKIKNLDITSRIKSSDPNLKPDPEKTTLCYKIDYIRANIVQDGIVVPPKQPSQLFSCSI 1273
            +S     D   R K+ +   +    + T+   I  +R ++++        +P+ L   SI
Sbjct: 1323 NS----FDFDLRRKTIENEDEKVILEKTMFSNIHTLRISLLEAHPSSISMKPAAL-QLSI 1377

Query: 1274 ELLEGYLSYDKLSLLDNNVQSCSVTLSPGT-DKLLFEFLNPFI-STFDLLQRELSS---F 1328
            E LE +      S +D NV S +VT    T D+   E ++ ++     +L+  ++S    
Sbjct: 1378 EDLELW-----SSTVDENVNSVNVTSFGFTLDESQLERISGYLFGQIKVLRDTITSAKEL 1432

Query: 1329 EDTLLASKREFLLNILRGGRDYEIQHDPPVITKPANITRFSNRHIRSAESWRIIMRLRHI 1388
            E+    ++++ + ++      Y+I HDP VITKPA I R S  H+R   SWRII RLRHI
Sbjct: 1433 ENLRKKTQKDLICDLTSASEYYQISHDPYVITKPAFIMRLSEGHVRENRSWRIITRLRHI 1492

Query: 1389 LNYLPQEWHQSFTRHLGT-QDFTSPEEAGKE---FLSIFSDWRSWEPTDVQGSFVHEKVF 1444
            L YLP +W  +   HL T QD  +P    ++   F+S+FS+WR+W+ +D+  S++++K+F
Sbjct: 1493 LTYLPNDWRTA--DHLVTVQDSENPNVPQRDEDIFVSVFSNWRNWDLSDITRSYIYKKIF 1550

Query: 1445 TKKRSRPF 1452
              +    F
Sbjct: 1551 LPQNEDSF 1558

 Score =  525 bits (1351), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 382/1247 (30%), Positives = 608/1247 (48%), Gaps = 76/1247 (6%)

Query: 1673 DEIKYLVEALVPELFAEPPIERESSGNKIHAVL-----FQGQVANITLKLQILSPFIILY 1727
            ++IK  VE L+P+ F    ++  S+  K    +      +    +++ ++ +LSPF +L 
Sbjct: 1803 EKIKRQVEVLIPQ-FKSHEVKNSSAVTKKTPRIPIKFDIRFNFTDMSSEIMLLSPFYLLQ 1861

Query: 1728 CAENFELQAESTDSVIFDLNSGESYMEISSAKQKLDYFKYTHTCLKLSGTSSSARL-FEH 1786
              +   + A   +++   L   E  + + S      +FK++ T L+     +   +    
Sbjct: 1862 DVKQLHIYASGHENMELVLGFLEYDVYLKSQLSSEQFFKFSSTDLQFKCEVADEVVPVVE 1921

Query: 1787 ISCDIGILKLSVFDLKTRITDLLQDIKAALFSMKSLSDILNISQSSP-----TASAFGSW 1841
            +     ++KL++ + +  + +LLQD +  + S+  +  + N  +S+      + S    W
Sbjct: 1922 VQISTSLMKLTLCEPRRALHNLLQDEQTLVESVDHIQKLWNFLRSASGGNDRSPSRNTRW 1981

Query: 1842 FSILPDNLSLQATYAGLLLGFGHTLYILEFNNFEAKHTRDGLPDAITPRPCFKVDHSIES 1901
                   L     Y GLL+      YI E ++  A  T          R  F     +ES
Sbjct: 1982 ------ALDANLKYFGLLVPVSSICYIFELHSLFASLTNANEQYEEYDRH-FSGQIVVES 2034

Query: 1902 ASFLIKDRRIDDRLAKVVDFAVNFNMVHDTDLCIQSVQIESTHLKITLAPMTVVRLL--- 1958
               L+K+  +   L+KV+DF++ F         +QS QIES++ ++ L P  +V +L   
Sbjct: 2035 CYLLVKELSLPANLSKVLDFSIRFLTSQKVPNSLQSYQIESSYFRLCLFPELLVDILWSV 2094

Query: 1959 ----SLINEFGIIRKQFTEESIYTPSSAHNNSTATECLEPSVWRLIIKSGHILSHDFSIV 2014
                SL+N F   +K  T    + P S++  + + E        L  +S HILS++F + 
Sbjct: 2095 HYLQSLLNHF---KKHHTP---WLPYSSNKTAKSGEST------LDFRSIHILSYNFCVG 2142

Query: 2015 WLFDIPNSSADGLICGYDRLFSVYEKPYGKLTLLNAYFSAAKILASEADFYSSVVRKQRI 2074
            WLF++ ++S  GLI GYDRLFS YEK +GKLTL++ Y S A    S+  FYS    K   
Sbjct: 2143 WLFEVGDNSEPGLILGYDRLFSAYEKHFGKLTLIDGYLSVANGNTSDT-FYSQKSEKDSY 2201

Query: 2075 NTSYLSDMQLRYWFTEDSENTDLFIRIHGAKLAVDISAEIVTLLEETIQSIQTFNNLKKA 2134
              +YLS+MQ+ YW   ++   DLF+R HG  + V   +    L+E+T+ SI+ FN +KKA
Sbjct: 2202 TRTYLSNMQIFYWLKGENLLKDLFVRFHGEVIDVRFLSTSFKLVEKTLHSIKRFNEMKKA 2261

Query: 2135 LVDPFRTKKQDSDISKEPYNW---NNQLA---TGVRSLNCIINYAGVTLKLHS-HDGRGD 2187
             +      KQ    +K   N    +N LA     +R++N  +N+AG   K++S  +    
Sbjct: 2262 KI------KQTGSSTKSKLNMEAASNTLAPFLAHIRTINSQLNFAGGVFKVYSPTELDSK 2315

Query: 2188 ASPL-ELTSPSYKVAIDYKYFPNLEKTHRFRTLITATPTHNTFYSTSAFLIHDLCYRFXX 2246
            A PL E+ SP  ++AI+Y++    EK+H  R   T  PTHN  ++  A L+ D  +    
Sbjct: 2316 AEPLLEIKSPGVQMAINYEFNETREKSHCIRFFTTIEPTHNMLFAKCAPLLSDFNHNIKN 2375

Query: 2247 XXXXXXXXXXXXXXXXXXXIKVEGSDNSTLLGSIDLVIILNVGKQEVTFSCEPKAKVQAT 2306
                                  +  D  +LL   D+   +  GKQ+++FSCEPKAKVQ  
Sbjct: 2376 MIRNLSSEDKSHPSKPV----TDSIDYKSLLNPYDIAFEIASGKQKLSFSCEPKAKVQLD 2431

Query: 2307 VGXXXXXXXXXXXXXXXXXSLCLAIEIENLMTNSRHIYSREVCASLKLRHISMVFDIMGS 2366
             G                    ++  ++ + ++ RHI+SR+  A+  L +I +V   M  
Sbjct: 2432 AGFNSFLFRVTTDKVDSVEPFNVSFSMDKIESSVRHIFSRDSSAAFMLDYIDIV---MMF 2488

Query: 2367 QVRRIYGSTLISSPLFYFNMKQLQDLKLFIDQWFPQKTPMNTGSYPEGVLVDDISRXXXX 2426
                +YG  L+S    Y NMKQ Q+L +F+D W   +      + P     +D S     
Sbjct: 2489 TYPNVYGVALVSDMNIYCNMKQRQNLNIFLDIW---RLSNRGRTKPSENKAEDKSDAKKS 2545

Query: 2427 XXXXXXXXXXXXXXX-----XVIVAGSCAEIELGPSLGVLNVTSEDVWAISKQQVDWSQQ 2481
                                 +I       ++LGPSLGVL +  E VW  +K Q D  + 
Sbjct: 2546 LSPPFSPSSNDSRKVFPWSFTIIFTNMGGVVDLGPSLGVLTLGLEQVWITTKHQGDQKRT 2605

Query: 2482 LDLNMGKLDVTSSGRLGGNFLVRNAHLSLELKWPNPKDFFQV-PLVCVKLGSDTVDTKLS 2540
                   + V S GRL G F +  A    E+ WP  +D  +V PL+ V +  + +  K +
Sbjct: 2606 WHTFAHGITVNSEGRLSGMFELDQASSVSEISWPE-EDLLRVGPLISVSMAINRMSIKSA 2664

Query: 2541 FDYHTFFISSLKQGYASLFNERDEDGSLADLLSVTVSFESVNIFLTALAAANISDIKNSI 2600
            FDYH F I S+K     L NE D    L DLL V++ FES+ +  TAL AAN  DI N+I
Sbjct: 2665 FDYHMFLIGSMKSVKVHLHNESDTYAILPDLLQVSLEFESIVLCATALTAANALDIYNTI 2724

Query: 2601 TRLKKDNELSYLSSFLASD-QPSDEPEEDGGIFDXXXXXXXXXXXXXGVFRLQISPTSLF 2659
             R+++DN +SY+ +   S+   S        + +                ++ ISP SLF
Sbjct: 2725 MRMQQDNRISYIETLKESNISASSTSVAYEEVLNSLNLLRTDMSVIVKELKVHISPMSLF 2784

