Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
AGR086C8.262ON53453427540.0
Ecym_43088.262ON52953516710.0
KLLA0F19140g8.262ON52741710711e-140
SAKL0H17028g8.262ON5505259351e-119
Kwal_56.237998.262ON4884128211e-103
TDEL0F038908.262ON4763518091e-101
KLTH0G13684g8.262ON5084368021e-100
KAFR0B055408.262ON5193687632e-94
ZYRO0C01650g8.262ON5864217195e-87
YDR110W (FOB1)8.262ON5663706783e-81
Smik_4.3568.262ON5763706775e-81
Kpol_543.388.262ON4423726614e-80
NCAS0B038508.262ON5884326681e-79
Suva_2.2708.262ON6323566684e-79
CAGL0B01771g8.262ON5364476606e-79
Skud_4.3718.262ON5803566514e-77
Kpol_392.68.262ON4573976408e-77
NDAI0J013808.262ON6243576327e-74
TPHA0J007408.262ON4083364753e-53
KNAG0H032408.262ON5193144361e-46
TBLA0E044308.262ON4813654303e-46
TPHA0A018108.262ON4573764022e-42
TBLA0F030708.262ON4453893853e-40
NDAI0B06160singletonON140373930.013
NDAI0G00550singletonON41273880.040
NDAI0G00600singletonON48878840.12
Kwal_YGOB_56.239796.200ON577111770.81
SAKL0B11583g2singletonON1755104780.83
SAKL0C11913g1singletonON1755104770.88
Kwal_56.23979singletonOFF430111751.5
NDAI0D03010na 1ON77893741.8
Skud_12.300singletonON39881732.5
Smik_49.2singletonON55098732.9
Kwal_56.228253.156ON96457723.3
CAGL0J08074g1.91ON34764704.6
Kwal_56.22670singletonON676143705.4
Kwal_26.8300singletonON902143697.7
Kwal_23.5250singletonON902143697.8
KNAG0E035307.153ON97966697.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= AGR086C
         (534 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AGR086C Chr7 complement(888758..890362) [1605 bp, 534 aa] {ON} S...  1065   0.0  
Ecym_4308 Chr4 complement(654030..655619) [1590 bp, 529 aa] {ON}...   648   0.0  
KLLA0F19140g Chr6 (1773327..1774910) [1584 bp, 527 aa] {ON} some...   417   e-140
SAKL0H17028g Chr8 complement(1495187..1496839) [1653 bp, 550 aa]...   364   e-119
Kwal_56.23799 s56 complement(708590..710056) [1467 bp, 488 aa] {...   320   e-103
TDEL0F03890 Chr6 (724664..726094) [1431 bp, 476 aa] {ON} Anc_8.2...   316   e-101
KLTH0G13684g Chr7 complement(1171645..1173171) [1527 bp, 508 aa]...   313   e-100
KAFR0B05540 Chr2 complement(1134547..1136106) [1560 bp, 519 aa] ...   298   2e-94
ZYRO0C01650g Chr3 complement(117323..119083) [1761 bp, 586 aa] {...   281   5e-87
YDR110W Chr4 (676102..677802) [1701 bp, 566 aa] {ON}  FOB1Nucleo...   265   3e-81
Smik_4.356 Chr4 (637418..639148) [1731 bp, 576 aa] {ON} YDR110W ...   265   5e-81
Kpol_543.38 s543 (84712..86040) [1329 bp, 442 aa] {ON} (84712..8...   259   4e-80
NCAS0B03850 Chr2 complement(685424..687190) [1767 bp, 588 aa] {O...   261   1e-79
Suva_2.270 Chr2 (470408..472306) [1899 bp, 632 aa] {ON} YDR110W ...   261   4e-79
CAGL0B01771g Chr2 (163063..164673) [1611 bp, 536 aa] {ON} weakly...   258   6e-79
Skud_4.371 Chr4 (647726..649468) [1743 bp, 580 aa] {ON} YDR110W ...   255   4e-77
Kpol_392.6 s392 complement(8453..9826) [1374 bp, 457 aa] {ON} co...   251   8e-77
NDAI0J01380 Chr10 complement(317185..319059) [1875 bp, 624 aa] {...   248   7e-74
TPHA0J00740 Chr10 (175036..176262) [1227 bp, 408 aa] {ON} Anc_8....   187   3e-53
KNAG0H03240 Chr8 complement(603920..605479) [1560 bp, 519 aa] {O...   172   1e-46
TBLA0E04430 Chr5 (1136737..1138182) [1446 bp, 481 aa] {ON} Anc_8...   170   3e-46
TPHA0A01810 Chr1 complement(365982..367355) [1374 bp, 457 aa] {O...   159   2e-42
TBLA0F03070 Chr6 complement(745795..747132) [1338 bp, 445 aa] {O...   152   3e-40
NDAI0B06160 Chr2 (1494425..1498636) [4212 bp, 1403 aa] {ON}            40   0.013
NDAI0G00550 Chr7 complement(116985..118223) [1239 bp, 412 aa] {O...    39   0.040
NDAI0G00600 Chr7 complement(130877..132343) [1467 bp, 488 aa] {O...    37   0.12 
Kwal_YGOB_56.23979 s56 complement(800041..800457,800459..801775)...    34   0.81 
SAKL0B11583g2 Chr2 (998260..999561,999563..1003528) [5268 bp, 17...    35   0.83 
SAKL0C11913g1 Chr3 complement(1069940..1073905,1073907..1075208)...    34   0.88 
Kwal_56.23979 s56 complement(800486..801775) [1290 bp, 430 aa] {...    33   1.5  
NDAI0D03010 Chr4 complement(712188..714524) [2337 bp, 778 aa] {O...    33   1.8  
Skud_12.300 Chr12 complement(546310..547503) [1194 bp, 398 aa] {...    33   2.5  
Smik_49.2 Chr49 (115..1764) [1650 bp, 550 aa] {ON} YNL054W-B (RE...    33   2.9  
Kwal_56.22825 s56 (292515..295409) [2895 bp, 964 aa] {ON} YDL035...    32   3.3  
CAGL0J08074g Chr10 (794667..795710) [1044 bp, 347 aa] {ON} simil...    32   4.6  
Kwal_56.22670 s56 complement(228050..230080) [2031 bp, 676 aa] {...    32   5.4  
Kwal_26.8300 s26 (729038..731746) [2709 bp, 902 aa] {ON} YGR109W...    31   7.7  
Kwal_23.5250 s23 complement(1075954..1078662) [2709 bp, 902 aa] ...    31   7.8  
KNAG0E03530 Chr5 (705077..708016) [2940 bp, 979 aa] {ON} Anc_7.1...    31   7.9  

