Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
AGR087C8.261ON57757728960.0
Ecym_43098.261ON57757621830.0
SAKL0H17050g8.261ON58457719690.0
KLLA0F19118g8.261ON57857718590.0
TDEL0F038808.261ON57957718330.0
KLTH0G13706g8.261ON58457718290.0
Kwal_56.238048.261ON57858017880.0
Smik_12.1478.261ON61361217450.0
Suva_10.1728.261ON61461317430.0
YLR088W (GAA1)8.261ON61461317390.0
Skud_12.1568.261ON61261117320.0
Kpol_543.378.261ON57857816610.0
ZYRO0C01672g8.261ON56958016470.0
TBLA0F030808.261ON58357016460.0
CAGL0L12232g8.261ON59157916130.0
NDAI0J013908.261ON58358416050.0
KNAG0H032508.261ON58559016030.0
NCAS0B038608.261ON58357915920.0
TPHA0A018208.261ON58157015440.0
KAFR0B055508.261ON55556115030.0
CAGL0J02002g7.133ON36170714.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AGR087C
         (577 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AGR087C Chr7 complement(890706..892439) [1734 bp, 577 aa] {ON} S...  1120   0.0  
Ecym_4309 Chr4 complement(656032..657765) [1734 bp, 577 aa] {ON}...   845   0.0  
SAKL0H17050g Chr8 complement(1497051..1498805) [1755 bp, 584 aa]...   763   0.0  
KLLA0F19118g Chr6 (1771250..1772986) [1737 bp, 578 aa] {ON} simi...   720   0.0  
TDEL0F03880 Chr6 (722770..724509) [1740 bp, 579 aa] {ON} Anc_8.2...   710   0.0  
KLTH0G13706g Chr7 complement(1173326..1175080) [1755 bp, 584 aa]...   709   0.0  
Kwal_56.23804 s56 complement(710216..711952) [1737 bp, 578 aa] {...   693   0.0  
Smik_12.147 Chr12 (295948..297789) [1842 bp, 613 aa] {ON} YLR088...   676   0.0  
Suva_10.172 Chr10 (320928..322772) [1845 bp, 614 aa] {ON} YLR088...   676   0.0  
YLR088W Chr12 (316107..317951) [1845 bp, 614 aa] {ON}  GAA1Subun...   674   0.0  
Skud_12.156 Chr12 (299282..301120) [1839 bp, 612 aa] {ON} YLR088...   671   0.0  
Kpol_543.37 s543 (82589..84325) [1737 bp, 578 aa] {ON} (82589..8...   644   0.0  
ZYRO0C01672g Chr3 complement(119344..121053) [1710 bp, 569 aa] {...   639   0.0  
TBLA0F03080 Chr6 complement(747695..749446) [1752 bp, 583 aa] {O...   638   0.0  
CAGL0L12232g Chr12 (1324754..1326529) [1776 bp, 591 aa] {ON} sim...   625   0.0  
NDAI0J01390 Chr10 complement(319754..321505) [1752 bp, 583 aa] {...   622   0.0  
KNAG0H03250 Chr8 complement(605885..607642) [1758 bp, 585 aa] {O...   622   0.0  
NCAS0B03860 Chr2 complement(687424..689175) [1752 bp, 583 aa] {O...   617   0.0  
TPHA0A01820 Chr1 complement(367804..369549) [1746 bp, 581 aa] {O...   599   0.0  
KAFR0B05550 Chr2 complement(1136432..1138099) [1668 bp, 555 aa] ...   583   0.0  
CAGL0J02002g Chr10 (200829..201914) [1086 bp, 361 aa] {ON} simil...    32   4.0  

>AGR087C Chr7 complement(890706..892439) [1734 bp, 577 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR088W
           (GAA1)
          Length = 577

 Score = 1120 bits (2896), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 546/577 (94%), Positives = 546/577 (94%)

Query: 1   MAVLEKLHRKVVDMGLVPKIIFSLAKISYVTTLLSVAWLTLFLPMEGQYRRTYISENALM 60
           MAVLEKLHRKVVDMGLVPKIIFSLAKISYVTTLLSVAWLTLFLPMEGQYRRTYISENALM
Sbjct: 1   MAVLEKLHRKVVDMGLVPKIIFSLAKISYVTTLLSVAWLTLFLPMEGQYRRTYISENALM 60

Query: 61  PSQAYSYFRESEWNILRGYRSEIDGMRTLTADERNRIVASWMEEYGAKAAVYNDDRHGET 120
           PSQAYSYFRESEWNILRGYRSEIDGMRTLTADERNRIVASWMEEYGAKAAVYNDDRHGET
Sbjct: 61  PSQAYSYFRESEWNILRGYRSEIDGMRTLTADERNRIVASWMEEYGAKAAVYNDDRHGET 120

Query: 121 LYAVLHATRGDGTEAMVLAAPWETVEGQYNTGGVALAVAMGRYFSRWPVWSKNIIIVLSE 180
           LYAVLHATRGDGTEAMVLAAPWETVEGQYNTGGVALAVAMGRYFSRWPVWSKNIIIVLSE
Sbjct: 121 LYAVLHATRGDGTEAMVLAAPWETVEGQYNTGGVALAVAMGRYFSRWPVWSKNIIIVLSE 180

Query: 181 DPHASLRSWVQAYHTKLDLTGGSIEAAIVLDYPGTNDYFQHVEISYEGLNGGMPNLDLLN 240
           DPHASLRSWVQAYHTKLDLTGGSIEAAIVLDYPGTNDYFQHVEISYEGLNGGMPNLDLLN
Sbjct: 181 DPHASLRSWVQAYHTKLDLTGGSIEAAIVLDYPGTNDYFQHVEISYEGLNGGMPNLDLLN 240

Query: 241 VAVHITEHEGMKVALHGTPWEELGTDTYFSRMRLLLKGIKDMALSGIKRTSGNEAFSGWR 300
           VAVHITEHEGMKVALHGTPWEELGTDTYFSRMRLLLKGIKDMALSGIKRTSGNEAFSGWR
Sbjct: 241 VAVHITEHEGMKVALHGTPWEELGTDTYFSRMRLLLKGIKDMALSGIKRTSGNEAFSGWR 300

Query: 301 IQSVTLKARGTNGSFDITTFGRVPEAMFRSVNNLLEKFHQSFFFYLLLAPRYFVSIGSYL 360
           IQSVTLKARGTNGSFDITTFGRVPEAMFRSVNNLLEKFHQSFFFYLLLAPRYFVSIGSYL
Sbjct: 301 IQSVTLKARGTNGSFDITTFGRVPEAMFRSVNNLLEKFHQSFFFYLLLAPRYFVSIGSYL 360

Query: 361 PAAVGLSISFAVMACDSVLNNEFASLPLISIYNIWXXXXXXXXXXXXXITAEVFFYXXXX 420
           PAAVGLSISFAVMACDSVLNNEFASLPLISIYNIW             ITAEVFFY    
Sbjct: 361 PAAVGLSISFAVMACDSVLNNEFASLPLISIYNIWALLAFSVALLVSAITAEVFFYLPAP 420

Query: 421 XXXXXFNVVVSFMPFALVKYKIQKPFSHRFKAAAYLYFSTVLSSLLVMNFQLAFMVGLLA 480
                FNVVVSFMPFALVKYKIQKPFSHRFKAAAYLYFSTVLSSLLVMNFQLAFMVGLLA
Sbjct: 421 ALLLAFNVVVSFMPFALVKYKIQKPFSHRFKAAAYLYFSTVLSSLLVMNFQLAFMVGLLA 480

Query: 481 FPMTFVRTTVHASVRQKMKXXXXXXXXXPFISICVFVHLFEPELTGFSVFYSLIDAWNDL 540
           FPMTFVRTTVHASVRQKMK         PFISICVFVHLFEPELTGFSVFYSLIDAWNDL
Sbjct: 481 FPMTFVRTTVHASVRQKMKNSLLLLLSNPFISICVFVHLFEPELTGFSVFYSLIDAWNDL 540

Query: 541 GCWTWYVLCLGWYPAWIMVAYSSIDSVPIAAPAKKSS 577
           GCWTWYVLCLGWYPAWIMVAYSSIDSVPIAAPAKKSS
Sbjct: 541 GCWTWYVLCLGWYPAWIMVAYSSIDSVPIAAPAKKSS 577

>Ecym_4309 Chr4 complement(656032..657765) [1734 bp, 577 aa] {ON}
           similar to Ashbya gossypii AGR087C
          Length = 577

 Score =  845 bits (2183), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 389/576 (67%), Positives = 471/576 (81%)

Query: 1   MAVLEKLHRKVVDMGLVPKIIFSLAKISYVTTLLSVAWLTLFLPMEGQYRRTYISENALM 60
           MAVLEKLHR++VDMGLVP+II SL KIS    LLS++WLTLFLP+EGQYRRTYISENALM
Sbjct: 1   MAVLEKLHRRIVDMGLVPRIIASLPKISIFCALLSISWLTLFLPLEGQYRRTYISENALM 60

Query: 61  PSQAYSYFRESEWNILRGYRSEIDGMRTLTADERNRIVASWMEEYGAKAAVYNDDRHGET 120
           PSQAYSYFRESEWNILRGYR E++ ++ L   ERN IVASWMEEYGAK ++  ++++GET
Sbjct: 61  PSQAYSYFRESEWNILRGYRRELENLKDLDIHERNTIVASWMEEYGAKTSINTNNQYGET 120

Query: 121 LYAVLHATRGDGTEAMVLAAPWETVEGQYNTGGVALAVAMGRYFSRWPVWSKNIIIVLSE 180
           LY ++H +RGDGTEAMVLAAPW T +G YN GG ALA+++ RYF+RWPVWSKNII+VLS 
Sbjct: 121 LYGIVHTSRGDGTEAMVLAAPWTTTDGLYNNGGAALAISLARYFARWPVWSKNIIVVLSA 180

Query: 181 DPHASLRSWVQAYHTKLDLTGGSIEAAIVLDYPGTNDYFQHVEISYEGLNGGMPNLDLLN 240
           DP ASLR+WV+AYHTKLDLTGGSIE+A+VLDYPGTNDYF+++EI Y GLNGG+PNLDL+N
Sbjct: 181 DPQASLRAWVKAYHTKLDLTGGSIESAVVLDYPGTNDYFKYIEIGYNGLNGGLPNLDLIN 240

Query: 241 VAVHITEHEGMKVALHGTPWEELGTDTYFSRMRLLLKGIKDMALSGIKRTSGNEAFSGWR 300
            AVHI+EHEGMKV+LHG P+ EL  DTY  R++ LL GIKDM L+GIK T+G+EAF+GWR
Sbjct: 241 TAVHISEHEGMKVSLHGMPFVELSQDTYKLRLKTLLSGIKDMTLAGIKNTTGHEAFNGWR 300

Query: 301 IQSVTLKARGTNGSFDITTFGRVPEAMFRSVNNLLEKFHQSFFFYLLLAPRYFVSIGSYL 360
           IQSVTLKA G +G FD+TTFGRVPEA+FRSVNNLLEKFHQSFFFYLLL+PR FVSIGSYL
Sbjct: 301 IQSVTLKAHGQDGPFDVTTFGRVPEAIFRSVNNLLEKFHQSFFFYLLLSPRSFVSIGSYL 360

Query: 361 PAAVGLSISFAVMACDSVLNNEFASLPLISIYNIWXXXXXXXXXXXXXITAEVFFYXXXX 420
           PAA+ LS SFA+ + DS+LNNE++ LPL+SIYNIW             +TAE F Y    
Sbjct: 361 PAAIALSASFAIASADSILNNEYSKLPLLSIYNIWALFAFAVALMISFVTAEAFAYMPLP 420

Query: 421 XXXXXFNVVVSFMPFALVKYKIQKPFSHRFKAAAYLYFSTVLSSLLVMNFQLAFMVGLLA 480
                FNV +SF+ F ++KYKIQKPFS+RFKA A+LYFS VL+SLLV+NF LA  VG+LA
Sbjct: 421 SLLLAFNVALSFISFTVIKYKIQKPFSYRFKAFAHLYFSIVLTSLLVVNFALALAVGVLA 480