Query: 2660 DSDVLILTATKMMANTGIQADIKIKTDLHWQLDDVSLALLPFNNSLDESYLATMEVGKYI 2719
            D++VL+++   + A +  Q+  K+KT+L  Q+ DV+ +L      LDE  ++ + V  Y+
Sbjct: 2785 DAEVLVVSVRDVNARSETQSGEKLKTELQLQISDVNASLSSSKEELDEETVSKIAVDDYM 2844

Query: 2720 ELSSTIQGGAIFSAPSIVVNMTTWQEPQSNVIELLYSTSFGGTVKIRWNLGPISFIKDMW 2779
              +S   GG I   P ++V+MTTWQ+  S V+E L++  F   + ++WNLGP++FIK+MW
Sbjct: 2845 LYASKFSGGTIIKLPQLLVSMTTWQQQSSPVLEYLFTCKFFDKISMKWNLGPVNFIKEMW 2904

Query: 2780 QAHMNAMQLREGYYHGLAESGVAVTPLNSKAVPLEMHLGSDYQYLPLQEPDIEMPRIKDL 2839
              H+ ++ +R     G +   + V   + K    E  + S + Y+PL EP IEMP+IKDL
Sbjct: 2905 ATHVRSLAVRRTQL-GNSSPELEVANESDK----EDTVKSKFIYVPLDEPYIEMPQIKDL 2959

Query: 2840 GDATPPIEWFGVNRTKFPGFTHQFVIVPLQKLARTAEKEYEKILGRA 2886
            GDATPP+EWFGV+R   P  THQ  ++ +QKL  TAEKEY K+  RA
Sbjct: 2960 GDATPPLEWFGVHRKNLPAATHQTAVLLIQKLVHTAEKEYAKLQQRA 3006

 Score = 94.7 bits (234), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 45/136 (33%), Positives = 72/136 (52%), Gaps = 19/136 (13%)

Query: 5   AIFYVGRVLGYIVSKAANLVLWKQYRVTVSIQSLVFSPLAGKVHFKNVSVTSQDQLISVL 64
            IFY+GR+ G++++     V+WK+ +V ++I+SL  +PL G + F+N+ +  +D  IS L
Sbjct: 36  VIFYLGRIFGFLLTFILEWVVWKRCKVKINIESLRIAPLGGNIMFRNLCIIHRDYTISCL 95

Query: 65  KGTITWRYWLIGRYR-----------------RSGTADGARR--CRFALKFEGFEYFVYN 105
           +GTI WRYWL    +                 +   ++  R+  CRF L  EG E FVYN
Sbjct: 96  EGTINWRYWLFNSRKSQYQENLDNEEERLENGQEPKSNSGRKHPCRFLLACEGLEIFVYN 155

Query: 106 RNGVYDRIARELDGED 121
           +   Y+ I      E+
Sbjct: 156 KTSSYENIIHMFSKEE 171

>KNAG0G02030 Chr7 complement(453579..462575) [8997 bp, 2998 aa] {ON}
            Anc_8.260 YLR087C
          Length = 2998

 Score =  698 bits (1801), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 413/1330 (31%), Positives = 678/1330 (50%), Gaps = 62/1330 (4%)

Query: 145  LIRRFLPVEFLHNKGAIVLGNKQTHSVAIMNYEKLAGTVSIEVPDDTRAPSSFRTEAKIS 204
            L   +LP++   +  + V+GNK T S+ I++ +   G +    P +       +      
Sbjct: 236  LFLNYLPLQIKVSHASYVVGNKFTPSLLIVSADSAEGVMDYCQPKEKLDIYKTKLTMDAK 295

Query: 205  NCTVAIKPNISYEVDNPVKIYVEPKRTARLWKKYKTLLGTVLEAT-LHAKRKKEQHQTPK 263
            N +V++K NI Y  +  +K  +   + ++LW  +      V +   L  K+K     T  
Sbjct: 296  NVSVSLKQNIGYNEEVLLKFKLTTGKLSKLWDNFVKATAFVRKPLGLSRKKKNRPSVTAN 355

Query: 264  WYDNWRGLSMYD---VNXXXXXXXXVKFDIEHHEYAKCTTVLKADQMDVTYSYGMPGTAR 320
            ++  WRGLS+Y              ++FD+  HEYAK T+++K  +  +TY + +PG   
Sbjct: 356  FHQKWRGLSLYKNYMFEDVQNDLDDIEFDLAGHEYAKFTSIIKCPRAILTYEFDIPGFV- 414

Query: 321  VTDSDNAENPLL---ERPELDHS-------VDILVYDANCTYGPWANRQVQQCLRVFSPT 370
                 +  +P L   + P++ ++       ++I ++  +  YGPWA RQV     + +P 
Sbjct: 415  ----PHGAHPTLSSIDGPDIGNNGAPPTFGLEIQLFGGSLCYGPWAQRQVAFIQSLLAPQ 470

Query: 371  VCRNFKLRTPEEIAQQTEPAAFKLSVTIMEDSVLRVPMKESSKDAAFLEKYKQTRDETRP 430
            + R+ K   P +  ++     FKL + + ED   R+P +ESSKDA FL  YK T ++ RP
Sbjct: 471  ISRDQKPVKPLQPGERRMYTLFKLGIVVNEDITWRIPTRESSKDAEFLRHYKNTNEDYRP 530

Query: 431  FGWIDIRIAKESNITVRMAAYPTENGFENILHANLVDTTISTSVNHDTLLKAKSHDITVD 490
            FGW+D++ +K+S  +   A   T +G +N +  +L D+ I +SVNHD  +K+KS D  ++
Sbjct: 531  FGWLDLKFSKDSYASFNFALCSTADGSQNTMKIHLGDSEIRSSVNHDIFIKSKSLDFDLN 590

Query: 491  FSYPYGWQDKAEWNFNVCSTQAELFVLRDHVYLISDLVTDFSGGEEVLYEQFRPFDYRFR 550
              +P GW +KA+W  NV S+Q E F+LR+H+ LI+D ++DFS GE   YE FRPF Y   
Sbjct: 591  LGFPLGWNEKAKWTINVASSQLETFLLREHITLIADTMSDFSTGEPTPYELFRPFLYTIN 650

Query: 551  WDIRGYSAYLNVNDANIINNPIDFGENCYLSVHGDDAEITFSLPITSIIQKYVTVDFNIF 610
            W + GYS YLNVND NI+NNP+DF ENCYLS HGD   +  ++P   I  +   + +NI+
Sbjct: 651  WKLDGYSIYLNVNDHNIVNNPLDFNENCYLSFHGDILNVDITVPKDRIDARATDISYNIY 710

Query: 611  TPHFSLFLNAPPWHTFSELLHYKEIGRSKNFNIKGSYTSYSEVDVDNVDALNIACETDYI 670
            TP F L LNAPPW+T +E + +KE+GR+ +F   G+Y  Y+E+DVDNVD + I C +   
Sbjct: 711  TPMFRLMLNAPPWNTLNEFMKHKEVGRAYDFRTTGNYLIYNELDVDNVDMITIICSSKST 770

Query: 671  VVLCYGVILKCMLNVKVNYFGEMVHFRTTEEYVEELQRRNKQNPSTCRPFNSDGNVHDSD 730
            V+ CYG +++ ++N+K+NYFG+  HF T+EEY E++  +     S    ++ D +   SD
Sbjct: 771  VLHCYGFVIRYLMNIKMNYFGDFFHFVTSEEYTEKISSKGYGEGSLFEKYSDDASTFVSD 830

Query: 731  VVATESNEIIDASFDAFGGPPTIKKSALKRSINELDVWFTFISKGGCFFFPENIYKFDAC 790
                + N   D       GP  +     +R  NE D+W TF    G    PE IY  D C
Sbjct: 831  F---DKNNEEDDKVKVPRGPADV-----RRKTNETDLWLTFNIWEGALLLPETIYNCDPC 882

Query: 791  LGFYFDNLEASLRFLNYYVDAAVSLDSIYFKRHTDIDARTLFKVIEDIGIPIDASDAYLS 850
            +  +F  L   +R  NYY+D   SLD I  ++++++    +F+ +           +Y+S
Sbjct: 883  IALHFGELAIDVRSTNYYMDLLASLDDIILRQYSNVQPNEIFENVRQCNGRDVKGHSYIS 942

Query: 851  QFSFRLHKMLGIMPSEESYACEFDVRVDTLDVHCDLAVLKAFVNTLRNLAFGFKDVENSL 910
              +   H+M G+ P+E +Y C++D  + T+ +  ++  +K  V + + + FGF D+EN L
Sbjct: 943  NINIHGHRMYGLPPTEPTYFCKWDFDLGTIKLESEVDFMKGLVTSFQKIGFGFDDLENVL 1002

Query: 911  QYEREQVFDLNKISCVIENVTVKLQNVDKDEDIWLSLNLPVTTLTSFDLANERYSRRSDL 970
             YE+E V D+  ++  +++  + + N +      L LN       + D  NE+YS R D+
Sbjct: 1003 LYEKEVVDDMTAVTVNVKDFKIIIHNPELHSRAELILN--NMQFCNIDFENEKYSTRMDI 1060