>AGR086C Chr7 complement(888758..890362) [1605 bp, 534 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR110W
           (FOB1)
          Length = 534

 Score = 1065 bits (2754), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 512/534 (95%), Positives = 512/534 (95%)

Query: 1   MVDIMSSPSKGVNDSQPMFVYQYITDEGFKVPQTDLNLYQLDGSLEHEWIDRGRGELRKI 60
           MVDIMSSPSKGVNDSQPMFVYQYITDEGFKVPQTDLNLYQLDGSLEHEWIDRGRGELRKI
Sbjct: 1   MVDIMSSPSKGVNDSQPMFVYQYITDEGFKVPQTDLNLYQLDGSLEHEWIDRGRGELRKI 60

Query: 61  MKTVKGQLTQEIYDLIASDTLSTQKLLECCDKVTPNTVENKYVLLKRRYVAKGGIVIDRK 120
           MKTVKGQLTQEIYDLIASDTLSTQKLLECCDKVTPNTVENKYVLLKRRYVAKGGIVIDRK
Sbjct: 61  MKTVKGQLTQEIYDLIASDTLSTQKLLECCDKVTPNTVENKYVLLKRRYVAKGGIVIDRK 120

Query: 121 RKDAPVIEPDSLFDMIMSAHLINDHMPWRKVYQHMKGLYANVTRELTNMVTGYCSHCNMD 180
           RKDAPVIEPDSLFDMIMSAHLINDHMPWRKVYQHMKGLYANVTRELTNMVTGYCSHCNMD
Sbjct: 121 RKDAPVIEPDSLFDMIMSAHLINDHMPWRKVYQHMKGLYANVTRELTNMVTGYCSHCNMD 180