Query: 481 FPMTFVRTTVHASVRQKMKXXXXXXXXXPFISICVFVHLFEPELTGFSVFYSLIDAWNDL 540
           FPM+  +TT +A+++QK++         PFI+  +   LFE +L G S+F+SLIDAW  L
Sbjct: 481 FPMSLTKTTTNATMQQKLRNSLLLMSSNPFIASWILCQLFEAQLAGTSLFHSLIDAWTQL 540

Query: 541 GCWTWYVLCLGWYPAWIMVAYSSIDSVPIAAPAKKS 576
           GCWTWYVLC+GWYP+WI+VAYSSIDS+PI   +KKS
Sbjct: 541 GCWTWYVLCIGWYPSWILVAYSSIDSIPIVTTSKKS 576

>SAKL0H17050g Chr8 complement(1497051..1498805) [1755 bp, 584 aa]
           {ON} similar to uniprot|P39012 Saccharomyces cerevisiae
           YLR088W GAA1 Subunit of the GPI:protein transamidase
           complex removes the GPI-anchoring signal and attaches
           GPI (glycosylphosphatidylinositol) to proteins in the ER
          Length = 584

 Score =  763 bits (1969), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 356/577 (61%), Positives = 450/577 (77%), Gaps = 1/577 (0%)

Query: 1   MAVLEKLHRKVVDMGLVPKIIFSLAKISYVTTLLSVAWLTLFLPMEGQYRRTYISENALM 60
           MA++EKLHR+ +DMGL+PK I  L  +S    ++ V+WL LF+P +GQ+RRTYISENALM
Sbjct: 1   MALVEKLHRRFIDMGLLPKFIALLPTLSIFCAVVGVSWLALFIPTDGQFRRTYISENALM 60

Query: 61  PSQAYSYFRESEWNILRGYRSEIDGMRTLTADERNRIVASWMEEYGAKAAVYNDDRHGET 120
           PSQAYSYFRE+EWN+LRGYR++I+  +  +  ERN  V+SW++++GAK A+Y ++ +GET
Sbjct: 61  PSQAYSYFRETEWNVLRGYRTQIELFKKSSTHERNEEVSSWLQQFGAKTAIYTNEEYGET 120

Query: 121 LYAVLHATRGDGTEAMVLAAPWETVEGQYNTGGVALAVAMGRYFSRWPVWSKNIIIVLSE 180
           LY +LHA RGDGTEAMVLAAPW   E QYNTGG+ALAV++ R+FSRWPVWSKNIIIVLSE
Sbjct: 121 LYGILHAPRGDGTEAMVLAAPWYNSENQYNTGGIALAVSLSRFFSRWPVWSKNIIIVLSE 180

Query: 181 DPHASLRSWVQAYHTKLDLTGGSIEAAIVLDYPGTNDYFQHVEISYEGLNGGMPNLDLLN 240
           DP A+LRSWV+AYHT LDLTGGSIEAA+V+D+PG+ND+F++VEI ++GLNG +PNLDL+N
Sbjct: 181 DPQAALRSWVEAYHTSLDLTGGSIEAAVVMDFPGSNDFFKYVEIHFDGLNGELPNLDLVN 240

Query: 241 VAVHITEHEGMKVALHGTPWEELGTDTYFSRMRLLLKGIKDMALSGIKRTSGNEAFSGWR 300
           VAVHITEHEGMKV+LHG   EELG + +FSRM+ ++ G+K+MALSGIK++ GNE FSGWR
Sbjct: 241 VAVHITEHEGMKVSLHGISEEELGKNDFFSRMKTIILGVKNMALSGIKKSHGNEVFSGWR 300

Query: 301 IQSVTLKARGTNGSFDITTFGRVPEAMFRSVNNLLEKFHQSFFFYLLLAPRYFVSIGSYL 360
           I SVTLKA GT+G FDITTFGR+PEA+FRSVNNLLEKFHQSFFFYLLLAPR FVSIGSYL
Sbjct: 301 IHSVTLKACGTDGPFDITTFGRIPEAIFRSVNNLLEKFHQSFFFYLLLAPRLFVSIGSYL 360

Query: 361 PAAVGLSISFAVMACDSVLNNEFASLPLISIYNIWXXXXXXXXXXXXXITAEVFFYXXXX 420
           PAAV LS+SFA+ + +++LNNE+ SLPL+S YN++             ITA+ F Y    
Sbjct: 361 PAAVALSVSFALASLNTILNNEYTSLPLLSTYNVFALLGFAVALFVSFITAQAFLYAPQP 420

Query: 421 XXXXXFNVVVSFMPFALVKYKIQKPFSHRFKAAAYLYFSTVLSSLLVMNFQLAFMVGLLA 480
                 NV++  MP    + KI+ PFS+R K+ AYLYFS VL+SLLV+NF LAF +G LA
Sbjct: 421 ELLLSLNVLLLLMPIIFTRVKIRTPFSYRLKSFAYLYFSVVLTSLLVVNFSLAFGLGCLA 480

Query: 481 FPMTFVRTTVHASVRQKMKXXXXXXXXXPFISICVFVHLFEPELTGFSVFYSLIDAWNDL 540
           FPMT VRTT   ++R ++K         PFI+I +F    + EL G  VFY L  AW DL
Sbjct: 481 FPMTLVRTT-SGNLRARLKNCVLLLISNPFIAIWLFAICVDRELQGVQVFYGLTSAWKDL 539

Query: 541 GCWTWYVLCLGWYPAWIMVAYSSIDSVPIAAPAKKSS 577
           GCWTW+V+C+GW P+W++VAYS IDSV I  P  + +
Sbjct: 540 GCWTWFVICIGWLPSWLLVAYSGIDSVSIVVPQDEKT 576

>KLLA0F19118g Chr6 (1771250..1772986) [1737 bp, 578 aa] {ON} similar
           to uniprot|P39012 Saccharomyces cerevisiae YLR088W GAA1
           Subunit of the GPI:protein transamidase complex removes
           the GPI-anchoring signal and attaches GPI
           (glycosylphosphatidylinositol) to proteins in the ER
          Length = 578

 Score =  720 bits (1859), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 334/577 (57%), Positives = 436/577 (75%), Gaps = 2/577 (0%)

Query: 1   MAVLEKLHRKVVDMGLVPKIIFSLAKISYVTTLLSVAWLTLFLPMEGQYRRTYISENALM 60
           MA++EKLHR+++ +GL+PK I  L+++S +  ++ + WL   LP +GQ+RRTYISENAL+
Sbjct: 1   MALVEKLHRRIISIGLIPKFISKLSQLSLLCCVIGLGWLVFMLPSDGQFRRTYISENALL 60

Query: 61  PSQAYSYFRESEWNILRGYRSEIDGMRTL-TADERNRIVASWMEEYGAKAAVYNDDRHGE 119
           PSQAYSYFRESEWNILRGYR+++D  + + T  + N  V+ W++E+G K A+Y+D+++GE
Sbjct: 61  PSQAYSYFRESEWNILRGYRTQLDLFQYVSTTHDSNAEVSKWLQEFGVKTAIYDDEQYGE 120

Query: 120 TLYAVLHATRGDGTEAMVLAAPWETVEGQYNTGGVALAVAMGRYFSRWPVWSKNIIIVLS 179
           TLY + HA RGDGTEAMV+AAPW     +YNTGG ALA+++ R+FSRWPVWSKNIIIVLS
Sbjct: 121 TLYGIFHAPRGDGTEAMVIAAPWYNENREYNTGGAALAISLVRFFSRWPVWSKNIIIVLS 180

Query: 180 EDPHASLRSWVQAYHTKLDLTGGSIEAAIVLDYPGTNDYFQHVEISYEGLNGGMPNLDLL 239
           EDP ASLRSWV AYHT LDLTGGSIE+AIVLDYPGT+D F ++EI Y+GLNG  PNLDL+
Sbjct: 181 EDPKASLRSWVTAYHTSLDLTGGSIESAIVLDYPGTSDRFDYMEIHYDGLNGETPNLDLV 240

Query: 240 NVAVHITEHEGMKVALHGTPWEELGTDTYFSRMRLLLKGIKDMALSGIKRTSGNEAFSGW 299
           NVAVHI EHEG+KV+LHG P+ EL  + Y SR++ +L GIKD  LSGIK   GNEAFSGW
Sbjct: 241 NVAVHIAEHEGIKVSLHGLPFSELDRNDYNSRLKTMLLGIKDSVLSGIKNCYGNEAFSGW 300

Query: 300 RIQSVTLKARGTNGSFDITTFGRVPEAMFRSVNNLLEKFHQSFFFYLLLAPRYFVSIGSY 359
           RIQS+TLKA+G +G  DITTFGRVPEA+ RSVNNLLEKFHQSFFFYLLLAPRYF+SIG+Y
Sbjct: 301 RIQSLTLKAKGIDGPHDITTFGRVPEALSRSVNNLLEKFHQSFFFYLLLAPRYFISIGTY 360

Query: 360 LPAAVGLSISFAVMACDSVLNNEFASLPLISIYNIWXXXXXXXXXXXXXITAEVFFYXXX 419
           L  AV +S++F   A + +LNN++  LPL+SIYNIW              T+++F Y   
Sbjct: 361 LATAVAVSVAFVFAALNQILNNKYGELPLLSIYNIWSILTFCISLVFAFATSQLFVYFPL 420

Query: 420 XXXXXXFNVVVSFMP-FALVKYKIQKPFSHRFKAAAYLYFSTVLSSLLVMNFQLAFMVGL 478
                  + + S +P  +  + +IQ+PFS+RFKA AY+Y + VL+SLLV+NF LA ++GL
Sbjct: 421 PRVLLGLSGIFSVLPLLSRTRLRIQEPFSYRFKAFAYIYMAIVLTSLLVLNFSLAIVMGL 480

Query: 479 LAFPMTFVRTTVHASVRQKMKXXXXXXXXXPFISICVFVHLFEPELTGFSVFYSLIDAWN 538
           LAFPMT   T + +++R  +K         PFI+    V+  EP L+GF VFY+LI+A  
Sbjct: 481 LAFPMTRTTTIIESNLRLSIKNLVLLIISNPFIATWAVVNFVEPRLSGFKVFYALIEASQ 540

Query: 539 DLGCWTWYVLCLGWYPAWIMVAYSSIDSVPIAAPAKK 575
            LGCWTWY++CLGWYP+W++V Y+SID++ +  P KK
Sbjct: 541 QLGCWTWYIICLGWYPSWLLVTYASIDAIEVQTPIKK 577

>TDEL0F03880 Chr6 (722770..724509) [1740 bp, 579 aa] {ON} Anc_8.261
           YLR088W
          Length = 579

 Score =  710 bits (1833), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 329/577 (57%), Positives = 436/577 (75%), Gaps = 4/577 (0%)

Query: 1   MAVLEKLHRKVVDMGLVPKIIFSLAKISYVTTLLSVAWLTLFLPMEGQYRRTYISENALM 60
           M+++ KLHR+V+D+GLVPKI+ +L  +S +  ++SV WL L LP+EG+YRRTYISENAL+
Sbjct: 1   MSLIGKLHRRVIDLGLVPKIVAALPLLSMLFAVVSVGWLAL-LPLEGRYRRTYISENALL 59

Query: 61  PSQAYSYFRESEWNILRGYRSEIDGMRTLTADERNRIVASWMEEYGAKAAVYNDDRHGET 120
           PSQAYSYFRE+EWN LRGYR++I+ +   T+ ERN  VA W+ E+G K A+Y D++HG+T
Sbjct: 60  PSQAYSYFRETEWNTLRGYRTQIERLANSTSRERNEEVAGWLREFGVKTAIYQDEKHGDT 119

Query: 121 LYAVLHATRGDGTEAMVLAAPWETVEGQYNTGGVALAVAMGRYFSRWPVWSKNIIIVLSE 180
           LY VLHA RGDGTEA++LAAPW   +G  N  GV++ +A+ R+FSRWPVWSKNII+VLSE
Sbjct: 120 LYGVLHAQRGDGTEAVILAAPWTNADGMVNLSGVSIGIALTRFFSRWPVWSKNIIVVLSE 179