Query: 971  SIPELLFGIYRGDSEST---CLGAFSTGVTVTLFERFEQFARCRVLQRKHILVNDAPFHR 1027
             IP L   +Y  + E++       F T +  T F  ++   + R LQR +I +NDAPFHR
Sbjct: 1061 RIPLLKLSLYGYNYEASKELSFFNFETKINFTNFCNYKNCVQHRALQRDYITMNDAPFHR 1120

Query: 1028 CSFMLPPEYKKMPIYRSLYGCXXXXXXXXXXXXXXXADNFEVIFEKLLGEIYQEYASDSS 1087
            C F+LP  Y+   IY+ LYG                 + FE I +  L     EY + S 
Sbjct: 1121 CGFILPASYQNSVIYQKLYGSIVPSSSLPPLPLPLLEETFEFIIQDFL----HEYNTTSD 1176

Query: 1088 YQITD----DSISSTEHDYHNQTVNAAIGTSSSLFIRSQNHQQTLSSFIVEFDPIDGYLD 1143
              I +    DS +     +++    A    S ++  +S   +    +++++F  I   +D
Sbjct: 1177 CIILNLPYPDSTNLNSDSFNSYPDTAPHTLSDTIIRKSPLPEDERDNYVIDFRYISISID 1236

Query: 1144 LSATEFMLEIYKYLTEVSLD---EAIDSLEIGIINQFIQTFGEDNGIS-----EVRVLCP 1195
                E    I K L     D   + IDS+EIG++ + +  F E  GIS     ++R+L  
Sbjct: 1237 ---PELFFYIEKLLNHFYGDDDTQVIDSIEIGLVKR-LSNFQE--GISSINNFKIRILFF 1290

Query: 1196 NISLSATNKQSKFSMFKLSSKIKNLDITSRIKSSDPNLKPDPEKTTLCYKIDYIRANI-V 1254
            ++     +         +   +  LD     KS + N +    + T   K++ IRA++  
Sbjct: 1291 DVFWGQRDTGG------IELYLDTLDFEMNEKSIEKNREKSLTEVTTLMKLNSIRASVNA 1344

Query: 1255 QDGIVVPPKQPSQLFSCSIELLEGYLSYDKLSLLDNNVQSCSVTLSPGTDKLLFEFLNPF 1314
            +        QP  L S  +E ++ + +  K  +    + S   T+       LF F    
Sbjct: 1345 KYSRGKTEGQPPAL-SLMVEGVKFWSTTAKKVINSIILTSIDATIDETQVVWLFNFFGDQ 1403

Query: 1315 ISTFDLLQRELSSFEDTLLASKREFLLNILRGGRDYEIQHDPPVITKPANITRFSNRHIR 1374
                  + +     +     S++E +  +      Y+I HDP VITKPA ITR S  H+R
Sbjct: 1404 KELIGSVVKTFEKVQKLRTQSRKELISRLTVASEYYQISHDPYVITKPAFITRLSRGHVR 1463

Query: 1375 SAESWRIIMRLRHILNYLPQEWHQSFTRHLGTQDFTSPEEAGKEFLSIFSDWRSWEPTDV 1434
               SW+II RLRHI+ YLP +W+++  + L  + + + ++A   F+S+FS WR+WE +DV
Sbjct: 1464 ENRSWKIITRLRHIMTYLPDDWNETVAKQLKERKYNASKDAKSIFMSVFSSWRNWEFSDV 1523

Query: 1435 QGSFVHEKVF 1444
              S+++ KVF
Sbjct: 1524 ARSYIYNKVF 1533

 Score =  498 bits (1282), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 368/1225 (30%), Positives = 573/1225 (46%), Gaps = 82/1225 (6%)

Query: 1711 ANITLKLQILSPFIILYCAENFELQAESTDSVIFDLNSGESYMEISSAKQKLDYFKYTHT 1770
            +N++L +  + PF      +  E +  S  +  F  N  +S + + S   K  YF+ +  
Sbjct: 1806 SNVSLDIMPIVPFQFRQETKKMEFKFSSQRTQNFQFNIWDSDLYLGSHLTKQQYFRLSLG 1865

Query: 1771 CLKLSGTSSS-ARLFEHISCDIGILKLSVFDLKTRITDLLQDIKAALFSMKSLSDILNIS 1829
             + +  T+        ++     I+KL+  +    +   LQD +    S+K L  + N+ 
Sbjct: 1866 NIIVGYTNGRLVNTIHNLDVSASIVKLTFSEPHRMLFSFLQDEREVSRSVKKLQVLGNLF 1925

Query: 1830 QSSPT-----ASAFGSWFSILPDNLSLQATYAGLLLGFGHTLYILEFNNFEAKHTRDGLP 1884
             S P      A A   W       L+    Y G+L+    T ++ E +   A      L 
Sbjct: 1926 SSEPEINTIPAGAKIDW------RLNADIKYLGILIPVSTTFFVFEMHTLLA-----SLA 1974

Query: 1885 DAITPRPCFKVDH-----SIESASFLIKDRRIDDRLAKVVDFAVNFNMVHDTDLCIQSVQ 1939
            D        + D      S+++  FLIKDR I   L++++D +   + +        S Q
Sbjct: 1975 DVDYGEIYREADEASGQVSVDNILFLIKDRTIPSTLSRIIDLSFKISAIQKIMESHHSYQ 2034

Query: 1940 IESTHLKITLAPMTVVRLLSLINEFGIIRKQFTE---ESIYTPSSAHNNSTATECLEPSV 1996
            IES HL+   +P ++VR+L   ++   +   +     ++++            +      
Sbjct: 2035 IESPHLRFCFSPYSLVRILWGGHQLLALHSHYRRHHSKNLWDFLPKKEKKVEEDKTTSFF 2094

Query: 1997 WRLIIKSGHILSHDFSIVWLFDIPNSSADGLICGYDRLFSVYEKPYGKLTLLNAYFSAAK 2056
              L   S HILS++F + WLF     +  GLI GY+RLFS YEK  GKLTL++A+FS + 
Sbjct: 2095 STLTFGSCHILSYNFCVGWLFQNNGDTDAGLILGYNRLFSAYEKGCGKLTLVDAFFSVSN 2154

Query: 2057 ILASEADFYSSVVRKQRINTSYLSDMQLRYWFTEDSENTDLFIRIHGAKLAVDISAEIVT 2116
               S+  FYS    + + N S+L ++Q+ YW    +E  D+FIR+HG  L V+  +  V 
Sbjct: 2155 GRTSDT-FYSDGNEEDKYNRSFLPNLQIIYWLKAAAEMKDVFIRLHGETLDVNFLSSFVK 2213

Query: 2117 LLEETIQSIQTFNNLKKALVDPF-------------------------RTKKQDSDISKE 2151
            ++E T+QSIQ F  LKK LV+P                          + KK+D+     
Sbjct: 2214 IIEATLQSIQVFQELKKVLVNPLTQSEARSEEEEEESEEHNRRETVPGKEKKEDA----- 2268

Query: 2152 PYNWNNQLATGVRSLNCIINYAGVTLKLHS-HDGRGDASP-LELTSPSYKVAIDYKYFPN 2209
            P        + +R +NC   Y G   K++S  D   +  P  E+ SP   + +DYK    
Sbjct: 2269 PRKDIAPFLSDIRKVNCQFKYDGGIFKVYSFEDIESNLDPSFEIRSPGVTIDLDYKNNIG 2328

Query: 2210 LEKTHRFRTLITATPTHNTFYSTSAFLIHDLCYRFXXXXXXXXXXXXXXXXXXXXXIKVE 2269
              K H  RTLIT   THN  ++  A L+  L                            +
Sbjct: 2329 DVKPHLIRTLITVNSTHNVLFARCAPLLMALSQDIQHMVKKHSSKKKPEPKQRVSR-PSQ 2387

Query: 2270 GSDNSTLLGSIDLVIILNVGKQEVTFSCEPKAKVQATVGXXXXXXXXXXXXXXXXXSLCL 2329
              D   LL S D++  +   +Q+++ SCEPKAKVQA VG                  L  
Sbjct: 2388 NIDYKRLLNSFDILFKIISSEQKLSLSCEPKAKVQANVGFDSFMFAILTNDLDTSEPLSF 2447

Query: 2330 AIEIENLMTNSRHIYSREVCASLKLRHISMVFDIMGSQVRRIYGSTLISSPLFYFNMKQL 2389
            A+ ++N  +  RHI+SRE  AS  L  I + F      +  ++G+ LIS    YFN+KQL
Sbjct: 2448 ALVVKNTRSAIRHIFSREPSASFGLDLIDVTFMFTHPNIINMFGACLISDVEVYFNVKQL 2507

Query: 2390 QDLKLFIDQW----FPQKTPMNTGSYPEGVLVDDISRXXXXXXXXXXXXXXXXXXXXVIV 2445
            Q+L LF+D W      +  PM     PE    D                        +I 
Sbjct: 2508 QNLYLFLDIWKLSNLLRPKPMKK---PE----DHHVAIDAPPSSPMDVGNIIPWCFTLIF 2560