Query: 181 RSVRRFSRYKHYNVHEKLMPLERCHVEVFAPFDDEGVEKIQGKYSHFLYCRDYHSRFIWL 240
           RSVRRFSRYKHYNVHEKLMPLERCHVEVFAPFDDEGVEKIQGKYSHFLYCRDYHSRFIWL
Sbjct: 181 RSVRRFSRYKHYNVHEKLMPLERCHVEVFAPFDDEGVEKIQGKYSHFLYCRDYHSRFIWL 240

Query: 241 LPLEGIAFRYLLPALAQLLCTMIRVPIFLETATLDRQDMFDICEVIARRYKFKIGLGLNS 300
           LPLEGIAFRYLLPALAQLLCTMIRVPIFLETATLDRQDMFDICEVIARRYKFKIGLGLNS
Sbjct: 241 LPLEGIAFRYLLPALAQLLCTMIRVPIFLETATLDRQDMFDICEVIARRYKFKIGLGLNS 300

Query: 301 GTEFQKNGIKRVKQLLSEYKEECQDDWNMCLRLVLSRVNQTYADRVRGIPSDLLCNEIPN 360
           GTEFQKNGIKRVKQLLSEYKEECQDDWNMCLRLVLSRVNQTYADRVRGIPSDLLCNEIPN
Sbjct: 301 GTEFQKNGIKRVKQLLSEYKEECQDDWNMCLRLVLSRVNQTYADRVRGIPSDLLCNEIPN 360

Query: 361 ISMXXXXXXXXXXDQLYAHHVVHFKEAGGMIYLEDEESAFVMDDPDDDCTPVPEEPPVAS 420
           ISM          DQLYAHHVVHFKEAGGMIYLEDEESAFVMDDPDDDCTPVPEEPPVAS
Sbjct: 361 ISMKFKQKQKKIIDQLYAHHVVHFKEAGGMIYLEDEESAFVMDDPDDDCTPVPEEPPVAS 420

Query: 421 DSIQNSATILTPITSTQITENEVARQDPDQLEIRPPSQNNESLSDRVSSEEPPVXXXXXX 480
           DSIQNSATILTPITSTQITENEVARQDPDQLEIRPPSQNNESLSDRVSSEEPPV      
Sbjct: 421 DSIQNSATILTPITSTQITENEVARQDPDQLEIRPPSQNNESLSDRVSSEEPPVSKERKK 480

Query: 481 XXXXXXALKTASSPSPNVNEEYYNNSELAGPGSSFFKNISTSQEPRYGDVSLEL 534
                 ALKTASSPSPNVNEEYYNNSELAGPGSSFFKNISTSQEPRYGDVSLEL
Sbjct: 481 RKISKRALKTASSPSPNVNEEYYNNSELAGPGSSFFKNISTSQEPRYGDVSLEL 534

>Ecym_4308 Chr4 complement(654030..655619) [1590 bp, 529 aa] {ON}
           similar to Ashbya gossypii AGR086C
          Length = 529

 Score =  648 bits (1671), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/535 (58%), Positives = 397/535 (74%), Gaps = 33/535 (6%)

Query: 11  GVNDSQPMFVYQYITDEGFKVPQTDLNLYQLDGSLEHEWIDRGRGELRKIMKTVKGQLTQ 70
           G + S+  FV+Q IT+EGFKVP+ DLN+YQL   L+H+W+D GR EL K++ TVKGQLTQ
Sbjct: 17  GSDGSESFFVFQKITEEGFKVPRFDLNVYQLAPELDHDWLDTGRNELIKLINTVKGQLTQ 76

Query: 71  EIYDLIASDTLSTQKLLECCDKVTPNTVENKYVLLKRRYVAKGGIVIDRKRKDAPVIEPD 130
           +IY+LI+S+TLSTQ LLECCDKVT  TVENK+VLLKRRY    G V+D KR+D PVIEPD
Sbjct: 77  DIYELISSNTLSTQTLLECCDKVTAGTVENKFVLLKRRYSILQGNVVDHKREDLPVIEPD 136

Query: 131 SLFDMIMSAHLINDHMPWRKVYQHMKGLYANVTRELTNMVTGYCSHCNMDRSVRRFSRYK 190
            +FD+IM+AHLIN H+PWRK++QH+K LYANVTR+ TN+VT YCSHCN DR+++RF RYK
Sbjct: 137 LVFDVIMAAHLINGHLPWRKIHQHLKNLYANVTRDFTNLVTLYCSHCNTDRNMKRFLRYK 196