Query: 181 DPHASLRSWVQAYHTKLDLTGGSIEAAIVLDYPGTNDYFQHVEISYEGLNGGMPNLDLLN 240
           +P  S+RSWV+AYHT LDLTGGSIEAA+VLDYPG NDYF HVEI Y+GLNG  PNLDL+N
Sbjct: 180 NPKGSMRSWVEAYHTSLDLTGGSIEAAVVLDYPGVNDYFDHVEIHYDGLNGEEPNLDLVN 239

Query: 241 VAVHITEHEGMKVALHGTPWEELGTDTYFSRMRLLLKGIKDMALSGIKRTSGNEAFSGWR 300
           +A+ ITEHEGMKV+LHG   +++  + ++SR+ ++L GIK+ ALSG+++ +GNEAFSGWR
Sbjct: 240 IAISITEHEGMKVSLHGVSCDKISDNDFWSRLLIMLTGIKNAALSGLRKVNGNEAFSGWR 299

Query: 301 IQSVTLKARGTNGSFDITTFGRVPEAMFRSVNNLLEKFHQSFFFYLLLAPRYFVSIGSYL 360
           IQ+VTLKA GT G  D+TTFGR+PEAMFRS+NNLLEKFHQSFFFY+LLAPRYFVSI SYL
Sbjct: 300 IQAVTLKAHGTEGRHDVTTFGRIPEAMFRSINNLLEKFHQSFFFYILLAPRYFVSISSYL 359

Query: 361 PAAVGLSISFAVMACDSVLNNEFASLPLISIYNIWXXXXXXXXXXXXXITAEVFFYXXXX 420
           P AV LSISFA+ + D+++NN +  LPL S YN+                A++F      
Sbjct: 360 PCAVTLSISFALASLDAMINNNYKKLPLSSTYNLLSLSMWCISLLGCFGIAQLFLRFDAP 419

Query: 421 XXXXXFNVVVSFMPFALVKYKIQKPFSHRFKAAAYLYFSTVLSSLLVMNFQLAFMVGLLA 480
                F+ ++SF+P  L+K KI +P ++R K+ A+L+FS VL+SLL++NF LAF +GL A
Sbjct: 420 TILISFSALISFLPL-LLKKKIAEPLAYRLKSVAFLFFSLVLTSLLMVNFFLAFAMGLTA 478

Query: 481 FPMTFVRTTV--HASVRQKMKXXXXXXXXXPFISICVFVHLFEPELTGFSVFYSLIDAWN 538
           FPMT VRT+   + S+R K+K         PFI+  +F   FEP+L GF+VF     AW 
Sbjct: 479 FPMTLVRTSSLNNYSLRIKLKNSILLLLSNPFIASYIFCQCFEPDLPGFTVFTEFATAWK 538

Query: 539 DLGCWTWYVLCLGWYPAWIMVAYSSIDSVPIAAPAKK 575
           +LGCWTW+V+C+GW P+W+MVA S++++ P     +K
Sbjct: 539 ELGCWTWFVICIGWLPSWLMVALSTLNTQPAQLDDRK 575

>KLTH0G13706g Chr7 complement(1173326..1175080) [1755 bp, 584 aa]
           {ON} similar to uniprot|P39012 Saccharomyces cerevisiae
           YLR088W GAA1 Subunit of the GPI:protein transamidase
           complex removes the GPI-anchoring signal and attaches
           GPI (glycosylphosphatidylinositol) to proteins in the ER
          Length = 584

 Score =  709 bits (1829), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 331/577 (57%), Positives = 427/577 (74%), Gaps = 4/577 (0%)

Query: 1   MAVLEKLHRKVVDMGLVPKIIFSLAKISYVTTLLSVAWLTLFLPMEGQYRRTYISENALM 60
           MA++EKL R+++D+GL+P+I+  L K+S +  +L + WLTL LP+EGQYR TYISENALM
Sbjct: 1   MALIEKLQRRIIDLGLLPRIVRFLPKLSILCGILGICWLTLLLPLEGQYRHTYISENALM 60

Query: 61  PSQAYSYFRESEWNILRGYRSEIDGMRTLTADERNRIVASWMEEYGAKAAVYNDDRHGET 120
           PSQAYSYFRE+EWNILRGYR++I  +   ++ ERN +VASW +E+GAK A Y DD HG T
Sbjct: 61  PSQAYSYFRETEWNILRGYRTQIQVLEEKSSKERNEVVASWFQEFGAKTAFYEDDLHGNT 120

Query: 121 LYAVLHATRGDGTEAMVLAAPWETVEGQYNTGGVALAVAMGRYFSRWPVWSKNIIIVLSE 180
           +Y VLHA RGDGTEAMVLAAPW   +G+YN GG ALA A+ R+FSRWPVWSKNIIIV S+
Sbjct: 121 MYGVLHAPRGDGTEAMVLAAPWYNGDGEYNIGGAALATALSRFFSRWPVWSKNIIIVFSD 180

Query: 181 DPHASLRSWVQAYHTKLDLTGGSIEAAIVLDYPGTNDYFQHVEISYEGLNGGMPNLDLLN 240
           DP ASLRSWV AYHT LDLTGGSIE+A+VLDYPG+ND+F++VEI Y GLNG +PNLDL+N
Sbjct: 181 DPEASLRSWVHAYHTSLDLTGGSIESAVVLDYPGSNDFFKYVEIYYAGLNGELPNLDLVN 240

Query: 241 VAVHITEHEGMKVALHGTPWEELGTDTYFSRMRLLLKGIKDMALSGIKRTSGNEAFSGWR 300
           VAVHITEHEGMKV+L+G   EE+    YFS+M+ ++ G+K MALSG++   GNEAFSGWR
Sbjct: 241 VAVHITEHEGMKVSLNGVSEEEMEKRNYFSKMKTMMVGVKKMALSGVQSCYGNEAFSGWR 300

Query: 301 IQSVTLKARGTNGSFDITTFGRVPEAMFRSVNNLLEKFHQSFFFYLLLAPRYFVSIGSYL 360
           IQ++ L+ARGT+G FDITTFGR+PEA FRSVNNLLEKFHQSFFFYLLLAPRYFVSI SYL
Sbjct: 301 IQAIVLRARGTDGPFDITTFGRIPEATFRSVNNLLEKFHQSFFFYLLLAPRYFVSIASYL 360

Query: 361 PAAVGLSISFAVMACDSVLNNEFASLPLISIYNIWXXXXXXXXXXXXXITAEVFFYXXXX 420
           PAAV  S+SF V   D VL +  ++ P  S++N+                + +F +    
Sbjct: 361 PAAVAFSVSFIVATLDCVLKSGASNTPAFSVHNLSAVIGFTVALLLSFALSILFSHWQYS 420

Query: 421 XXXXXFNVVVSFMPFALVKYKIQKPFSHRFKAAAYLYFSTVLSSLLVMNFQLAFMVGLLA 480
                 N V++ +P    +  I+   S++FK+ A+LY S VL+SLLV+NF LAF +GLLA
Sbjct: 421 SLLISCNAVIAVLPAIFGRQGIEASHSYQFKSVAFLYLSVVLTSLLVINFALAFGIGLLA 480

Query: 481 FPMTFVRTTVHASVRQKMKXXXXXXXXXPFISICVFVHLFEPELTGFSVFYSLIDAWNDL 540
           FP+  V+  + +  RQ++K         PFIS  +FV+ FEP+L+G  +F+ L+ AW  L
Sbjct: 481 FPLILVKAPMTS--RQRVKNTILLILSNPFISTLLFVNTFEPQLSGLQLFHRLVQAWQKL 538

Query: 541 GCWTWYVLCLGWYPAWIMVAYSSIDS--VPIAAPAKK 575
           GCWTW V+C+GW P+W++VA S I     P+  P+++
Sbjct: 539 GCWTWSVVCIGWLPSWLLVACSGIPMPYQPVGGPSQR 575

>Kwal_56.23804 s56 complement(710216..711952) [1737 bp, 578 aa] {ON}
           YLR088W (GAA1) - Possible component of GPI:protein
           transamidase [contig 173] FULL
          Length = 578

 Score =  693 bits (1788), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 331/580 (57%), Positives = 423/580 (72%), Gaps = 5/580 (0%)

Query: 1   MAVLEKLHRKVVDMGLVPKIIFSLAKISYVTTLLSVAWLTLFLPMEGQYRRTYISENALM 60
           MA++E+L RKV+D+GL+P+I+  L K+S +  ++ + W+TL LP+EGQYR TYISENALM
Sbjct: 1   MALIERLQRKVIDLGLLPRIVRFLPKLSVLCGIIGIFWVTLLLPLEGQYRHTYISENALM 60

Query: 61  PSQAYSYFRESEWNILRGYRSEIDGMRTLTADERNRIVASWMEEYGAKAAVYNDDRHGET 120
           PSQAYSYFRE+EWNILRGYR++I  +   ++ ERN I+ SW++E+G K A+Y D+  G T
Sbjct: 61  PSQAYSYFRETEWNILRGYRTQIQTLENKSSLERNEILGSWLQEFGVKTALYEDESCGNT 120

Query: 121 LYAVLHATRGDGTEAMVLAAPWETVEGQYNTGGVALAVAMGRYFSRWPVWSKNIIIVLSE 180
           LY VLHA RGDGTEAMVL+APW   +G++N GG AL VA+ RYFSRWPVWSKNII+V S+
Sbjct: 121 LYGVLHAPRGDGTEAMVLSAPWFNGDGEFNKGGTALVVALARYFSRWPVWSKNIIVVFSD 180

Query: 181 DPHASLRSWVQAYHTKLDLTGGSIEAAIVLDYPGTNDYFQHVEISYEGLNGGMPNLDLLN 240
           DP ASLRSWVQAYHT LDLTGGSIE+A+VLDYPG ND+F++VEI Y GLNG +PNLDL+N
Sbjct: 181 DPKASLRSWVQAYHTSLDLTGGSIESAVVLDYPGVNDFFKYVEIYYAGLNGELPNLDLVN 240

Query: 241 VAVHITEHEGMKVALHGTPWEELGTDTYFSRMRLLLKGIKDMALSGIKRTSGNEAFSGWR 300
           VA+H+TEHEGMKV+L+G P +E+    YF+RM+ ++ GIK MALSG++R  GNEAFSGWR
Sbjct: 241 VAIHVTEHEGMKVSLNGIPEDEMQNRDYFARMKTMVVGIKKMALSGVQRCYGNEAFSGWR 300

Query: 301 IQSVTLKARGTNGSFDITTFGRVPEAMFRSVNNLLEKFHQSFFFYLLLAPRYFVSIGSYL 360
           IQ+V L+ARG +G FDITTFGRVPEA+FRSVNNLLEKFHQSFFFYLLLAPRYFVSI SYL
Sbjct: 301 IQAVVLRARGDHGPFDITTFGRVPEAVFRSVNNLLEKFHQSFFFYLLLAPRYFVSIASYL 360

Query: 361 PAAVGLSISFAVMACDSVLNNEFASLPLISIYNIWXXXXXXXXXXXXXITAEVFFYXXXX 420
           PAAV  S+SF V A D+VL    ++     + NI                +  F      
Sbjct: 361 PAAVAFSVSFIVAALDNVLCQGASTSQSGILPNIAAVVGFTVALLFSFTVSVTFARFHHP 420

Query: 421 XXXXXFNVVVSFMPFALVKYKIQKPFSHRFKAAAYLYFSTVLSSLLVMNFQLAFMVGLLA 480
                ++V+ +  P  L + +IQ  ++HR KA AYLY S VL+SLLV+NF LAF +GLLA
Sbjct: 421 VILISWSVMTALAPILLNRVRIQSSYAHRLKAVAYLYLSVVLTSLLVVNFALAFGIGLLA 480

Query: 481 FPMTFVRTTVHASVRQKMKXXXXXXXXXPFISICVFVHLFEPELTGFSVFYSLIDAWNDL 540
           FP+  V+ +   + R   K         PFIS C+F + FEP L G  +   L+ AWN+ 
Sbjct: 481 FPLILVKNS--TTPRLLFKNSLLLLLSNPFISTCLFAYFFEPLLPGLQILEQLVQAWNEF 538

Query: 541 GCWTWYVLCLGWYPAWIMVAYSSID---SVPIAAPAKKSS 577
           GCWTW V+C+GW P+W+++AYSS+    S  + +  KKSS
Sbjct: 539 GCWTWCVVCIGWLPSWLLIAYSSMITDVSTLLNSAEKKSS 578