Query: 2446 AGSCAEIELGPSLGVLNVTSEDVWAISKQQVDWSQQLDLNMGKLDVTSSGRLGGNFLVRN 2505
            A    +++LGPSLG+L+++    W  S       Q L   + ++ +T+ GRL G   +  
Sbjct: 2561 ANINGKVDLGPSLGLLSLSMRKAWFASDHYESKRQLLHAYIDQIKLTAKGRLSGIVELDG 2620

Query: 2506 AHLSLELKWPNPKDFFQVPLVCVKLGSDTVDTKLSFDYHTFFISSLKQGYASLFNERDED 2565
            A  + E+ WP   D +  PLV +      +  K++FDYH F I ++      L +ERD  
Sbjct: 2621 ALWAAEVNWPKYDDPY--PLVALSFVISNISLKVAFDYHMFLIGTVLNTVFHLHSERDTS 2678

Query: 2566 GSLADLLSVTVSFESVNIFLTALAAANISDIKNSITRLKKDNELSYLSSFLASDQPSDEP 2625
            G + DLL V ++ E +++  TAL AAN+ D+ N+I R+++D  +SYL +   S+    + 
Sbjct: 2679 GFMPDLLKVMLTCEQIDMCSTALVAANLLDLYNTIMRMRQDTNVSYLETLRESNTTDTKE 2738

Query: 2626 EED-GGIFDXXXXXXXXXXXXXGVFRLQISPTSLFDSDVLILTATKMMANTGIQADIKIK 2684
              D   I                   +QISP SLFD +VL++    + AN    A  K++
Sbjct: 2739 TVDYKDILKVLNLIQTDVVVDINTLNVQISPISLFDVEVLVVNIANVCANVKTHAGEKLE 2798

Query: 2685 TDLHWQLDDVSLALLPFNNSLDESYLATMEVGKYIELSSTIQGGAIFSAPSIVVNMTTWQ 2744
            T LH QL +   +L      +DE  ++ + V  Y+  +S I GG IF  P + ++M T+Q
Sbjct: 2799 TYLHLQLYNAHGSLSSSKGEMDEDMVSKISVEDYMVYASKIVGGTIFDIPKLEISMHTFQ 2858

Query: 2745 EPQSNVIELLYSTSFGGTVKIRWNLGPISFIKDMWQAHMNAMQLREGYYHGLAESGVAVT 2804
            +  S+++E  Y ++FG  + +RWNLGP++FIK+MW  H+ A+ +R       ++S V  T
Sbjct: 2859 KSNSDILEYGYRSTFGDKIAVRWNLGPVNFIKEMWTTHIKALAVRR------SQSLVGTT 2912

Query: 2805 PLNSKAVPLEM---HLGSDYQYLPLQEPDIEMPRIKDLGDATPPIEWFGVNRTKFPGFTH 2861
                  V   M      S   Y+ ++EP I+ P+IKDLGDATP +EWFG+NR KFP FTH
Sbjct: 2913 GDEEGDVEKRMRDEETLSKLTYIAIEEPQIDTPQIKDLGDATPSLEWFGLNRKKFPIFTH 2972

Query: 2862 QFVIVPLQKLARTAEKEYEKILGRA 2886
            Q VIVP+QKL  +AEKEY  I+G +
Sbjct: 2973 QTVIVPVQKLIHSAEKEYANIVGHS 2997

 Score = 95.5 bits (236), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 52/135 (38%), Positives = 75/135 (55%), Gaps = 14/135 (10%)

Query: 1   MVIFAIFYVGRVLGYIVSKAANLVLWKQYRVTVSIQSLVFSPLAGKVHFKNVSVTSQDQL 60
           + I  +FYVGR + + +S  A  +LWK+YR+ V+I+SL  S L G++ FKN+++  +D  
Sbjct: 33  LSITVLFYVGRAIAWFISFIAEWLLWKRYRLKVNIESLRVSLLGGRIFFKNLTIIDKDYT 92

Query: 61  ISVLKGTITWRYWL----IGRYRRSGTA---DGAR-------RCRFALKFEGFEYFVYNR 106
           IS L G I+WRYWL    I ++     A   DGA         CR  L+ EG E F+YNR
Sbjct: 93  ISFLIGQISWRYWLFRPRIPQFLTELNAEDDDGASLQRNEKLACRLLLECEGVELFLYNR 152

Query: 107 NGVYDRIARELDGED 121
              YD   +    E+
Sbjct: 153 TVAYDNTIKMFSKEE 167

>KLLA0F19096g Chr6 complement(1762215..1770986) [8772 bp, 2923 aa]
            {ON} similar to uniprot|Q12150 Saccharomyces cerevisiae
            YLR087C CSF1 Protein required for fermentation at low
            temperature
          Length = 2923

 Score =  627 bits (1618), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 441/1523 (28%), Positives = 713/1523 (46%), Gaps = 120/1523 (7%)

Query: 1    MVIFAIFYVGRVLGYIVSKAANLVLWKQYRVTVSIQSLVFSPLAGKVHFKNVSVTSQDQL 60
            + I A FY+GR+L ++++K  +  +W+QY++ +++QS+  S L G++ FKN++V S D  
Sbjct: 32   LCILAPFYLGRILAWVLTKGLDFWVWRQYKIKINLQSIKVSFLGGRIFFKNLTVVSNDFT 91

Query: 61   ISVLKGTITWRYWLIGRYRRS---------GTADGARRCRFALKFEGFEYFVYNRNGVYD 111
            IS L+G+ TWRYWL+    R           + +    CRF L+ +G E FVYN+  VY+
Sbjct: 92   ISFLEGSFTWRYWLLHTRIRGIDFESEDGDASENAKLPCRFLLQCDGLEVFVYNKIDVYE 151

Query: 112  RIARE------LDGEDXXXXXXXXXXXXXXX---------------IAELQDDPLIR--- 147
             + R+       DG++                               ++  D P +    
Sbjct: 152  SVLRDHFTNVTKDGQETESNDDITINTEKAAANSKLSNSSRYSYSGRSKSTDAPKLSAKT 211

Query: 148  RFLPVEFLHNKGAIVLGNKQTHSVAIMNYEKLAGTVSI--EVPDDTRAPSSFRTEAKIS- 204
            +  P++   N+ AIVLGN+ T  V +  +E+  G   I   + D       +RT+  +  
Sbjct: 212  KLFPIQLEANRAAIVLGNRNTRHVGVFKFEQAKGVYDIFSSISD----LDYYRTKISLDL 267

Query: 205  -NCTVAIKPNISYEVDNPVKIYVEPKRTARLWKKYKTLLGTVLEATLHAKRKKEQHQTPK 263
             +    ++ N+ Y+ DNP+K +V  K   ++W+  K    ++ +  L  + K   +Q   
Sbjct: 268  YDALFELRTNLGYQNDNPIKTFVVEKTMDKIWQTVKKQCISISKLLLPNQGKTINNQQA- 326

Query: 264  WYDNWRGLSMYDVNXXXXXXXXVKFDIEHHEYAKCTTVLKADQMDVTYSYGMPGTARV-- 321
            + D+W+GL +Y               +   EYA+ + V+KA+++ +TY + +PG      
Sbjct: 327  YIDSWKGLDLYHHTKAVQEENVDTTVLHEQEYARYSRVMKAERVSLTYYFDIPGIVPANS 386

Query: 322  ------TDSDNAENPLLERPELDHSVDILVYDANCTYGPWANRQVQQCLRVFSPTVCRNF 375
                  +D D + N   +        DI +Y A   YGPWA++ +Q  +R+FSP V R+ 
Sbjct: 387  SSINSQSDRDESLNCNQDDDTPAFGTDIHIYTAAVYYGPWAHKHMQDIIRLFSPIVSRDQ 446

Query: 376  KLRTPEEIAQQTEPAAFKLSVTIMEDSVLRVPMKESSKDAAFLEKYKQTRDETRPFGWID 435
               T  E         FKLSV   + SVL +P +ESSKD  F+++YK T D  R FGW++
Sbjct: 447  MKATKPEPGSLRIYENFKLSVDFRDKSVLHIPTRESSKDEEFIKRYKTTGDTHRAFGWLN 506

Query: 436  IRIAKESNITVRMAAYPTENGFENILHANLVDTTISTSVNHDTLLKAKSHDITVDFSYPY 495
            + + +   I   +A     +   N L+  L++  I +SVNH+ L +  +  I  +  YP 
Sbjct: 507  VSLNEGGEILFNLALCSQADRLPNELYVLLLNPEIKSSVNHEVLFRCNTQTIKANIGYPT 566

Query: 496  GWQDKAEWNFNVCSTQAELFVLRDHVYLISDLVTDFSGGEEVLYEQFRPFDYRFRWDIRG 555
            GW  +A+W F + S  AELF+LRDH+ LISDL TDFS  + + YE FRPF Y  +W    
Sbjct: 567  GWNKQADWLFELDSRTAELFLLRDHISLISDLFTDFSANDALRYELFRPFTYEIKWVFTE 626