Query: 191 HYNVHEKLMPLERCHVEVFAPFDDEGVEKIQGKYSHFLYCRDYHSRFIWLLPLEGIAFRY 250
           HYNV++K+MPLERCHVE+FAPFDD+G EKI+ KYSH LYCRDYHSRF+W+LPLEGI FR 
Sbjct: 197 HYNVYDKVMPLERCHVEIFAPFDDDGNEKIEDKYSHVLYCRDYHSRFVWMLPLEGITFRD 256

Query: 251 LLPALAQLLCTMIRVPIFLETATLDRQDMFDICEVIARRYKFKIGLGLNSGTEFQKNGIK 310
           L+PAL QLLC+MIR+PIFLETATLDRQDMFD+CE IAR+YK KIGLGLNSGT+FQ+NG+ 
Sbjct: 257 LVPALTQLLCSMIRLPIFLETATLDRQDMFDVCEYIARKYKLKIGLGLNSGTDFQRNGVT 316

Query: 311 RVKQLLSEYKEECQDDWNMCLRLVLSRVNQTYADRVRGIPSDLLCNEIPNISMXXXXXXX 370
           R+K L +E+KE+C  +WNMCLRLVL+RVNQ Y+DRVRGIPSDLLCNEI NI+        
Sbjct: 317 RIKNLFAEHKEQCIKEWNMCLRLVLTRVNQNYSDRVRGIPSDLLCNEISNIAHKFKLKQR 376

Query: 371 XXXDQLYAHHVVHFKEAGGMIYLEDEESAFVMDD----PDDDCTPVPEEPPVASDSIQNS 426
              D+LYAHHVV F+EAGGMIYLED+ SAFV+D+    P++D  PV E P  + +S+++S
Sbjct: 377 KIIDELYAHHVVQFREAGGMIYLEDDNSAFVVDEDEHGPENDNVPVTESP--SKESMKSS 434

Query: 427 ATI----LTPITSTQITENEVARQDPDQLEIRPPSQ--NNESLSDRVSSEEPPVXXXXXX 480
             I    L P  ++ I    V   +   +      +  N E ++D+   E          
Sbjct: 435 NNIADNLLEPNNNSSIPSKRVLPSEKSSIRKNGSKKKINKEKVTDKGKME---------- 484

Query: 481 XXXXXXALKTASSP-SPNVNEEYYNNSELAGPGSSFFKNISTSQEPRYGDVSLEL 534
                      SSP S   N+++ + SE+  P S +F+N S SQ  +Y DVS+EL
Sbjct: 485 ----------LSSPLSQAGNQDFQDLSEIPEPSSPYFRNTSISQRSKYADVSIEL 529

>KLLA0F19140g Chr6 (1773327..1774910) [1584 bp, 527 aa] {ON} some
           similarities with uniprot|O13329 Saccharomyces
           cerevisiae YDR110W FOB1 Nucleolar protein required for
           DNA replication fork blocking and recombinational
           hotspot activities binds to the replication fork barrier
           site in the rDNA region related to retroviral integrases
          Length = 527

 Score =  417 bits (1071), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 205/417 (49%), Positives = 271/417 (64%), Gaps = 26/417 (6%)

Query: 26  DEGFKVPQTDLNLYQLDGSLEHEWIDRGRGELRKIMKTVKGQLTQEIYDLIASDTLSTQK 85
           D  F +P    +L    G L+ + +  GR +L K + TVKGQLTQ IYDL+ SD L+ + 
Sbjct: 54  DFKFVLPVKGFDLGSFCGELDQDMLIEGRLQLEKEINTVKGQLTQPIYDLLHSDALTKEN 113

Query: 86  LLECCDKVTPNTVENKYVLLKRRYVAKGGIVIDRKRKDAPVIEPDSLFDMIMSAHLINDH 145
           LL   DKVT +TVENK+VLLKRRY  +  ++ D KRKD  V EP+ LFD+IMS H++N H
Sbjct: 114 LLRASDKVTNSTVENKFVLLKRRYYVQENLLHDVKRKDLVVYEPNELFDLIMSVHVLNSH 173

Query: 146 MPWRKVYQHMKGLYANVTRELTNMVTGYCSHCNMDRSVRRFSRYKHYNVHEKLMPLERCH 205
           +  + +Y  +   YANVT+    +VT +CS CN   +   + ++KH N+H  L+PL RCH
Sbjct: 174 VSSKGIYNELSTFYANVTQSFCKLVTSFCSKCNESGNKISYKKFKHENIHANLIPLGRCH 233