>Smik_12.147 Chr12 (295948..297789) [1842 bp, 613 aa] {ON} YLR088W
           (REAL)
          Length = 613

 Score =  676 bits (1745), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 329/612 (53%), Positives = 428/612 (69%), Gaps = 39/612 (6%)

Query: 1   MAVLEKLHRKVVDMGLVPKIIFSLAKISYVTTLLSVAWLTLFLPMEGQYRRTYISENALM 60
           MA+LEKLHR++VDMGLVP+II SL  +S V  L     + + LPM+GQYRRTYISENALM
Sbjct: 1   MALLEKLHRRIVDMGLVPRIIASLPVVSMVCALFGFISIAI-LPMDGQYRRTYISENALM 59

Query: 61  PSQAYSYFRESEWNILRGYRSEIDGMRTLTADERNRIVASWMEEYGAKAAVYNDDRHGET 120
           PSQAYSYFRESEWNILRGYRS+I+ M  +T+ ERN I+ SW++E+G K A+Y ++++GET
Sbjct: 60  PSQAYSYFRESEWNILRGYRSQIEEMVNMTSMERNNIMGSWLQEFGTKTAIYENEQYGET 119

Query: 121 LYAVLHATRGDGTEAMVLAAPWETVEGQYNTGGVALAVAMGRYFSRWPVWSKNIIIVLSE 180
           LY V+HA RGDGTEAMVLA PW   + ++N GG AL V++ R+FSRWPVWSKNIIIV SE
Sbjct: 120 LYGVMHAPRGDGTEAMVLAVPWFNSDDKFNVGGAALGVSLARFFSRWPVWSKNIIIVFSE 179

Query: 181 DPHASLRSWVQAYHTKLDLTGGSIEAAIVLDYPGTNDYFQHVEISYEGLNGGMPNLDLLN 240
           +P A+LRSWV+AYHT LDLTGGSIEAA+V+DY    D+F++VEISY+GLNG +PNLDL+N
Sbjct: 180 NPCAALRSWVEAYHTSLDLTGGSIEAAVVVDYSSAEDFFEYVEISYDGLNGELPNLDLVN 239

Query: 241 VAVHITEHEGMKVALHGTPWEELGTDTYFSRMRLLLKGIKDMALSGIKRTSGNEAFSGWR 300
           VA+ ITEHEGMKV+LHG P ++L  + Y+SR+++L  GI+D AL+G+K   GNEAFSGWR
Sbjct: 240 VAISITEHEGMKVSLHGLPLDQLTINNYWSRLKVLCLGIRDWALAGVKNPHGNEAFSGWR 299

Query: 301 IQSVTLKARGTNGSFDITTFGRVPEAMFRSVNNLLEKFHQSFFFYLLLAPRYFVSIGSYL 360
           IQSVTLKA G +G  DITTFGR+PEAMFRS+NNLLEKFHQSFFFYLLLAPR FVSI SYL
Sbjct: 300 IQSVTLKAHGNSGH-DITTFGRIPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYL 358

Query: 361 PAAVGLSISFAVMACDSVLNNEFASLPLISIYNIWXXXXXXXXXXXXXITAEVFFYXXXX 420
           P+AV LS++FA+ + ++ +NN +AS+ + S YN+              + ++VF      
Sbjct: 359 PSAVALSVAFAISSLNAFINNTYASISIFSEYNLVALLVWFISLVISFVVSQVFLLLPSA 418

Query: 421 XXXXXFNVVVSFMPFALV-KYKIQKPFSHRFKAAAYLYFSTVLSSLLVMNFQLAFMVGLL 479
                 +++  F+P  L  K  I +P S+R K  A+LYFS VL+SLL++NF +A ++G L
Sbjct: 419 GLLMAISMISCFLPLILSKKVHISEPLSYRLKNVAFLYFSLVLTSLLMINFAMALLIGTL 478

Query: 480 AFPMTFVRTTVHAS------------------------------------VRQKMKXXXX 503
           AFPMT V+T + +S                                     RQ++K    
Sbjct: 479 AFPMTLVKTIIESSGEHEVSAKPYISIKTEPKEETELIENYEDIMPGKSQQRQELKNLLL 538

Query: 504 XXXXXPFISICVFVHLFEPELTGFSVFYSLIDAWNDLGCWTWYVLCLGWYPAWIMVAYSS 563
                PFISI +F   F+ E  GF V   L+ AW DL CW+W+VLC+GW P W++V  SS
Sbjct: 539 LVLTNPFISITIFGSFFDDEFQGFDVINKLVSAWLDLKCWSWFVLCIGWLPCWLLVLASS 598

Query: 564 IDSVPIAAPAKK 575
            +S  +   +K+
Sbjct: 599 FESKRVMLKSKE 610

>Suva_10.172 Chr10 (320928..322772) [1845 bp, 614 aa] {ON} YLR088W
           (REAL)
          Length = 614

 Score =  676 bits (1743), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 327/613 (53%), Positives = 428/613 (69%), Gaps = 40/613 (6%)

Query: 1   MAVLEKLHRKVVDMGLVPKIIFSLAKISYVTTLLSVAWLTLFLPMEGQYRRTYISENALM 60
           MA+LEKLHR+VVDMGLVP++I  L  IS +  L     + + LPM+GQYRRTYISENALM
Sbjct: 1   MALLEKLHRRVVDMGLVPRVIALLPVISTLCALFGFISIAI-LPMDGQYRRTYISENALM 59

Query: 61  PSQAYSYFRESEWNILRGYRSEIDGMRTLTADERNRIVASWMEEYGAKAAVYNDDRHGET 120
           PSQAYSYFRE+EWNILRGYRS+I+    +T+ ERN ++ SW++E+G K A+Y ++++GET
Sbjct: 60  PSQAYSYFRETEWNILRGYRSQIEETVNMTSTERNNLMGSWLQEFGTKTAIYENEQYGET 119

Query: 121 LYAVLHATRGDGTEAMVLAAPWETVEGQYNTGGVALAVAMGRYFSRWPVWSKNIIIVLSE 180
           LY V+HA RGDGTEAMVLA PW   E ++N GG +L V++ R+FSRWPVWSKNII+V SE
Sbjct: 120 LYGVMHAPRGDGTEAMVLAIPWFNSEKEFNVGGASLGVSLARFFSRWPVWSKNIIVVFSE 179

Query: 181 DPHASLRSWVQAYHTKLDLTGGSIEAAIVLDYPGTNDYFQHVEISYEGLNGGMPNLDLLN 240
           +PHA+LRSWV+AYHT LDLTGGSIEAA+VLDY    D+F++VE+SY+GLNG +PNLDL+N
Sbjct: 180 NPHAALRSWVEAYHTSLDLTGGSIEAAVVLDYSSAEDFFEYVEVSYDGLNGELPNLDLVN 239

Query: 241 VAVHITEHEGMKVALHGTPWEELGTDTYFSRMRLLLKGIKDMALSGIKRTSGNEAFSGWR 300
           VA+ I EHEGMKV+LHG P+E+LG + +FSR+++L  GI+D ALSG+K   GNEAFSGWR
Sbjct: 240 VAISIIEHEGMKVSLHGLPYEQLGDNDFFSRLKILCLGIRDWALSGVKNPHGNEAFSGWR 299

Query: 301 IQSVTLKARGTNGSFDITTFGRVPEAMFRSVNNLLEKFHQSFFFYLLLAPRYFVSIGSYL 360
           IQSVTLKA G +G  DITTFGR+PEAMFRS+NNLLEKFHQSFFFYLLLAPR FVSI SYL
Sbjct: 300 IQSVTLKAHG-HGGHDITTFGRIPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYL 358

Query: 361 PAAVGLSISFAVMACDSVLNNEFASLPLISIYNIWXXXXXXXXXXXXXITAEVFFYXXXX 420
           P+AV LS++FA+ + ++ +NN++AS+ L S YN+              + +++F      
Sbjct: 359 PSAVALSVAFAMSSLNAFINNDYASISLFSEYNLVAVLVWFIAMVVSFVISQLFLSVLPA 418

Query: 421 XXXXXFNVVVSFMPFALV-KYKIQKPFSHRFKAAAYLYFSTVLSSLLVMNFQLAFMVGLL 479
                 ++ + F+P AL  K  I +P S+R K  A+LYFS V +SLL++NF +A ++G L
Sbjct: 419 GLLMTISLAICFLPIALSGKVHISEPLSYRLKNVAFLYFSLVSTSLLMINFAMALLIGTL 478

Query: 480 AFPMTFVRTTV-------------------------------------HASVRQKMKXXX 502
           AFPMTF++T                                           RQK+K   
Sbjct: 479 AFPMTFIKTIAVERPAEPETGTRSNISIKTEPNDETQLNKHYKEGTLEKNQQRQKLKNLL 538

Query: 503 XXXXXXPFISICVFVHLFEPELTGFSVFYSLIDAWNDLGCWTWYVLCLGWYPAWIMVAYS 562
                 PFISI VF  LF+ E  GF +   L+ AW DL CW+W++LCLGW P W+++  S
Sbjct: 539 LLILTNPFISITVFGLLFDDEFQGFDIINKLVSAWIDLKCWSWFILCLGWLPCWLLILAS 598

Query: 563 SIDSVPIAAPAKK 575
           S +S  +   +K+
Sbjct: 599 SFESKSVVVKSKE 611

>YLR088W Chr12 (316107..317951) [1845 bp, 614 aa] {ON}  GAA1Subunit
           of the GPI (glycosylphosphatidylinositol):protein
           transamidase complex, removes the GPI-anchoring signal
           and attaches GPI to proteins in the ER
          Length = 614

 Score =  674 bits (1739), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 326/613 (53%), Positives = 426/613 (69%), Gaps = 40/613 (6%)

Query: 1   MAVLEKLHRKVVDMGLVPKIIFSLAKISYVTTLLSVAWLTLFLPMEGQYRRTYISENALM 60
           MA+LEKLHR++VDMGLVP+II  L  IS +  L     + + LPM+GQYRRTYISENALM
Sbjct: 1   MALLEKLHRRIVDMGLVPRIIALLPVISMLCALFGFISIAI-LPMDGQYRRTYISENALM 59

Query: 61  PSQAYSYFRESEWNILRGYRSEIDGMRTLTADERNRIVASWMEEYGAKAAVYNDDRHGET 120
           PSQAYSYFRESEWNILRGYRS+I  M  +T+ ERN ++ SW++E+G K A+Y ++++GET
Sbjct: 60  PSQAYSYFRESEWNILRGYRSQIKEMVNMTSMERNNLMGSWLQEFGTKTAIYENEQYGET 119

Query: 121 LYAVLHATRGDGTEAMVLAAPWETVEGQYNTGGVALAVAMGRYFSRWPVWSKNIIIVLSE 180
           LY V+HA RGDGTEAMVLA PW   + ++N GG AL V++ R+FSRWPVWSKNII+V SE
Sbjct: 120 LYGVMHAPRGDGTEAMVLAVPWFNSDDEFNIGGAALGVSLARFFSRWPVWSKNIIVVFSE 179

Query: 181 DPHASLRSWVQAYHTKLDLTGGSIEAAIVLDYPGTNDYFQHVEISYEGLNGGMPNLDLLN 240
           +P A+LRSWV+AYHT LDLTGGSIEAA+VLDY  T D+F++VEISY+GLNG +PNLDL+N
Sbjct: 180 NPRAALRSWVEAYHTSLDLTGGSIEAAVVLDYSSTEDFFEYVEISYDGLNGELPNLDLVN 239

Query: 241 VAVHITEHEGMKVALHGTPWEELGTDTYFSRMRLLLKGIKDMALSGIKRTSGNEAFSGWR 300
           +A+ ITEHEGMKV+LHG P ++L  + ++SR+++L  GI+D ALSG+K+  GNEAFSGWR
Sbjct: 240 IAISITEHEGMKVSLHGLPSDQLTNNNFWSRLKILCLGIRDWALSGVKKPHGNEAFSGWR 299

Query: 301 IQSVTLKARGTNGSFDITTFGRVPEAMFRSVNNLLEKFHQSFFFYLLLAPRYFVSIGSYL 360
           IQSVTLKA G +G  DITTFGR+PEAMFRS+NNLLEKFHQSFFFYLLLAPR FVSI SYL
Sbjct: 300 IQSVTLKAHGNSGH-DITTFGRIPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYL 358