Query: 556  YSAYLNVNDANIINNPIDFGENCYLSVHGDDAEITFSLPITSIIQKYVTVDFNIFTPHFS 615
            Y  +LNVNDANIINN +D  ENC+LS+ GD    + +LP TSI+++     F + +P   
Sbjct: 627  YKLFLNVNDANIINNLLDLNENCFLSLSGDILNTSINLPFTSIVKEPHETTFLLKSPLVK 686

Query: 616  LFLNAPPWHTFSELLHYKEIGRSKNFNIKGSYTSYSEVDVDNVDALNIACETDYIVVLCY 675
            L ++ P W+T  E L     G   +F++ G+Y S+  VDVDN D + I   +     L +
Sbjct: 687  LSIHPPCWNTLHEFLSETTFGECPDFSMTGTYISFPSVDVDNTDTILIDFRSSSTKFLSF 746

Query: 676  GVILKCMLNVKVNYFGEMVHFRTTEEYVEELQRRNKQNPSTCRPFNSDGNVHDSDVVATE 735
            G +L+ ++N+K+NYFG+  HF+TTEEY  +L         T + F  +   +D + + + 
Sbjct: 747  GFVLRYLMNIKLNYFGDFNHFKTTEEYSNDLSMEEDTKTKT-KNF-QEQPTNDVESLTSS 804

Query: 736  SNEIIDASFDAFGGPPTIKKSALKRSINELDVWFTFISKGGCFFFPENIYKFDACLGFYF 795
            S++      D      TI KS+L R+ NE DVW TF    GC   PEN+Y         F
Sbjct: 805  SSDGSYQVADTI-NENTIHKSSLLRTKNETDVWITFFVNDGCIIIPENLYDCQRSFLLSF 863

Query: 796  DNLEASLRFLNYYVDAAVSLDSIYFKRHTDIDARTLFKVIEDIGIPIDASDAYLSQFSFR 855
              LE  +R+ NY++D       IY     +     +  + E        +  YL   +  
Sbjct: 864  RRLEFDMRYTNYFMDLTAFFSRIYLNHSNEFSFNRVVAIEESHS----ENTGYLDDLNLH 919

Query: 856  LHKMLGIMPSEESYACEFDVRVDTLDVHCDLAVLKAFVNTLRNLAFGFKDVENSLQYERE 915
             H+M G+ P EE+Y C++D+ + +L    D   L +F+  ++ + F +KD EN L Y   
Sbjct: 920  GHRMFGVPPVEETYLCKWDISIGSLSTDSDGQFLFSFLEAIQKVGFTYKDAENILIYSIH 979

Query: 916  QVFDLNKISCVIENVTVKLQNVDKDEDIWLSLNLPVTTLTSFDLANERYSRRSDLSIPEL 975
            +  D+  ++  I  V+  +   +      LSLN    T+ S+DL+N RYS+R DL +  +
Sbjct: 980  KPEDVTSLTISIGRVS-SIVRTNHGGSATLSLN--DITINSWDLSNSRYSKRVDLLVAAI 1036

Query: 976  LFGIYRGDSESTCLGAFSTGVTVTLFERFEQFARCRVLQRKHILVNDAPFHRCSFMLP-P 1034
               +   D + T L    T V +T F         RV Q+  +L+ND+PFHRC F+L   
Sbjct: 1037 --SVCAIDEKKTVLFTCDTAVELTKFVVRSNMKNHRVTQQNCVLLNDSPFHRCKFLLAFD 1094

Query: 1035 EYKKMPIYRSLYGCXXXXXXXXXXXXXXXADNFEVIFEKLLGEIYQEYASDS----SYQI 1090
            +     +Y  L G                   F+ I+E+LLG        D+    +  +
Sbjct: 1095 QLNHSTLYDDLLGSITPSISLPTLSEPLTFQTFDNIYERLLGSYINLINFDTDIIDTKNL 1154

Query: 1091 TDDSISSTEHDYHNQTVNAAIGTSSSLFIRSQNHQQTLSSFIVEFDPIDGYLDLSATEFM 1150
            TDD          + TV+  +    +    S+N    +S+  V   P       +A  FM
Sbjct: 1155 TDDRPDDKRLLPLSNTVSNDLSGQLAEEFESENTTVNISTLSVFVTPKAFTFAENAAHFM 1214

Query: 1151 LEIYKYLTEVSLDEAIDSLEIGIINQFIQTFGEDNGISEVRVLCPNISL-----SATNKQ 1205
            L +       S +  +D  E+ I+N F      +       V+  N+ +     +A +K 
Sbjct: 1215 LTM-------STESIMDYFEMNIVNIFSVGHITNGKFFNSSVMLKNVKVNISDETALDKT 1267

Query: 1206 SKFSMFKLSSKIKNLDITSRIKSSDPNLKPDPEKT------TLCYKIDYIRANIVQDG-- 1257
               ++ +L   + N+ + S+I     NL+   E T      T+    D ++ NI +    
Sbjct: 1268 QLEALDRLELSVSNISVISKILKYPQNLEQSNESTGITDDSTISCNFDSLQFNIFKSSKN 1327

Query: 1258 ---IVVPPKQ------PSQLFSCSIELLEGYLSYDKLSLLDNNVQSCSVTLSPGTDKLLF 1308
                V+P          + LFS   ++ +      K ++LD +V+     L     KL  
Sbjct: 1328 RLTKVLPIAWFEILMFNTVLFSDVGKVSKLIFGSIKSAILDADVEWTVEYLL----KLAK 1383

Query: 1309 EFLNPFISTFDLLQRELSSFEDTLLASKREFLLNILRGGRDYEIQHDPPVITKPANITRF 1368
             F     S  +L   +L S +       +E ++ +   G+   I   P +ITKPA ITR 
Sbjct: 1384 AFCKEGKSCIEL--GKLRSID------MKETIIRVAELGKISGIDSVPYIITKPAYITRL 1435

Query: 1369 SNRHIRSAESWRIIMRLRHILNYLPQEWHQSFTRHLGTQDFTSPEEA------GKEFLSI 1422
            S  H+R   SW+II RLRH+        H S      +Q    PEE         +FL I
Sbjct: 1436 SKFHVRDTASWKIITRLRHVSK------HTSHVSETTSQCDDIPEEVRNICKDKSQFLDI 1489

Query: 1423 FSDWRSWEPTDVQGSFVHEKVFT 1445
            F DW++W+  +V+ S +   +F+
Sbjct: 1490 FVDWKNWDVYEVEQSSLFTLLFS 1512

 Score =  594 bits (1531), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 388/1256 (30%), Positives = 635/1256 (50%), Gaps = 74/1256 (5%)

Query: 1654 IDSSSATTKDLTESLPYVRDEIKYL--VEALVPELFAEPPIERESSGNKIHAVLFQGQVA 1711
            +DSS  T   LTE + + R  +  +  ++A+ P+  +E     + +G+     +   +V 
Sbjct: 1717 LDSSDLT---LTEMMKHARALLASIDDMKAITPDHDSE-----KKNGHVDLVWVLSLKVG 1768

Query: 1712 NITLKLQILSPFIILYCAENFELQAESTDSVIFDLNSGESYMEISSAKQKLDYFKYTHTC 1771
            ++ L+     PFII       +   ++   +   +N  E  ++    + KL   + +++ 
Sbjct: 1769 SLQLQTSAFVPFIIRILISGLDFNFKNLSGISIIVNYTELLLDFYFNQLKL--LRISNSV 1826

Query: 1772 LKLSGTSSSARLFEHISCDIGILKLSVFDLKTRITDLLQDIKAALFSMKSLSDILNISQS 1831
             K+   S++  L   I  D  I+KL++ D +  I +L   +   +  +  +    N + +
Sbjct: 1827 TKVDYRSNT--LLTDIGLDTDIVKLTLSDNRVYIEELTDSLNGTVSELIKIFKNKN-ADN 1883

Query: 1832 SPTASAFGSWFSILPDNLSLQATYAGLLLGFGHTLYILEFNN--FEAKHTRDGLPDAITP 1889
             P A  F       P +  + A Y GLL     T Y+LEFN   F      + L +    
Sbjct: 1884 EPAAPKFK------PCSFKMNAIYIGLLTDLKTTNYVLEFNETAFSCASRAEALEETHAN 1937

Query: 1890 RPCFKVDHSIESASFLIKDRRIDDRLAKVVDFAVNFNMVHDTDLCIQSVQIESTHLKITL 1949
                ++   I++   L+ +  +   L+K+ D      ++ D     +++QIE+ H ++ L
Sbjct: 1938 DNLREMSLVIQNVCILVLNPEVLPTLSKIFDIGFALKLIEDD--IKKTLQIETPHSRVML 1995

Query: 1950 APMTVVRLLSLINEFGIIRKQFTEESIYTPSSAHNNSTATECLEPSVWRLIIKSGHILSH 2009
            AP T++ ++  I E  +  ++  ++  +  SS      A E   P  +  +  S +ILS+
Sbjct: 1996 APSTLIAVIFFIQEAKVSLQKVKQKGKFNSSS-----NAIEI--PPYFETL--SVNILSN 2046