Query: 206 VEVFAPFDD--EGVE-----KIQGKYSHFLYCRDYHSRFIWLLPLEGIAFRYLLPALAQL 258
           VE+FAPFD   +G +     KI+GKY   LYCRDY+SR++WL PL+ +    LLP + +L
Sbjct: 234 VEIFAPFDSAYQGNDNTDELKIEGKYPFVLYCRDYYSRYVWLEPLKSVTLSDLLPVMTKL 293

Query: 259 LCTMIRVPIFLETATLDRQDMFDICEVIARRYKFKIGLGLNSGTEFQKNGIKRVKQLLSE 318
           L +MIR+PIF++T TLDRQDMFD+CE IAR YK KIGLG+NS T FQK GIKR+K L  +
Sbjct: 294 LFSMIRMPIFIDTCTLDRQDMFDVCENIARIYKIKIGLGMNSSTSFQKTGIKRMKSLFLQ 353

Query: 319 YKEECQDDWNMCLRLVLSRVNQTYADRVRGIPSDLLCNEIPNISMXXXXXXXXXXDQLYA 378
           +KEEC  DWNMCL+LV+SR+NQ Y+DRVRG+PSDLLC+   ++             +L  
Sbjct: 354 HKEECLHDWNMCLKLVVSRLNQNYSDRVRGVPSDLLCSTQQDLHKKFRTLQRNVISRLLG 413

Query: 379 HHVVHFKEAGGMIYLEDEESAFVMDDPDD-------------------DCTPVPEEP 416
           HHVV F+EAGGMIYLEDE S  ++   DD                   D TP+ E+P
Sbjct: 414 HHVVQFEEAGGMIYLEDENSPNLLLSGDDNSEESEHDSEIFDELASSRDGTPISEQP 470

>SAKL0H17028g Chr8 complement(1495187..1496839) [1653 bp, 550 aa]
           {ON} similar to uniprot|O13329 Saccharomyces cerevisiae
           YDR110W FOB1 Nucleolar protein required for DNA
           replication fork blocking and recombinational hotspot
           activities binds to the replication fork barrier site in
           the rDNA region related to retroviral integrases
          Length = 550

 Score =  364 bits (935), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 209/525 (39%), Positives = 303/525 (57%), Gaps = 38/525 (7%)

Query: 34  TDLNLYQLDGSLEHEWIDRGRGELRKIMKTVKGQLTQEIYDLIASDTLSTQKLLECCDKV 93
           TDLN+         E ++RG  +  K +++VKGQLTQ  Y+LI +DTL+ + LL   D +
Sbjct: 40  TDLNV---------ELLERGGRDFIKYLESVKGQLTQAQYELIKTDTLTLETLLAVTDGL 90

Query: 94  TPNTVENKYVLLKRRY-VAKGGIVIDRKRKDAPVIEPDSLFDMIMSAHLINDHMPWRKVY 152
            P+  E KY+ LKRRY V    IV D KR D  V EP+ ++++I+S HL+N+H+ WRK++
Sbjct: 91  IPSNAEAKYLFLKRRYYVDSDQIVRDHKRDDTIVCEPELMYELIVSGHLLNNHLHWRKLH 150

Query: 153 QHMKGLYANVTRELTNMVTGYCSHCNMDRSVRRFSRYKHYNVHEKLMPLERCHVEVFAPF 212
           + +K  Y+N+TR+   M   YCS CN    V+ F+++KH N ++ L+PLER HVE+F PF
Sbjct: 151 RFLKSQYSNITRDFVQMCARYCSECNPQEEVKPFTKFKHTNAYQGLLPLERIHVEIFKPF 210

Query: 213 DDEGVEKIQGKYSHFLYCRDYHSRFIWLLPLEGIAFRYLLPALAQLLCTMIRVPIFLETA 272
             +  E I+ KYSH LYCRDYHSRF+WL PL GI F+ L+P L + L ++ R+PIFLET 
Sbjct: 211 GTD--ELIEEKYSHVLYCRDYHSRFVWLSPLTGITFQELVPQLTEFLLSLPRLPIFLETT 268