Query: 361 PAAVGLSISFAVMACDSVLNNEFASLPLISIYNIWXXXXXXXXXXXXXITAEVFFYXXXX 420
           P+AV LSI+FA+ + ++ +NN +A++ L S YN+              + ++ F      
Sbjct: 359 PSAVALSIAFAISSLNAFINNAYANISLFSEYNLVALLVWFVSLVISFVVSQAFLLIPSS 418

Query: 421 XXXXXFNVVVSFMPFALV-KYKIQKPFSHRFKAAAYLYFSTVLSSLLVMNFQLAFMVGLL 479
                 ++   F+P  L  K  I +P S+R K  A+LYFS V +SLL++NF +A ++G L
Sbjct: 419 GLLMTISMASCFLPLILSRKIHISEPLSYRLKNVAFLYFSLVSTSLLMINFAMALLIGTL 478

Query: 480 AFPMTFVRTTVHASV-------------------------------------RQKMKXXX 502
           AFPMTFV+T V +S                                      +QK+K   
Sbjct: 479 AFPMTFVKTIVESSSEHEVTTQSSNPIKTEPKDEIELVENHMDTTPATPQQQKQKLKNLV 538

Query: 503 XXXXXXPFISICVFVHLFEPELTGFSVFYSLIDAWNDLGCWTWYVLCLGWYPAWIMVAYS 562
                 PFISI +F   F+ E  GF +   L+ AW DL CW+W+VLC+GW P W+++  S
Sbjct: 539 LLILTNPFISITLFGLFFDDEFHGFDIINKLVSAWLDLKCWSWFVLCIGWLPCWLLILAS 598

Query: 563 SIDSVPIAAPAKK 575
           S +S  +   +K+
Sbjct: 599 SFESKSVVVRSKE 611

>Skud_12.156 Chr12 (299282..301120) [1839 bp, 612 aa] {ON} YLR088W
           (REAL)
          Length = 612

 Score =  671 bits (1732), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 327/611 (53%), Positives = 424/611 (69%), Gaps = 38/611 (6%)

Query: 1   MAVLEKLHRKVVDMGLVPKIIFSLAKISYVTTLLSVAWLTLFLPMEGQYRRTYISENALM 60
           MA+LEKLHR++VDMGLVP+II  L  IS +  L     + + LPM+GQYRRTYISENALM
Sbjct: 1   MALLEKLHRRIVDMGLVPRIIALLPVISTLCALFGFISIAI-LPMDGQYRRTYISENALM 59

Query: 61  PSQAYSYFRESEWNILRGYRSEIDGMRTLTADERNRIVASWMEEYGAKAAVYNDDRHGET 120
           PSQAYSYFRESEWN+LRGYRS+I+ M  +T+ ERN  + SW++E+G K A+Y   ++GET
Sbjct: 60  PSQAYSYFRESEWNVLRGYRSQIEEMENMTSSERNNQMGSWLQEFGTKTAIYESQQYGET 119

Query: 121 LYAVLHATRGDGTEAMVLAAPWETVEGQYNTGGVALAVAMGRYFSRWPVWSKNIIIVLSE 180
           LY V+HA RGDGTEAMVLA PW   + ++N GG AL V++ R+FSRWPVWSKNII+V SE
Sbjct: 120 LYGVMHAPRGDGTEAMVLAIPWFNSDDEFNVGGAALGVSLARFFSRWPVWSKNIIVVFSE 179

Query: 181 DPHASLRSWVQAYHTKLDLTGGSIEAAIVLDYPGTNDYFQHVEISYEGLNGGMPNLDLLN 240
           +P A+LRSWV+AYHT LDLTGGSIEAA+VLDY    D+F++VEISY+GLNG +PNLDL+N
Sbjct: 180 NPRAALRSWVEAYHTSLDLTGGSIEAAVVLDYSSAEDFFEYVEISYDGLNGELPNLDLVN 239

Query: 241 VAVHITEHEGMKVALHGTPWEELGTDTYFSRMRLLLKGIKDMALSGIKRTSGNEAFSGWR 300
           +A+ ITEHEGMKV+LHG P+++L  + ++SR+++L  GI+D ALSG+K   GNEAFSGWR
Sbjct: 240 IAISITEHEGMKVSLHGLPYDQLANNDFWSRLKILSLGIRDWALSGVKNPHGNEAFSGWR 299

Query: 301 IQSVTLKARGTNGSFDITTFGRVPEAMFRSVNNLLEKFHQSFFFYLLLAPRYFVSIGSYL 360
           IQSVTLKA G +G  DITTFGR+PEAMFRS+NNLLEKFHQSFFFYLLLAPR FVSI SYL
Sbjct: 300 IQSVTLKAHG-HGGHDITTFGRIPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYL 358

Query: 361 PAAVGLSISFAVMACDSVLNNEFASLPLISIYNIWXXXXXXXXXXXXXITAEVFFYXXXX 420
           P+AV  S++FA+ + ++ +NN +AS+ L S YN+              I +++F      
Sbjct: 359 PSAVAFSVAFAISSLNAFINNAYASISLFSEYNLVALLVWFISLVVSFIISQIFLLVPSV 418

Query: 421 XXXXXFNVVVSFMPFALV-KYKIQKPFSHRFKAAAYLYFSTVLSSLLVMNFQLAFMVGLL 479
                 ++   F+P  L  K  I +P S+R K  A+LYFS V +SLL++NF +A ++G L
Sbjct: 419 GLLMTISLATCFLPLVLSEKVHISEPLSYRLKNVAFLYFSLVSTSLLMINFAMALLIGSL 478

Query: 480 AFPMTFVRTTV-------------HASV----------------------RQKMKXXXXX 504
           AFPMTF+RT V             H SV                      RQ++K     
Sbjct: 479 AFPMTFIRTIVVGKSTEHEMGTKSHTSVKTESRDDLFEHHGDTVLEKAKKRQQLKNLLLL 538

Query: 505 XXXXPFISICVFVHLFEPELTGFSVFYSLIDAWNDLGCWTWYVLCLGWYPAWIMVAYSSI 564
               PFISI +F  +F+ E  GF +   LI AW DL CW W+VLC+GW P W+++  SS 
Sbjct: 539 VLTNPFISITLFALVFDNEFHGFDIVNKLISAWLDLKCWNWFVLCIGWLPCWLLILASSF 598

Query: 565 DSVPIAAPAKK 575
           +S  +   +K+
Sbjct: 599 ESRSVVVKSKE 609

>Kpol_543.37 s543 (82589..84325) [1737 bp, 578 aa] {ON}
           (82589..84325) [1737 nt, 579 aa]
          Length = 578

 Score =  644 bits (1661), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/578 (53%), Positives = 415/578 (71%), Gaps = 5/578 (0%)

Query: 1   MAVLEKLHRKVVDMGLVPKIIFSLAKISYVTTLLSVAWLTLFLPMEGQYRRTYISENALM 60
           M++LE L R+++D GL+PK + +L K+S +   +SV  L L+LPM+GQ+RRTYISENALM
Sbjct: 1   MSILENLQRRLIDAGLLPKFLAALPKLSMLLVSVSVM-LMLYLPMDGQFRRTYISENALM 59

Query: 61  PSQAYSYFRESEWNILRGYRSEIDGMRTLTADERNRIVASWMEEYGAKAAVYNDDRHGET 120
           PSQAYSYFRE+EWNILRGYR EI+ + + ++ ERN I++SW+EE+G K +VY +  +G++
Sbjct: 60  PSQAYSYFRETEWNILRGYRKEIEVLSSHSSIERNAIMSSWLEEFGLKTSVYKNQEYGDS 119

Query: 121 LYAVLHATRGDGTEAMVLAAPWETVEGQYNTGGVALAVAMGRYFSRWPVWSKNIIIVLSE 180
           LY V +A RGDGTE+MVLA PW   E ++N  G AL V++ R+ SRWPVWSKNII+V SE
Sbjct: 120 LYGVFNAPRGDGTESMVLAVPWYNAEDEFNVSGAALGVSLARFLSRWPVWSKNIIVVFSE 179

Query: 181 DPHASLRSWVQAYHTKLDLTGGSIEAAIVLDYPGTNDYFQHVEISYEGLNGGMPNLDLLN 240
           +P  +LRSWV+AYHT LDLTGGSIEAA+VLDYPG +DYF+++E+ Y G NG +PNLDL+N
Sbjct: 180 NPREALRSWVEAYHTSLDLTGGSIEAAVVLDYPGVSDYFEYIEVHYNGYNGVLPNLDLVN 239

Query: 241 VAVHITEHEGMKVALHGTPWEELGTDTYFSRMRLLLKGIKDMALSGIKRTSGNEAFSGWR 300
           +A+ I EHEG+KV+LHG   +E+G   Y+SR++++  G K++AL+G++   GNEAFSGWR
Sbjct: 240 IAISIAEHEGLKVSLHGLTPDEMGNGDYWSRLKMISLGTKNLALTGVREVYGNEAFSGWR 299

Query: 301 IQSVTLKARGTNGSFDITTFGRVPEAMFRSVNNLLEKFHQSFFFYLLLAPRYFVSIGSYL 360
           IQ++TLKARG + + D+TTFGRV EAMFRS+NNLLEKFHQSFFFY LLAPRYFVSIGSYL
Sbjct: 300 IQALTLKARG-DTNHDVTTFGRVAEAMFRSINNLLEKFHQSFFFYFLLAPRYFVSIGSYL 358

Query: 361 PAAVGLSISFAVMACDSVLNNEFASLPLISIYNIWXXXXXXXXXXXXXITAEVFFYXXXX 420
           PAAV LSISFAV + DS +NN++ S+   S YN+                   F Y    
Sbjct: 359 PAAVVLSISFAVASIDSFVNNQYVSMVDSSYYNLLSFIFWAVSVIVCFFLGNSFTYYPQP 418

Query: 421 XXXXXFNVVVSFMPFALVK-YKIQKPFSHRFKAAAYLYFSTVLSSLLVMNFQLAFMVGLL 479
                 NVV+S +P A  K   I +P ++R K  +++Y S V++SLLV+NF LAF +GL 
Sbjct: 419 LLLLLGNVVISTIPLAAPKNLSISEPLAYRLKTISFMYLSLVMTSLLVVNFPLAFGMGLF 478

Query: 480 AFPMTFVRTTVHASVRQKMKXXXXXXXXXPFISICVFVHLFEPELTGFSVFYSLIDAWND 539
           A+PMT V      ++R K +         PFI+  +F+ + E +L G    Y L+DAWN 
Sbjct: 479 AYPMTLVMLNNTDNLRLKTRNSILLAISNPFIAFWLFITIVESKLDGIEAIYGLVDAWNK 538

Query: 540 LGCWTWYVLCLGWYPAWIMVAYSS--IDSVPIAAPAKK 575
           LG WTW++ C+GW+P+WI+VA S+  ++ V     +KK
Sbjct: 539 LGSWTWFIFCIGWFPSWILVAISALKVEQVQTEPNSKK 576

>ZYRO0C01672g Chr3 complement(119344..121053) [1710 bp, 569 aa] {ON}
           similar to uniprot|P39012 Saccharomyces cerevisiae
           YLR088W GAA1 Subunit of the GPI:protein transamidase
           complex removes the GPI-anchoring signal and attaches
           GPI (glycosylphosphatidylinositol) to proteins in the ER
          Length = 569

 Score =  639 bits (1647), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/580 (54%), Positives = 414/580 (71%), Gaps = 17/580 (2%)

Query: 1   MAVLEKLHRKVVDMGLVPKIIFSLAKISYVTTLLSVAWLTLFLPMEGQYRRTYISENALM 60
           MA++E+L R+VV+MGLVPKII  L  +S +  ++S  WL   LP+EGQ+RRTYISENALM
Sbjct: 1   MALIEQLQRRVVEMGLVPKIIALLPLVSMICAMISSLWLAT-LPIEGQFRRTYISENALM 59

Query: 61  PSQAYSYFRESEWNILRGYRSEIDGMRTLTADERNRIVASWMEEYGAKAAVYNDDRHGET 120
           PSQAYSYFRESEWNILRGYRS+I+    ++ +ERN  +A W++E+GAK ++YN++ +G++
Sbjct: 60  PSQAYSYFRESEWNILRGYRSQIEHFGEISNNERNEQMAEWLQEFGAKTSIYNNEEYGDS 119