Query: 2010 DFSIVWLFDIPNSSADGLICGYDRLFSVYEKPYGKLTLLNAYFSAAKILASEADFYSSVV 2069
               + W+F+  ++  +G++ GY+ LF+ YEKPYGKLT+++ Y + A+   S   F+++ V
Sbjct: 2047 KLCLGWIFE-EDTDENGIVIGYESLFAAYEKPYGKLTIVDGYVATAQGKESNNFFFANGV 2105

Query: 2070 RKQRINTSYLSDMQLRYWFTEDSENTDLFIRIHGAKLAVDI---SAEIVTLLEETIQSIQ 2126
             +  +N S+LS MQ+ +WF+      DLF+R++  KL V I   S EIV ++  +I+S Q
Sbjct: 2106 PE--LNRSHLSSMQINFWFSGQFIEKDLFVRMNADKLDVRILTTSVEIVNVMRSSIESFQ 2163

Query: 2127 TFNNLKKALVDPFRTKKQDSDISKEPYNWNNQLAT-GVRSLNCIINYAGVTLKLHSHDGR 2185
                  K L      KK          N +++++   +RS+NCI  Y G  + L++ D  
Sbjct: 2164 ------KKLAKISNIKKSSISTHNVAENLSDKVSILSIRSINCIAKYGGGIINLYTPDDI 2217

Query: 2186 GDASP---LELTSPSYKVAIDYKY-FPNLEKTHRFRTLITATPTHNTFYSTSAFLIHDLC 2241
               SP   LELTSPS +V++DY + FP+ +K H  R+L+    THN  +S+   ++ +L 
Sbjct: 2218 AQDSPKSSLELTSPSIEVSLDYMHNFPS-QKQHWIRSLVNVESTHNILFSSCVPVLVNLT 2276

Query: 2242 YRFXXXXX---XXXXXXXXXXXXXXXXIKVEGSDNSTLLGSIDLVIILNVGKQEVTFSCE 2298
                                        +    D   L   ID  I++NVG Q +T +CE
Sbjct: 2277 TEIQKQMERFNSEKKQLVHKTQEQTTNTQRISFDYKNLFKKIDTAIVINVGAQNITLTCE 2336

Query: 2299 PKAKVQATVGXXXXXXXXXXXXXXXXXSLCLAIEIENLMTNSRHIYSREVCASLKLRHIS 2358
            P+AK+QA +G                  L L+++   +  ++RHI+SRE+ +S  +  + 
Sbjct: 2337 PRAKIQADLGFSNFRISMFTDSPDHSEPLSLSLQWSEIEISTRHIFSREISSSAGINEVY 2396

Query: 2359 MVFDIMGSQVRRIYGSTLISSPLFYFNMKQLQDLKLFIDQWFPQ-KTPMNTGSYPEGVLV 2417
            + F +      + YG+TLIS   FY NMKQLQ++ LF+D W P+ K     GS P     
Sbjct: 2397 LDFMLTHENTIKTYGNTLISDMKFYVNMKQLQEITLFLDIWSPKTKKAQKLGSGPHS--- 2453

Query: 2418 DDISRXXXXXXXXXXXXXXXXXXXXVIVAGSCAEIELGPSLGVLNVTSEDVWAISKQQVD 2477
                +                    +I   + A I++ PSLG +N      W  S  +VD
Sbjct: 2454 ---GQKCQPQALTEFTTPKIPWIYQIIFKNTSAVIDMDPSLGSINFKVPTFWISSHHRVD 2510

Query: 2478 WSQQLDLNMGKLDVTSSGRLGGNFLVRNAHLSLELKWPNPKDFFQVPLVCVKLGSDTVDT 2537
            WS  +   + +L+  S GRLGG F ++N      + WP   + F+ PL+ +      + +
Sbjct: 2511 WSHSVSFYLDELNSKSDGRLGGLFEIKNIFFDSSISWPVKDNKFEAPLINLAFKMSHLSS 2570

Query: 2538 KLSFDYHTFFISSLKQGYASLFNERDEDGSLADLLSVTVSFESVNIFLTALAAANISDIK 2597
            K+ FDYH+F I+ +     ++ NERDE G L DLL V++SF SVNIFLTALA+AN+ DI 
Sbjct: 2571 KIGFDYHSFLIARVSDLQLAIRNERDESGLLKDLLIVSMSFGSVNIFLTALASANLYDIY 2630

Query: 2598 NSITRLKKDNELSYLSSFLASDQPSDEPEEDGGI------FDXXXXXXXXXXXXXGVFRL 2651
             +  R++ +N+ SY+ +   S+     PE  G I                     G FRL
Sbjct: 2631 ATFARMRIENKKSYVQTLKESN-----PESSGKIHFSNNELLAPLRLRTNLTAEIGSFRL 2685

Query: 2652 QISPTSLFDSDVLILTATKMMANTGIQADIKIKTDLHWQLDDVSLALLPFNNSLDESYLA 2711
             + P++LFDS+VL+L A KM      Q + K KTDL WQ+ D++++L  F N L E   A
Sbjct: 2686 YVFPSTLFDSEVLVLKANKMNVEAATQTEQKTKTDLTWQIRDINISLAQFKNELTEEQFA 2745

Query: 2712 TMEVGKYIELSSTIQGGAIFSAPSIVVNMTTWQEPQSNVIELLYSTSFGGTVKIRWNLGP 2771
             + V +Y   ++ ++G  I +APS+ V +TTWQ+     IE LYS+SFG  V I+WNL P
Sbjct: 2746 ELSVEEYNRQAALLEGDIILAAPSVFVGITTWQKIPDTDIEFLYSSSFGDKVDIKWNLDP 2805

Query: 2772 ISFIKDMWQAHMNAMQLREGYYHGLAESGVAVTPLNSKAVPLEMHLGSDYQYLPLQEPDI 2831
            I+FI++MW  H+ A+ +R G+               ++ + + ++LG+ Y+Y+PL+EP I
Sbjct: 2806 INFIREMWATHVRALSVRRGHTEPSPSKPFFEDENIAEKIKI-VNLGTKYKYIPLEEPHI 2864

Query: 2832 EMPRIKDLGDATPPIEWFGVNRTKFPGFTHQFVIVPLQKLARTAEKEYEKILGRAL 2887
            EMP ++DLG+ATPPIEWFGVNR +FPG  HQ ++VPLQKL   AE +Y + LG  L
Sbjct: 2865 EMPLLRDLGNATPPIEWFGVNRKRFPGMAHQLIVVPLQKLIYVAEDQYNRTLGDNL 2920

>TPHA0J00730 Chr10 complement(165253..174393) [9141 bp, 3046 aa] {ON}
            Anc_8.260 YLR087C
          Length = 3046

 Score =  624 bits (1610), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 405/1341 (30%), Positives = 658/1341 (49%), Gaps = 83/1341 (6%)

Query: 150  LPVEFLHNKGAIVLGNKQTHSVAIMNYEKLAGTVSIEVPDDTRAPSSFRTEAKISNCTVA 209
            LP++   NKGAI +GNK T S+ ++N+ +  G +   +PD        +   +I++  ++
Sbjct: 308  LPLDININKGAITIGNKFTRSLLVINFTEAHGLLDYALPDSKLDVFKNKVTFEINDIDMS 367

Query: 210  IKPNISYEVDNPVKIYVEPKRTARLWKKYKTLLGTV----LEATLHAKRKKEQHQTPKWY 265
            IK NI Y  +   +         R+W   + +L  +    L+    + R KE     K  
Sbjct: 368  IKRNIGYNPELASRFNFRAGVLTRIWSYLQLVLNLIPTGRLKTWYESLRYKEDTTFVK-- 425

Query: 266  DNWRGLSMYDVNXXXXXXX---XVKFDIEHHEYAKCTTVLKADQMDVTYSYGMPG----- 317
              W GL +Y  +           V FD  +HEYAK +   KA Q+  +    +PG     
Sbjct: 426  -KWDGLVLYKDSVKSSTKLGADDVDFDFANHEYAKVSNFFKAPQIIFSIESDIPGIVPHG 484

Query: 318  ------TARVTDSDNAENPLLERPELDHSVDILVYDANCTYGPWANRQVQQCLRVFSPTV 371
                   A   D  N E+P    P     +D+ +  A+  +G W NR +     +  P +
Sbjct: 485  SHPPLSKAHGPDIGNHESP----PTF--LIDLQLSHASIYFGSWVNRNIVDLRDLMFPVI 538

Query: 372  CRNFKLRTPEEIAQQTEPAAFKLSVTIMEDSVLRVPMKESSKDAAFLEKYKQTRDETRPF 431
             ++ K     +       + F  SV++++DS +R+P +E SKD+ FL++Y +T+D+ R F
Sbjct: 539  SKDQKPLNKLKPGLTRVHSMFNFSVSVLDDSSIRLPTREPSKDSDFLKQYLETKDDFRAF 598

Query: 432  GWIDIRIAKESNITVRMAAYPTENGFENILHANLVDTTISTSVNHDTLLKAKSHDITVDF 491
            GWID+   K S   + +   PT  GFEN L +   +  ++TSVNH+ L K+ S +I  + 
Sbjct: 599  GWIDLSFKKGSEFMLNIPMIPTSGGFENTLFSKFSELEVTTSVNHNLLFKSNSLNIAANI 658

Query: 492  SYPYGWQDKAEWNFNVCSTQAELFVLRDHVYLISDLVTDFSGGEEVLYEQFRPFDYRFRW 551
             YP GW D   W FN+ S Q ++F+LR+H+ L+SD++ DFS  E   YE FR F Y    
Sbjct: 659  GYPLGWNDPVNWIFNINSKQLDIFLLREHITLLSDMIIDFSTQEPTPYELFRSFTYNLNL 718

Query: 552  DIRGYSAYLNVNDANIINNPIDFGENCYLSVHGDDAEITFSLPITSIIQKYVTVDFNIFT 611
             I GYS Y NVND NIINNP+DF ENCYLS HGD      ++PI S+ Q+YVT+ + IFT
Sbjct: 719  KIGGYSFYFNVNDRNIINNPLDFNENCYLSFHGDLFTSEITIPIISLAQQYVTISYEIFT 778

Query: 612  PHFSLFLNAPPWHTFSELLHYKEIGRSKNFNIKGSYTSYSEVDVDNVDALNIACETDYIV 671
            P F LFLN P W+T SE +  KEIGRS +F + G+Y  YSE+D+DNVD+L I  E++  V
Sbjct: 779  PMFRLFLNTPSWNTLSEFMRNKEIGRSHDFRVSGTYLIYSELDIDNVDSLTIDFESNSTV 838

Query: 672  VLCYGVILKCMLNVKVNYFGEMVHFRTTEEYVEELQRRNKQNPSTCRPFNSDGNVHDSDV 731
            + C+G ++K M+N + NYFG  + F TTEEY E +  RN  N +        G+++ +D+
Sbjct: 839  LYCFGFVIKYMMNFQANYFGSFIKFITTEEYSELI--RNNVNDNL-------GSINTNDL 889

Query: 732  VATESNEIIDASFDAFG--GPPTIKKSALKRSINELDVWFTFISKGGCFFFPENIYKFDA 789
             + E  + +D+  +        TIK+S L R+ NE D+W  F    G    PE +Y  D+
Sbjct: 890  TSIEGLQKMDSITNDVEDINQKTIKRSDLLRTENETDIWLNFKVNDGALILPEELYNGDS 949

Query: 790  CLGFYFDNLEASLRFLNYYVDAAVSLDSIYFKRHTDIDARTLFKVIEDIGIPIDASDAYL 849
            C+   F  L  ++R  NYY+D  ++L      R   ID   LF+ I+       + +  +
Sbjct: 950  CVSLSFGELFINMRTCNYYMDVYITLYDNNLNRFEKIDPHELFEYIQTRNRS-SSVEGNI 1008

Query: 850  SQFSFRLHKMLGIMPSEESYACEFDVRVDTLDVHCDLAVLKAFVNTLRNLAFGFKDVENS 909
            S  +   H+M G+ P E +Y C++ + + T  +  D+  L +F+ +L  + F   + ENS
Sbjct: 1009 SDITIHGHRMYGLPPKELTYFCQWSINIGTFLIDSDMIFLLSFIQSLNKIGFFLSNKENS 1068

Query: 910  LQYEREQVFDLNKISCVIENVTVKLQNVDKDEDIWLSLNLPVTTLTSFDLANERYSRRSD 969
            L YE + V D+  +S  +E++ V L   D   +    +      + + D  NE+Y++R D
Sbjct: 1069 LLYESDTVNDMTLLSVDVESLKVILS--DPLLEARAEIGASSIIIRNIDFENEKYTKRLD 1126

Query: 970  LSIPELLFGI--YRGDSESTCLGAFSTGVTVTLFERFEQFARCRVLQRKHILVNDAPFHR 1027
            ++  E  F +   + DS    +    T + +T F + +        QRK I ++D+P+HR
Sbjct: 1127 VNASEFYFSLDSLKIDSGKKNILDVRTKLNITNFFKTDNHINHLDTQRKFIGLHDSPYHR 1186

Query: 1028 CSFMLPPEYKKMPIYRSLYGCXXXXXXXXXXXXXXXADNFEVIFEKLLGEIYQEYASDSS 1087
            C F+LP ++++   Y+ LYG                      I E +L + Y E+     
Sbjct: 1187 CFFLLPEKFQESSSYKELYGSITPSFSLPMLPIPHIYSTTNFIVEGILDD-YSEFLLS-- 1243

Query: 1088 YQITDDSISSTEHDYHNQ-TVNAAIGTSSSLFIRSQNHQQ--TLSSFIVEFDPID----- 1139
                         D+HNQ ++NA + +  +  ++     Q     + +   DP +     
Sbjct: 1244 -------------DHHNQMSINAELNSVDTTPLKDSFDMQITNFQNILTTEDPYETDNFV 1290

Query: 1140 ---GYLDLSAT-EFMLEIYKYLTE----VSLDEAIDSLEIGIINQFIQTFGEDNGISEVR 1191
                YL ++   + +  I K+ TE     S++  ID +E+ I+N+        +    V 
Sbjct: 1291 VNVKYLTVTVNPDIVFTIEKFSTEFNKKFSMNNQIDGIEMAIVNRLSDLKENISSKINVN 1350

Query: 1192 VLCPNISLSATNKQSKFSMFKLSSKIKNLDITSRIKSSDPNLKPDPEKTTLCYKIDYIRA 1251
            +    I  +  ++   F    + + I  L      +S+  N     +  TL  K   +R 
Sbjct: 1351 LNVEKIDAAWGHRDVCF----IGTYINMLKFELSQESTYNNNGGLQKDLTLLGKFRSVRI 1406

Query: 1252 NIVQDGIV--VPPKQPSQLFSCSIELLEGYLSYDKLSLLDNNVQSCSVTLSPGTDKLLFE 1309
             I+Q+         +P  L S  +E  E + S     L   N+ S  +T+       L  
Sbjct: 1407 -IIQNHSYNSFSDDRPPGL-SLMLEGFEAWSSTTTKQLTTLNLTSFDITVDEYQIHWLIP 1464

Query: 1310 FLNPFISTFDLLQRELSSFEDTLLASKREFLLNILRGGRDYEIQHDPPVITKPANITRFS 1369
            ++   I  F  +Q  +    D   + ++ F+ +++  G  Y+I HDP VITKPA + R S
Sbjct: 1465 YVKSQILLFTKIQDSVKLIYDEQASYQKTFITSLIWAGEKYQIDHDPYVITKPATVLRLS 1524

Query: 1370 NRHIRSAESWRIIMRLRHILNYLPQEWHQSFTRHLGTQDFTSPEEAGKEFLSIFSDWRSW 1429
              HIR   SWRI+ +LRHIL YLP++W          +     +EA   FL++FS+WR+W
Sbjct: 1525 AWHIRENRSWRIVTKLRHILTYLPEDWEDRLDEEDLIKRSGLEKEAASTFLNVFSNWRNW 1584

Query: 1430 EPTDVQGSFVHEKVFTKKRSR 1450
            E +D++ S+++  +F ++ S+
Sbjct: 1585 EVSDIEKSYIYRMIFVEEVSK 1605

 Score =  492 bits (1266), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 348/1222 (28%), Positives = 587/1222 (48%), Gaps = 68/1222 (5%)

Query: 1694 RESSGNKIHAVLFQGQVANITLKLQILSPFIILYCAE--NFELQAESTDSVIFDLNSGES 1751
            +++  N  + +       N++ ++ +L P  + +     N      + D ++  +   + 
Sbjct: 1862 QKAKPNSKNNITLSATFTNVSSEITLLHPIYLKHETNSVNISYNTINIDELLVQVLDTDL 1921

Query: 1752 YMEISSAKQKLDYFKYTHTCLKLSGTSSSARLFEHISCDIGILKLSVFDLKTRITDLLQD 1811
            Y+  S  K++     Y    L       + +L + +     ILKL+  D +  +   LQD
Sbjct: 1922 YLNSSHTKEQYARLSYDKLELTTFLPDLNEKLID-LEISSSILKLTTSDPRRMLFSFLQD 1980

Query: 1812 ---IKAALFSMKSLSDILNISQSSPTASAFGSWFSILPDNLSLQATYAGLLLGFGHTLYI 1868
               +K +L  ++SL  +   + S  + + F S+  I+    + ++ Y G+LL    T Y+
Sbjct: 1981 EKELKNSLTFLRSLESLNRKANSEDSETLFSSYEWIV----NFKSKYMGVLLPIQATYYV 2036

Query: 1869 LEFNNFEAKHTRDGLPDAITPRPCFKVDHSIESASFLIKDRRIDDRLAKVVDFAVNFNMV 1928
             E ++  +  +    P +   +  F  D S +   FLIKD+ I  + +K++DF++  +  
Sbjct: 2037 FELHDALSTVSNKEEPSSAVHKK-FHGDLSFDHIIFLIKDQSIPHKFSKILDFSIKLSTH 2095

Query: 1929 HDTDLCIQSVQIESTHLKITLAPMTVVRLLSLINEFGIIRKQFTEESIYTPSSAH----- 1983
               +   +S +IES+  ++ L P ++++ +     +G  +  +   S Y  S+ +     
Sbjct: 2096 RTVNNFDRSFEIESSFFRVCLTPFSLIQTM-----WGYYQLLYLLNSYYDQSTVNFFVFN 2150