Query: 121 LYAVLHATRGDGTEAMVLAAPWETVEGQYNTGGVALAVAMGRYFSRWPVWSKNIIIVLSE 180
           LY +LHA RGDGTEA++LA PW   EG  N GG +L +++ R+FSRWPVWSKNIIIV SE
Sbjct: 120 LYGILHAERGDGTEAILLAVPWYNAEGDLNVGGASLGISLSRFFSRWPVWSKNIIIVFSE 179

Query: 181 DPHASLRSWVQAYHTKLDLTGGSIEAAIVLDYPGTNDYFQHVEISYEGLNGGMPNLDLLN 240
           +P+ +LRSWVQAYHT LDLTGGSIEAAIVLDYPGTNDYF + EISY GLNG +PNLDL+N
Sbjct: 180 NPNVALRSWVQAYHTSLDLTGGSIEAAIVLDYPGTNDYFDYAEISYGGLNGELPNLDLVN 239

Query: 241 VAVHITEHEGMKVALHGTPWEELGTDTYFSRMRLLLKGIKDMALSGIKRTSGNEAFSGWR 300
           +AV ITEHEG+ V+LHG   E +  ++Y+SR+++LL GI   A +G++   GNEAFSGWR
Sbjct: 240 IAVSITEHEGVHVSLHGMTPESINDESYWSRLKILLCGIYRDAFAGLEPLQGNEAFSGWR 299

Query: 301 IQSVTLKARGTN-GSFDITTFGRVPEAMFRSVNNLLEKFHQSFFFYLLLAPRYFVSIGSY 359
           IQSVT+KA G   G+ DITTFGR+PEAMFRS+NNLLEKFHQS+FFY+L+APRYFVSI SY
Sbjct: 300 IQSVTIKAHGKEGGNNDITTFGRIPEAMFRSINNLLEKFHQSYFFYMLVAPRYFVSISSY 359

Query: 360 LPAAVGLSISFAVMACDSVLNNEFASLPLISIYNIWXXXXXXXXXXXXXITAEVFFYXXX 419
           LPA V L+  FA+ + +S+L N++++L   S YN+              + +++F Y   
Sbjct: 360 LPATVVLTAGFALASLNSLLANQYSNLSFYSHYNLKALLFWLVSILVSFVFSQLFLYVPS 419

Query: 420 XXXXXXFNVVVSFMPFALVK-YKIQKPFSHRFKAAAYLYFSTVLSSLLVMNFQLAFMVGL 478
                 F VV+  +P A  + + I +P SHR +  A+LY S V++SL+++NF LAF+VG+
Sbjct: 420 TILLVAFIVVMLLLPLAAGRLWTITEPLSHRLQMYAFLYMSLVVTSLMMVNFTLAFVVGI 479

Query: 479 LAFPMTFVRTTVHASVRQKMKXXXXXXXXXPFISICVFVHLFEPELTGFSVFYSLIDAWN 538
           LAFPMT V T    +     K         P +S   F+    P+L        LI AW 
Sbjct: 480 LAFPMTAVGTQRSLT----FKKYALLIISNPLVSF--FIVKPHPQL-----LQKLISAWQ 528

Query: 539 DLGCWTWYVLCLGWYPAWIMVAYSSIDSV---PIAAPAKK 575
           DLGCWTW+VLCLGW P+W ++A S+  S    P+A   K+
Sbjct: 529 DLGCWTWFVLCLGWLPSWTLIALSACSSTNLDPVATSKKE 568

>TBLA0F03080 Chr6 complement(747695..749446) [1752 bp, 583 aa] {ON}
           Anc_8.261 YLR088W
          Length = 583

 Score =  638 bits (1646), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 308/570 (54%), Positives = 413/570 (72%), Gaps = 5/570 (0%)

Query: 1   MAVLEKLHRKVVDMGLVPKIIFSLAKISYVTTLLSVAWLTLFLPMEGQYRRTYISENALM 60
           MA+L  +HR+V+DMGLVPKI+  L  +S     + +  L L LPM+GQYR TYISENALM
Sbjct: 1   MALLATIHRRVIDMGLVPKIMKRLPLVSIFLAAIGIV-LFLMLPMDGQYRHTYISENALM 59

Query: 61  PSQAYSYFRESEWNILRGYRSEIDGMRTLTADERNRIVASWMEEYGAKAAVYNDDRHGET 120
           PSQAYSYFRESEWNILRGYR+EID   ++ + +RN ++  W+EE+G K +VY++D +G+T
Sbjct: 60  PSQAYSYFRESEWNILRGYRTEIDIFPSMPSRDRNLVMTQWLEEFGTKTSVYHNDEYGDT 119

Query: 121 LYAVLHATRGDGTEAMVLAAPWETVEGQYNTGGVALAVAMGRYFSRWPVWSKNIIIVLSE 180
           LY + +A RGDGTEA+VLA PW   +G++NTGG AL +A+ R+FSRWP+WSKNII+V SE
Sbjct: 120 LYGIFNAPRGDGTEAIVLAIPWYNADGEFNTGGAALGIALSRFFSRWPIWSKNIIVVFSE 179

Query: 181 DPHASLRSWVQAYHTKLDLTGGSIEAAIVLDYPGTNDYFQHVEISYEGLNGGMPNLDLLN 240
           +P  +LRSWV AYH  LDLTGGSIEAAIV+DYP ++D+F +VEI Y G+NG +PNLDLLN
Sbjct: 180 NPDGALRSWVDAYHHSLDLTGGSIEAAIVMDYPSSSDFFDYVEIYYHGINGELPNLDLLN 239

Query: 241 VAVHITEHEGMKVALHGTPWEELGTDTYFSRMRLLLKGIKDMALSGIKRTSGNEAFSGWR 300
           +A+ ITEHEGM+V+LHG P E L  + YFSR+R LL G KD  LSGIK   GNEAFSG+R
Sbjct: 240 IAIQITEHEGMQVSLHGLPKESLHQNNYFSRLRTLLLGTKDALLSGIKPRHGNEAFSGFR 299

Query: 301 IQSVTLKARGT--NGSFDITTFGRVPEAMFRSVNNLLEKFHQSFFFYLLLAPRYFVSIGS 358
           IQ++TLKA+ T  N   DIT+FGR+ EA FRSVNNLLEKFHQSFFFYL+LAP+YFVSI S
Sbjct: 300 IQAITLKAKFTPDNNDHDITSFGRIAEASFRSVNNLLEKFHQSFFFYLILAPKYFVSISS 359

Query: 359 YLPAAVGLSISFAVMACDSVLNNEFASLPLISIYNIWXXXXXXXXXXXXXITAEVFFYXX 418
           YLP+AV  S++FA+ +  S +NN +++LP+ S YN+                A +     
Sbjct: 360 YLPSAVTFSVAFAISSLSSYINNSYSTLPIFSEYNLLAGLLFTISITFSFFVARLSLLFT 419

Query: 419 XXXXXXXFNVVVSFMPFAL-VKYKIQKPFSHRFKAAAYLYFSTVLSSLLVMNFQLAFMVG 477
                   +V +S +P  L  ++ I +P S+R K+ A+LY S VL+SLLV+NF LAF +G
Sbjct: 420 EPRLLVLGSVFLSVLPHLLGNRFTIPEPLSYRLKSIAFLYISLVLTSLLVLNFSLAFGIG 479

Query: 478 LLAFPMTFVRT-TVHASVRQKMKXXXXXXXXXPFISICVFVHLFEPELTGFSVFYSLIDA 536
           +L F MT V+T T+H+S+R +++         PF S+ +F ++F+ ++ G  +FY  I +
Sbjct: 480 ILGFAMTAVKTITIHSSMRVRVRNTMHLLLSNPFTSVLLFTYIFDKDIYGIKIFYEFIHS 539

Query: 537 WNDLGCWTWYVLCLGWYPAWIMVAYSSIDS 566
           WN L CWTW+++C+GW P WI+V+ SSI +
Sbjct: 540 WNTLNCWTWFIICVGWLPPWILVSISSIQT 569

>CAGL0L12232g Chr12 (1324754..1326529) [1776 bp, 591 aa] {ON}
           similar to uniprot|P39012 Saccharomyces cerevisiae
           YLR088w required for attachment of GPI anchor onto
           proteins
          Length = 591

 Score =  625 bits (1613), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/579 (51%), Positives = 415/579 (71%), Gaps = 11/579 (1%)

Query: 1   MAVLEKLHRKVVDMGLVPKIIFSLAKISYVTTLLSVAWLTLFLPMEGQYRRTYISENALM 60
           M++L+K++R++ + G + K++  L ++S +  ++++  L   LP++GQYRRTYISENALM
Sbjct: 1   MSLLQKVYRRLSERGAITKLLQQLPRVSNLLVVVAIV-LLAILPLDGQYRRTYISENALM 59

Query: 61  PSQAYSYFRESEWNILRGYRSEIDGMRTLTADERNRIVASWMEEYGAKAAVYNDDRHGET 120
           PSQAYSYFRE+EWNILRGYRS+I+ +   + D+RN +VA W++E G K A+Y  ++ G+T
Sbjct: 60  PSQAYSYFRETEWNILRGYRSQIETLEHSSVDQRNEVVAEWLQEQGLKTALYEHEKWGKT 119

Query: 121 LYAVLHATRGDGTEAMVLAAPWETVEGQYNTGGVALAVAMGRYFSRWPVWSKNIIIVLSE 180
           LY VLHA+RGDGTEAMVLA PW+ V+ Q+N GG AL V++ ++F RWPVWSKNII+V SE
Sbjct: 120 LYGVLHASRGDGTEAMVLAIPWKNVDDQFNLGGAALGVSLSQFFKRWPVWSKNIIVVFSE 179

Query: 181 DPHASLRSWVQAYHTKLDLTGGSIEAAIVLDYPGTNDYFQHVEISYEGLNGGMPNLDLLN 240
           D  A+LR+WV AYHT LDLT GSIEAA+VLDYP  +D+F++VEISY+GLNG +PNLDL+N
Sbjct: 180 DSGAALRAWVDAYHTSLDLTAGSIEAAVVLDYPSKSDFFEYVEISYDGLNGELPNLDLVN 239

Query: 241 VAVHITEHEGMKVALHGTPWEELGTDTYFSRMRLLLKGIKDMALSGIKRTSGNEAFSGWR 300
           +AV ITEHEGMKV+LHG P  E+    YF+R++++  GIK+ ALSG+KR  GNEAFSGWR
Sbjct: 240 IAVSITEHEGMKVSLHGLPPNEMYNTDYFARLKIMFVGIKNWALSGVKRIHGNEAFSGWR 299

Query: 301 IQSVTLKARGTNGSFDITTFGRVPEAMFRSVNNLLEKFHQSFFFYLLLAPRYFVSIGSYL 360
           IQSVTL+A G  G  DIT FGR+PEAMFRSVNNLLEKFHQS+FFYLLLAPR FVSI +YL
Sbjct: 300 IQSVTLRAHGNEGQLDITCFGRIPEAMFRSVNNLLEKFHQSYFFYLLLAPRNFVSISNYL 359

Query: 361 PAAVGLSISFAVMACDSVLNNEFASLPLISIYNIWXXXXXXXXXXXXXITAEVFFYXXXX 420
           P+AV +S++FAV++ DS +NN++ S+P  S+  +              + + V       
Sbjct: 360 PSAVIISVAFAVISLDSAINNDYLSIPFSSVNTLVPFIILSASVFVSFLISRVLIMLPIV 419

Query: 421 XXXXXFNVVVSFMPFALVK---YKIQKPFSHRFKAAAYLYFSTVLSSLLVMNFQLAFMVG 477
                 +V ++F+P  + K   + I +  ++R K+   +Y+S +L+SLL++NF L FM+G
Sbjct: 420 ESLLFGSVALTFLPLVMSKKNIHVINQAVAYRLKSIGSIYYSLILTSLLMVNFALTFMIG 479