Query: 1984 --NNSTATECLEPSVWRLIIKSGHILSHDFSIVWLFDIPNSSADGLICGYDRLFSVYEKP 2041
              N   AT   + +V+   ++S HILS++FSI WL+   +++  GLI GY+RLFS YE  
Sbjct: 2151 DNNIDGATNSEKENVFS--VRSFHILSYNFSIGWLYQDSDNTIPGLILGYNRLFSTYEDN 2208

Query: 2042 YGKLTLLNAYFSAAKILASEAD-FYSSVVRKQRINTSYLSDMQLRYWFTEDSENTDLFIR 2100
            +GKLTL++ +FS A    S  D FYSS     + N SYL ++Q+ YW  E  +   LFI+
Sbjct: 2209 HGKLTLVDGFFSLAN--GSSGDTFYSSGDESSKFNRSYLPNIQILYWIKEIEKMKHLFIK 2266

Query: 2101 IHGAKLAVDISAEIVTLLEETIQSIQTFNNLKKALVDPFRTKK--QDSDISKEPYNWNNQ 2158
             HG  L V+     V ++E T++SI  F  LK+  ++P    K  +D   +    N    
Sbjct: 2267 FHGETLDVNFFENFVNIIESTVRSIDLFQTLKREKINPLVKAKPERDEKSNSALTNIKGP 2326

Query: 2159 LATGVRSLNCIINYAGVTLKLHSHDGRGDA--SPLELTSPSYKVAIDYKYFPNLEKTHRF 2216
            +   ++ +NC   Y G   +L S+    +     L + SP  K+ + Y YF    K H  
Sbjct: 2327 IFGKLKQVNCEFIYDGGLFRLFSNASMTNKLEPTLMIKSPKVKIMLSYDYFEKELKKHWI 2386

Query: 2217 RTLITATPTHNTFYSTSAFLIHDLCYRFXXXXXXXXXXXXXXXXXXXXXIKVEGSDN--- 2273
              LI   PT N   S     + D   +                         E  DN   
Sbjct: 2387 NCLIDIEPTQNVLKSGCVPFLSDFISQIKDIVELQDVNME------------ENMDNNVK 2434

Query: 2274 -----STLLGSIDLVIILNVGKQEVTFSCEPKAKVQATVGXXXXXXXXXXXXXXXXXSLC 2328
                 ++LL + D+   L  G Q VT  CEPKAK+   VG                  L 
Sbjct: 2435 DPINITSLLENFDICFKLISGTQHVTLDCEPKAKINTDVGFGSFEFSILTPHLNPIDPLD 2494

Query: 2329 LAIEIENLMTNSRHIYSREVCASLKLRHISMVFDIMGSQVRRIYGSTLISSPLFYFNMKQ 2388
            ++++I ++ T+ +H +S E  AS ++  + ++      +V   +G+ L+     +FN+KQ
Sbjct: 2495 ISLKINDIKTSVKHQFSNEASASFEVSKLDVILIFTHPEV---FGTGLVDDVKLHFNLKQ 2551

Query: 2389 LQDLKLFIDQW-FPQKTPMNTGSYPEGVLVDDISRXXXXXXXXXXXXXXXXXXXXVIVAG 2447
             Q++ +F+D W   + T           LVD  S                       + G
Sbjct: 2552 FQNISIFLDIWDVSKSTEKKLFKKDSNTLVDAKSSPIAQTIVNSSTLPWSFVFIATNING 2611

Query: 2448 SCAEIELGPSLGVLNVTSEDVWAISKQQVDWSQQLDLNMGKLDVTSSGRLGGNFLVRNAH 2507
               +I +G +LG L +  +  W  +    +  Q L L    + ++S GRLGG   + +  
Sbjct: 2612 ---DINMGSTLGNLALNLQRTWISTDHFHNKRQLLHLFTDNVKISSEGRLGGFVEIDDIT 2668

Query: 2508 LSLELKWPNPKDFFQVPLVCVKLGSDTVDTKLSFDYHTFFISSLKQGYASLFNERDEDGS 2567
              L++ + +   F   PLV +      V  K++FDYH F IS++K     + +E+D D  
Sbjct: 2669 WKLDVNYVDKYKFVVSPLVDLLFDVGKVSMKVAFDYHMFLISTVKDLKFHVLSEKDIDDI 2728

Query: 2568 LADLLSVTVSFESVNIFLTALAAANISDIKNSITRLKKDNELSYLSSFLASDQPSDEPE- 2626
            L DLL+V ++ + + +  TAL A+NI DI N+I R ++DN+ SY+ + L S+    + + 
Sbjct: 2729 LPDLLTVNLTCDEIKVCTTALVASNILDIYNTIMRTRQDNKNSYIETLLESNNNVLKRKP 2788

Query: 2627 --EDGGIFDXXXXXXXXXXXXXGVFRLQISPTSLFDSDVLILTATKMMANTGIQADIKIK 2684
              ED  I                   LQISP+SL+D++V+I+    + ++T  +   KIK
Sbjct: 2789 LYED--ILKSLNLLQTSLSANIHELNLQISPSSLYDAEVIIIRVQDVFSSTETRTGEKIK 2846

Query: 2685 TDLHWQLDDVSLALLPFNNSLDESYLATMEVGKYIELSSTIQGGAIFSAPSIVVNMTTWQ 2744
            TDL  ++ + +L+L  F   L E  +A M    YI  +ST+  G IF  P + +NMTT+Q
Sbjct: 2847 TDLEMRVYNATLSLTSFGKELTEEDIAEMSAETYISYASTLTSGRIFEIPQLTINMTTFQ 2906

Query: 2745 EPQSNVIELLYSTSFGGTVKIRWNLGPISFIKDMWQAHMNAMQLREGYYHGLAESGVAVT 2804
               + +++  YS SF G V + WNLGPI+FIK++W  H+ ++++R   + G  +    ++
Sbjct: 2907 NADNMILQYTYSCSFDGKVDVTWNLGPINFIKEVWATHVRSLEVRTVQFMGNHD----IS 2962

Query: 2805 PLNSKAVPLEMHLGSDYQYLPLQEPDIEMPRIKDLGDATPPIEWFGVNRTKFPGFTHQFV 2864
              N       + + S+ +Y+ L+EP IEMP+IKDL DATPP+EWFG+NR  FP  THQ V
Sbjct: 2963 LENEGDTDESVKVLSNIEYIALEEPYIEMPQIKDLKDATPPLEWFGLNRKYFPSATHQSV 3022

Query: 2865 IVPLQKLARTAEKEYEKILGRA 2886
            IVP+QKL   A+KEY K+LG +
Sbjct: 3023 IVPIQKLVNVAQKEYAKVLGSS 3044

 Score = 73.2 bits (178), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 32/87 (36%), Positives = 54/87 (62%), Gaps = 4/87 (4%)

Query: 6   IFYVGRVLGYIVSKAANLVLWKQYRVTVSIQSLVFSPLAGKVHFKNVSVTSQDQLISVLK 65
           +FYV ++ G+ ++ A   +LWK   + V+I+S+  S L G + FKNV +  QD+ IS+L+
Sbjct: 38  VFYVAKLWGFGLTFACEWLLWKTMNIKVTIESIRLSFLTGTIFFKNVCLIDQDKTISILE 97

Query: 66  GTITWRYWLIG----RYRRSGTADGAR 88
            ++TWRYWL+      Y  +  AD ++
Sbjct: 98  CSVTWRYWLLNTRKSEYELNAKADTSK 124

>NDAI0B05390 Chr2 complement(1313930..1326160) [12231 bp, 4076 aa]
            {ON} Anc_1.216 YKR054C
          Length = 4076

 Score = 35.8 bits (81), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 31/105 (29%), Positives = 58/105 (55%), Gaps = 13/105 (12%)

Query: 837  DIGIPIDASDAYLSQFSFRLHKMLGIMPS-EESYACEFDVRVDTLDVHCDLAVLKAFVNT 895
            D  IPIDA      +F+  +  ++GI+   + SY  +FD+   +   H        FV+ 
Sbjct: 2918 DQTIPIDAIRIIPFEFNTFIDMLIGIVVLFDSSYFEDFDIGPKS-PAH--------FVSA 2968

Query: 896  LRNLAFGFKDVENSLQYEREQVFDLNKISCVIENVTVKLQNVDKD 940
            +R+L+  F+++   L+ ER+  F +N +  + E+V VK+QN++K+
Sbjct: 2969 IRSLSHTFRNMHEQLEIERQ--FTINGLEKLTESV-VKVQNLEKE 3010

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.136    0.403 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 295,723,886
Number of extensions: 12993424
Number of successful extensions: 33960
Number of sequences better than 10.0: 27
Number of HSP's gapped: 34092
Number of HSP's successfully gapped: 87
Length of query: 2887
Length of database: 53,481,399
Length adjustment: 127
Effective length of query: 2760
Effective length of database: 38,918,817
Effective search space: 107415934920
Effective search space used: 107415934920
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 75 (33.5 bits)