Query: 478 LLAFPMTFV-----RTTVHASVRQKMKXXXXXXXXXPFISICVFVHLFEPELTG-FSVFY 531
           LLAFP+T +     +T    S +  +K         PFIS+ +F    + +  G FSV Y
Sbjct: 480 LLAFPLTKLAVISTKTIADESRKSILKNTFILFITNPFISLWLFTATMDTDFNGSFSVIY 539

Query: 532 S-LIDAWNDLGCWTWYVLCLGWYPAWIMVAYSSIDSVPI 569
           + +I +W+ LGCWTW+++CLGW P W++   SSI S PI
Sbjct: 540 NRMITSWDTLGCWTWFIICLGWLPYWLISVISSIPSQPI 578

>NDAI0J01390 Chr10 complement(319754..321505) [1752 bp, 583 aa] {ON}
           Anc_8.261 YLR088W
          Length = 583

 Score =  622 bits (1605), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 306/584 (52%), Positives = 415/584 (71%), Gaps = 10/584 (1%)

Query: 1   MAVLEKLHRKVVDMGLVPKIIFSLAKISYVTTLLSVAWLTLFLPMEGQYRRTYISENALM 60
           M +LE++ R +V  GL+PKI+  L KIS +   +S+  + + LPM+GQYR TYISENALM
Sbjct: 1   MGLLERVQRVIVSRGLIPKIMAQLPKISIIFVAISILMIAI-LPMDGQYRNTYISENALM 59

Query: 61  PSQAYSYFRESEWNILRGYRSEIDGMRTLTADERNRIVASWMEEYGAKAAVYNDDRHGET 120
           PSQAYSYFRE+EWNI+RGYR+E+  M   T+ ERN+I+ SW+ E+G K  +Y ++R  E 
Sbjct: 60  PSQAYSYFRETEWNIVRGYRNELVHMENSTSRERNQIMESWLNEFGVKTQIY-ENRDNEV 118

Query: 121 LYAVLHATRGDGTEAMVLAAPWETVEGQYNTGGVALAVAMGRYFSRWPVWSKNIIIVLSE 180
           LY V HA RGDGTEA+VLA PW  V+G++NT G A+ VA+ RYFSRWPVWSKNII+V SE
Sbjct: 119 LYGVFHAPRGDGTEAIVLAVPWFNVDGEFNTNGAAVGVALARYFSRWPVWSKNIIVVFSE 178

Query: 181 DPHASLRSWVQAYHTKLDLTGGSIEAAIVLDYPGTNDYFQHVEISYEGLNGGMPNLDLLN 240
           +P ++LRSWV+AY+T LDLTGGSIEAAIVLD PG NDYF ++E+ Y+GLNG +PNLDL+N
Sbjct: 179 NPDSALRSWVEAYYTSLDLTGGSIEAAIVLDSPGENDYFDYLEVYYDGLNGELPNLDLVN 238

Query: 241 VAVHITEHEGMKVALHGTPWEELGTDTYFSRMRLLLKGIKDMALSGIKRTSGNEAFSGWR 300
           + ++I EHEGM+V+LHGTP++++  + Y++R+++L+  I+  A SG+ +T GNEAFSGWR
Sbjct: 239 IGIYIAEHEGMRVSLHGTPFDQIKENNYWTRLKILVASIQSSAFSGLTKTHGNEAFSGWR 298

Query: 301 IQSVTLKARGTNGSFDITTFGRVPEAMFRSVNNLLEKFHQSFFFYLLLAPRYFVSIGSYL 360
           IQS+TLK +G +G  DIT FGRVPEAMFRS+NNLLEKFHQSFFFYLLLAPR FVSI SYL
Sbjct: 299 IQSITLKTKGNSGPLDITCFGRVPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSYL 358

Query: 361 PAAVGLSISFAVMACDSVLNNEFASLPLISIYNIWXXXXXXXXXXXXXITAEVFFYXXXX 420
           P+AV LS++F +   DS +NN   +LP  S Y +              I A++F      
Sbjct: 359 PSAVILSVAFVIAFMDSYINNPSFALPFFSNYTLIPAIVWTVTLVACFILAQLFLILPIP 418

Query: 421 XXXXXFNVVVSFMPFALVKYKIQKP-FSHRFKAAAYLYFSTVLSSLLVMNFQLAFMVGLL 479
                 N+V+S     +   K+ KP  S+R ++ A+L+ S +L+SLL++NF L+FM+GL+
Sbjct: 419 SLLLLINIVISISSIIIQNKKLFKPAVSNRLRSFAFLHLSLILTSLLMVNFPLSFMIGLM 478

Query: 480 AFPMTFVRT-TVHASVRQKMKXXXXXXXXXPFISICVFVHLFEPE----LTGFSVFYSLI 534
           AFPMT VR+ T + + + K++         PFI++ ++ ++        L G  V   LI
Sbjct: 479 AFPMTKVRSITANTAPQIKLENIILLMISNPFIALIIYNNVSSNSGLQGLQGLRVINRLI 538

Query: 535 DAWNDLGCWTWYVLCLGWYPAWIMVAYSSIDS--VPIAAPAKKS 576
            AW D+ CWTW+VLCLGW P+WIMVA S I++   P +   KK+
Sbjct: 539 SAWKDMRCWTWFVLCLGWLPSWIMVAISVIENEREPTSHDVKKN 582

>KNAG0H03250 Chr8 complement(605885..607642) [1758 bp, 585 aa] {ON}
           Anc_8.261 YLR088W
          Length = 585

 Score =  622 bits (1603), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/590 (53%), Positives = 410/590 (69%), Gaps = 18/590 (3%)

Query: 1   MAVLEKLHRKVVDMGLVPKIIFSLAKISYVTTLLSVAWLTLFLPMEGQYRRTYISENALM 60
           M + E L RK V +GL+PK++ +L  +S +T ++SV  + L +PM GQYR TYISENALM
Sbjct: 1   MGLFETLQRKAVKLGLLPKLLAALPLLSALTAVVSVV-MILIIPMNGQYRNTYISENALM 59

Query: 61  PSQAYSYFRESEWNILRGYRSEIDGM--RTLTADERNRIVASWMEEYGAKAAVYNDDRHG 118
           PSQAYSYFRE+EWNILRGYR+EI+ +  R ++A +R  IVA W+ E+GAK AVY ++  G
Sbjct: 60  PSQAYSYFRETEWNILRGYRTEIEVLNSRGVSASDRYDIVAGWLNEFGAKTAVYRNEEMG 119

Query: 119 ETLYAVLHATRGDGTEAMVLAAPWETVEGQYNTGGVALAVAMGRYFSRWPVWSKNIIIVL 178
           +TLY VLHA RGDGTEAMVL APW   EG++N GG ALA+A+ RYFSRWPVWSKNII+V 
Sbjct: 120 DTLYGVLHAPRGDGTEAMVLCAPWNNSEGEFNIGGSALAIALSRYFSRWPVWSKNIIVVF 179

Query: 179 SEDPHASLRSWVQAYHTKLDLTGGSIEAAIVLDYPGTNDYFQHVEISYEGLNGGMPNLDL 238
           S++P  +LRSWV+AYHT LDLTGGSIEAA++LDYP  NDYF + EI +EGLNG +PNLDL
Sbjct: 180 SDNPSVALRSWVEAYHTSLDLTGGSIEAAVILDYPSNNDYFNYTEIHFEGLNGELPNLDL 239

Query: 239 LNVAVHITEHEGMKVALHGTPWEELGTDTYFSRMRLLLKGIKDMALSGIKRTSGNEAFSG 298
           +NVAVHIT+HEGMKV+LHG P  EL  + Y+SR++LL  G+KD  L+G+K+  GNE FSG
Sbjct: 240 VNVAVHITQHEGMKVSLHGLPRSELEKNNYWSRLKLLFLGMKDSTLAGMKKAHGNEVFSG 299

Query: 299 WRIQSVTLKARGTNGSFDITTFGRVPEAMFRSVNNLLEKFHQSFFFYLLLAPRYFVSIGS 358
           WRIQ+VTLKARG  G  DITTFGR+PEAMFRS+NNLLEKFHQSFFFY LL+P  FVSI S
Sbjct: 300 WRIQAVTLKARG-EGQIDITTFGRIPEAMFRSINNLLEKFHQSFFFYFLLSPNNFVSISS 358

Query: 359 YLPAAVGLSISFAVMACDSVLNNEFASLPLISIYNIWXXXXXXXXXXXXXITAEVFFYXX 418
           YLP+AV LSI+FA+ A D+ +NN +AS   I+ Y +              + A  F Y  
Sbjct: 359 YLPSAVLLSITFAIAAVDATVNNAYASALHIT-YTLLAALASVISLLVSFLVAHWFLYST 417

Query: 419 XXXXXXXF-NVVVSFMPFALVKYK--IQKPFSHRFKAAAYLYFSTVLSSLLVMNFQLAFM 475
                    +VV++  P  + +    +++P  +R +   Y+Y+S +L+SLL++NF LAF 
Sbjct: 418 TSPLYLILGSVVLAVSPLVMSRSNNALREPVCYRMRTLGYIYYSLILTSLLMLNFPLAFS 477

Query: 476 VGLLAFPMTFVRTTVHASVRQ---KMKXXXXXXXXXPFIS---ICVFVHLFEPELTGFSV 529
           +GL  +PMT V+     S  Q   K++         PF++   IC  V     E     V
Sbjct: 478 IGLFGYPMTLVKPLNIYSKSQMSLKLRNSVLLVISNPFVATWLICTVVE--NSEFPNLDV 535

Query: 530 FYSLIDAWNDLGCWTWYVLCLGWYPAWIMVAYSSIDSVPIAAPA--KKSS 577
           F +L  AW DL CWTW+VLCLGW P W++V +SS  S+P A     KKS+
Sbjct: 536 FAALFSAWKDLNCWTWFVLCLGWLPTWLLVTFSSFTSIPAAETTIEKKSN 585

>NCAS0B03860 Chr2 complement(687424..689175) [1752 bp, 583 aa] {ON}
           Anc_8.261 YLR088W
          Length = 583

 Score =  617 bits (1592), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/579 (52%), Positives = 409/579 (70%), Gaps = 5/579 (0%)

Query: 1   MAVLEKLHRKVVDMGLVPKIIFSLAKISYVTTLLSVAWLTLFLPMEGQYRRTYISENALM 60
           M + E++ R+V+  GL+PK+I  L  IS +  +L +  +   LP EGQYR TYISENALM
Sbjct: 1   MGLFERVQRQVIARGLIPKVISLLPLISTLCIVLGIV-IIGILPFEGQYRNTYISENALM 59

Query: 61  PSQAYSYFRESEWNILRGYRSEIDGMRTLTADERNRIVASWMEEYGAKAAVYNDDRHGET 120
           PSQAYSYFRESEWNI+RGYRS+I  +R  +A ERN I++ W++++G K  +Y +   G+T
Sbjct: 60  PSQAYSYFRESEWNIVRGYRSQIVELRNASAVERNAIMSEWLQQFGTKTDIYQNHETGDT 119

Query: 121 LYAVLHATRGDGTEAMVLAAPWETVEGQYNTGGVALAVAMGRYFSRWPVWSKNIIIVLSE 180
           LY V HA RGDGTE+MVLA PW   +G++N  G AL VA+ RYFSRWPVWSKNII+V +E
Sbjct: 120 LYGVFHAPRGDGTESMVLAIPWFNADGEFNVNGAALGVALARYFSRWPVWSKNIIVVFTE 179

Query: 181 DPHASLRSWVQAYHTKLDLTGGSIEAAIVLDYPGTNDYFQHVEISYEGLNGGMPNLDLLN 240
           +P A+LRSWV+AYHT LDLTGGSIEAAIVLD+ G  D F ++EI Y+GLNG +PNLD++N
Sbjct: 180 NPKAALRSWVEAYHTSLDLTGGSIEAAIVLDFAGEGDLFDYMEIYYDGLNGELPNLDMVN 239

Query: 241 VAVHITEHEGMKVALHGTPWEELGTDTYFSRMRLLLKGIKDMALSGIKRTSGNEAFSGWR 300
           + V   EHEGMKV+LHGTP++++  DT FSR+++L+  IK+ ALSG+K+T GNEAFSGWR
Sbjct: 240 IGVFTAEHEGMKVSLHGTPFDKIKEDTLFSRLKILMSSIKNSALSGVKKTYGNEAFSGWR 299

Query: 301 IQSVTLKARGTNGSFDITTFGRVPEAMFRSVNNLLEKFHQSFFFYLLLAPRYFVSIGSYL 360
           IQSVTL+ARG NG FD+T+FGRVPEAMFRS+NNLLEKFHQSFFFYL+LAPR+FVSI SYL
Sbjct: 300 IQSVTLRARGQNGPFDVTSFGRVPEAMFRSINNLLEKFHQSFFFYLMLAPRHFVSISSYL 359

Query: 361 PAAVGLSISFAVMACDSVLNNEFASLPLISIYNIWXXXXXXXXXXXXXITAEVFFYXXXX 420
           P+ V +SI FA+ + +S  NN + +LP  S+Y +              I + +F Y    
Sbjct: 360 PSTVAISIGFALASLNSYFNNPYYTLPFFSLYTLLSILFWFVSLVVTFIVSNIFIYSPFP 419

Query: 421 XXXXXFNVVVSFMPFALVKYKIQKP-FSHRFKAAAYLYFSTVLSSLLVMNFQLAFMVGLL 479
                 N+++   P  L      K   S+R ++ A+L+ S +L+SLL++NF LAF +GLL
Sbjct: 420 TILLAVNIIICLYPAILKGNAFMKDLLSYRLRSTAFLFMSLLLTSLLMVNFPLAFGMGLL 479

Query: 480 AFPMTFVRTTVHAS---VRQKMKXXXXXXXXXPFISICVFVHLFEPELTGFSVFYSLIDA 536
           +FPMT V+T    +    R ++K         PFI+  +F  L + E +G  VF  L+ A
Sbjct: 480 SFPMTQVKTITSDTPTISRTRVKNSVLLLVSNPFIATWLFSLLCDNEFSGLDVFERLVSA 539

Query: 537 WNDLGCWTWYVLCLGWYPAWIMVAYSSIDSVPIAAPAKK 575
             +LGCWTW VLC+GW+  W++VA S++D+V ++  ++ 
Sbjct: 540 SRELGCWTWLVLCVGWWTPWLLVAISALDTVKLSNDSED 578

>TPHA0A01820 Chr1 complement(367804..369549) [1746 bp, 581 aa] {ON}
           Anc_8.261 YLR088W
          Length = 581

 Score =  599 bits (1544), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 289/570 (50%), Positives = 402/570 (70%), Gaps = 6/570 (1%)

Query: 1   MAVLEKLHRKVVDMGLVPKIIFSLAKISYVTTLLSVAWLTLFLPMEGQYRRTYISENALM 60
           MA++E LHR+   +GL+PK+I  L+ +S +  L+S+  L L LP++GQYRRTYISENAL+
Sbjct: 1   MALIEVLHRRATKLGLLPKVIGKLSIVSNILVLISIG-LILCLPLDGQYRRTYISENALL 59

Query: 61  PSQAYSYFRESEWNILRGYRSEIDGMRTLTADERNRIVASWMEEYGAKAAVYNDDRHGET 120
           PSQAYSYFRESEWNILRGYR+ I+ +    A  RN +++SW+ ++G K AVY++   G+T
Sbjct: 60  PSQAYSYFRESEWNILRGYRTAIEALIDKPARVRNEVISSWLTDFGMKHAVYDNAADGDT 119

Query: 121 LYAVLHATRGDGTEAMVLAAPWETVEGQYNTGGVALAVAMGRYFSRWPVWSKNIIIVLSE 180
           LY V ++ RGDGTEA+VLA PW   + + N GG AL +++ RYFSRWP+WSKNII+V+SE
Sbjct: 120 LYGVYNSQRGDGTEAIVLAVPWYNTDNEVNIGGAALGISLSRYFSRWPIWSKNIILVISE 179

Query: 181 DPHASLRSWVQAYHTKLDLTGGSIEAAIVLDYPGTNDYFQHVEISYEGLNGGMPNLDLLN 240
           +PH +++SWV AYH  LDLTGGS+EAAIVLD+P  ++YF+ VE+ + G+NG +PNLD++N
Sbjct: 180 NPHKAMKSWVDAYHNSLDLTGGSLEAAIVLDFPSKSEYFEFVELYFNGINGELPNLDIVN 239

Query: 241 VAVHITEHEGMKVALHGTPWEELGTDTYFSRMRLLLKGIKDMALSGIKRTSGNEAFSGWR 300
           VA+ + EHEG+KV+L G    E+ T +YF+R++ LL G+K+ ALSG ++  GNEAFSG R
Sbjct: 240 VAISVIEHEGVKVSLQGLNLSEMYTSSYFNRLKTLLFGVKNSALSGTRKLYGNEAFSGRR 299

Query: 301 IQSVTLKARGTNGSFDITTFGRVPEAMFRSVNNLLEKFHQSFFFYLLLAPRYFVSIGSYL 360
           IQ++TLKA GT G  DITTFGR+PEA+FRSVNNLLEKFHQSFFFY L+APR+FVSIGSYL
Sbjct: 300 IQALTLKACGTEGH-DITTFGRIPEAIFRSVNNLLEKFHQSFFFYFLVAPRHFVSIGSYL 358

Query: 361 PAAVGLSISFAVMACDSVLNNEFASLPLISIYNIWXXXXXXXXXXXXXITAEVFFYXXXX 420
           P+AV LSISF + A  S +NN++ ++PL    +I              I  ++       
Sbjct: 359 PSAVCLSISFGISAAHSYINNQYITVPLSDNSSILALIIFFGSIAISFIFLQINETFLQP 418

Query: 421 XXXXXFNVVVSFMPFALVKY---KIQKPFSHRFKAAAYLYFSTVLSSLLVMNFQLAFMVG 477
                  +++SF+P   +      IQ   S+R K+ A++Y S VL+SLLVMNF LAF +G
Sbjct: 419 HLMILAFLLISFLPLTNIPQPLITIQPCLSYRLKSFAFIYISLVLTSLLVMNFALAFGMG 478

Query: 478 LLAFPMTFVRTTVHA-SVRQKMKXXXXXXXXXPFISICVFVHLFEPELTGFSVFYSLIDA 536
           LLAFP+TF ++     + + K+          PFI+I +FV +FE ++T F VF  LI +
Sbjct: 479 LLAFPLTFTKSCSEMITFKSKVINCFYLAISNPFIAIFIFVSIFEDDITNFEVFSDLISS 538

Query: 537 WNDLGCWTWYVLCLGWYPAWIMVAYSSIDS 566
           +  +G WTW + C+GW+  W MV  +++D+
Sbjct: 539 FKYMGNWTWAITCIGWFTTWQMVYIANLDT 568

>KAFR0B05550 Chr2 complement(1136432..1138099) [1668 bp, 555 aa]
           {ON} Anc_8.261 YLR088W
          Length = 555

 Score =  583 bits (1503), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 299/561 (53%), Positives = 385/561 (68%), Gaps = 14/561 (2%)

Query: 1   MAVLEKLHRKVVDMGLVPKIIFSLAKISYVTTLLSVAWLTLFLPMEGQYRRTYISENALM 60
           M ++E++ R+V  MGLVPK+   L   S +  L+S+      LP++GQYR TYISENALM
Sbjct: 1   MGLVERVKRQVAVMGLVPKLKKYLPLFSKIIALISLI-SIAILPIDGQYRNTYISENALM 59

Query: 61  PSQAYSYFRESEWNILRGYRSEIDGMRTLTADERNRIVASWMEEYGAKAAVYNDDRHGET 120
           PSQAYSYFRE+EWNILRGYR++++ M  L   ERN I+ +W+ + GAK   +N+     T
Sbjct: 60  PSQAYSYFRETEWNILRGYRTQVENMVDLPLTERNDIMETWLNDIGAKTDTHNNS----T 115

Query: 121 LYAVLHATRGDGTEAMVLAAPWETVEGQYNTGGVALAVAMGRYFSRWPVWSKNIIIVLSE 180
           +Y + H+ RGDGTEA+VLA PW   EGQ+NTGG AL V++ R+F RWP+WSKNII+V SE
Sbjct: 116 IYGIFHSPRGDGTEAIVLAIPWHNSEGQFNTGGAALGVSLARFFWRWPIWSKNIIVVFSE 175

Query: 181 DPHASLRSWVQAYHTKLDLTGGSIEAAIVLDYPGTNDYFQHVEISYEGLNGGMPNLDLLN 240
           D  ASLRSWV+AYHT LDLTGGSIEAA++LDY   +D+F +VEI Y+GLNG +PNLDL+N
Sbjct: 176 DTGASLRSWVEAYHTSLDLTGGSIEAAVILDYASESDFFDYVEIHYDGLNGELPNLDLVN 235

Query: 241 VAVHITEHEGMKVALHGTPWEELGTDTYFSRMRLLLKGIKDMALSGIKRTSGNEAFSGWR 300
           +AV ITEHEGMKV+LHG P EEL   + +SR ++LL+ IKD +L+GIK+  GNEAFSGWR
Sbjct: 236 IAVSITEHEGMKVSLHGLPREELEERSLWSRFKMLLRSIKDSSLAGIKKPHGNEAFSGWR 295

Query: 301 IQSVTLKARGTNGSFDITTFGRVPEAMFRSVNNLLEKFHQSFFFYLLLAPRYFVSIGSYL 360
           IQ++TLKA G  G  DITTFGR+PEAMFRS+NNLLEKFHQSFF+YLLLAPR FVSI SYL
Sbjct: 296 IQALTLKACG-EGGIDITTFGRIPEAMFRSINNLLEKFHQSFFYYLLLAPRNFVSISSYL 354

Query: 361 PAAVGLSISFAVMACDSVLNNEFASLPLISIYNIWXXXXXXXXXXXXXITAEVFFYXXXX 420
           PAAVGLS++FA  +    +N+   S+P IS Y +                A  +      
Sbjct: 355 PAAVGLSLAFACSSLGEFVNDNQDSIPFISSYTLEAIIVWFLSITFSFCFAITYLKYTFP 414

Query: 421 XXXXXFNVVVSFMP-----FALVKYKIQKPFSHRFKAAAYLYFSTVLSSLLVMNFQLAFM 475
                  ++ SF+P       L + KI    +HR KA A+ YFS VL+SLL++NF LA  
Sbjct: 415 VMLMFICILFSFIPLISRGLPLAETKIT--VAHRMKAFAFGYFSLVLTSLLMINFPLALT 472

Query: 476 VGLLAFPMTFVR-TTVHASVRQKMKXXXXXXXXXPFISICVFVHLFEPELTGFSVFYSLI 534
           +G+LAFPMT V+ +    +  Q +K         P+ISIC F ++F+ ELTG +    LI
Sbjct: 473 IGVLAFPMTLVKISNTLPTSSQALKNSMLLLVSNPYISICAFSNIFDSELTGLATLDRLI 532

Query: 535 DAWNDLGCWTWYVLCLGWYPA 555
            AWND+ CWTW+   L  Y A
Sbjct: 533 PAWNDMNCWTWFFSHLAGYHA 553

>CAGL0J02002g Chr10 (200829..201914) [1086 bp, 361 aa] {ON} similar
           to uniprot|P40556 Saccharomyces cerevisiae YIL006w or
           uniprot|P39953 Saccharomyces cerevisiae YEL006w
          Length = 361

 Score = 32.0 bits (71), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 23/70 (32%), Positives = 39/70 (55%), Gaps = 6/70 (8%)

Query: 212 YPGTNDYFQHVEISYEGLN----GGMPNL-DLLNVAVHITEHEGMKVALHGTPWEELGTD 266
           Y GT D F+ + I+ EG+     G +P+L  LL+VA+H   +E +KV+      +E   +
Sbjct: 209 YQGTYDAFKKI-INQEGVKALYAGLVPSLLGLLHVAIHFPVYERLKVSFKCYQRDESSNE 267

Query: 267 TYFSRMRLLL 276
           +  +  RL+L
Sbjct: 268 SKINLKRLIL 277

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.324    0.137    0.424 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 54,524,164
Number of extensions: 2166143
Number of successful extensions: 6163
Number of sequences better than 10.0: 30
Number of HSP's gapped: 6204
Number of HSP's successfully gapped: 34
Length of query: 577
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 462
Effective length of database: 40,294,809
Effective search space: 18616201758
Effective search space used: 18616201758
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 68 (30.8 bits)