Query: 273 TLDRQDMFDICEVIARRYKFKIGLGLNSGTEFQKNGIKRVKQLLSEYKEECQDDWNMCLR 332
           TLDRQDMFD+CE IAR+Y+  IGLGLN+ + F KNGI+R+K LL   K++C  DW MCL+
Sbjct: 269 TLDRQDMFDMCEYIARKYQLAIGLGLNNSSHFYKNGIERMKYLLQTNKKKCAKDWGMCLK 328

Query: 333 LVLSRVNQTYADRVRGIPSDLLCNEIPNISMXXXXXXXXXXDQLYAHHVVHFKEAGGMIY 392
                 N  Y  R+ G  +DLLCNE+ +              +L+AH+VV  K+ GGM+Y
Sbjct: 329 YGSYHNNTAYNPRIMGFSNDLLCNEVSSCGKKFKLKREKIIHELFAHNVVTLKDTGGMVY 388

Query: 393 LEDEESAFVMDDPDDDCTPVPEEP-----PVASDSIQNSATILTPITSTQITENEVARQD 447
           +E+E S F+M+  D+D   V ++      P+A+   Q     +  + S  +T  + +  D
Sbjct: 389 VENENSVFIME--DEDLISVNQDSQESGTPMATSGGQGVEQEMDEMPSMGLTPLKGSNGD 446

Query: 448 --PDQLEIRPPSQNNESLSDRVSSEEPPVXXXXXXXXXXXXALKTAS------SPSPNVN 499
                 +  P  +   SLS R SS+                 +K         S S +V 
Sbjct: 447 MLHKTADSTPKVKRTSSLS-RASSKRTGERASLSDTITPTKKVKKVGENRSRLSGSESVE 505

Query: 500 E--------EYYNNSELAGPGSSFFKNISTSQEPRY--GDVSLEL 534
           +        EY  + E+ GP +SFF  ++ S+  R    D+S+EL
Sbjct: 506 QGNSEANRDEYDLSEEIPGPSTSFFATVNHSRTARADENDISIEL 550

>Kwal_56.23799 s56 complement(708590..710056) [1467 bp, 488 aa] {ON}
           YDR110W (FOB1) - DNA replication fork blocking protein
           [contig 173] FULL
          Length = 488

 Score =  320 bits (821), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 165/412 (40%), Positives = 246/412 (59%), Gaps = 13/412 (3%)

Query: 29  FKVPQTDLNLYQLDGSLEHEWIDRGRGELRKIMKTVKGQLTQEIYDLIASDTLSTQKLLE 88
           F++P+    L +    L  E + RGR +  K  ++VKGQLTQE +DL+ S  L+ + L+ 
Sbjct: 19  FRMPKVGETLEKYGNGLNDELLARGRLDFIKYQESVKGQLTQEQFDLVRSSALTAENLMS 78

Query: 89  CCDKVTPNTVENKYVLLKRR-YVAKGGIVIDRKRKDAPVIEPDSLFDMIMSAHLINDHMP 147
             DK+    +E K++LLKRR YV   G V D K  D  V EP+SLFD+IM  HL N H+ 
Sbjct: 79  TSDKLHSGNIETKFLLLKRRFYVDADGTVRDFKCDDTVVCEPESLFDLIMCGHLKNGHIH 138

Query: 148 WRKVYQHMKGLYANVTRELTNMVTGYCSHCNMDRSVRRFSRYKHYNVHEKLMPLERCHVE 207
           WR+++ +++  YAN TR    +   YCS CN +  +R + +++H N++  L+PLER HVE
Sbjct: 139 WRRLHHYLRRKYANTTRAFAQICVRYCSECNPEEVLRPYRKFRHTNIYSGLLPLERVHVE 198

Query: 208 VFAPFDDEGVEKIQGKYSHFLYCRDYHSRFIWLLPLEGIAFRYLLPALAQLLCTMIRVPI 267
           + APF     + I+G YSH LY RDY+SRF+W+ PL       +  A    L ++ RVPI
Sbjct: 199 IIAPFP----KLIEGLYSHVLYLRDYYSRFVWMQPLASERVSEITKAFLTFLLSLPRVPI 254

Query: 268 FLETATLDRQDMFDICEVIARRYKFKIGLGLNSGTEFQKNGIKRVKQLLSEYKEECQDDW 327
           F+ET+TL RQD+F++CE IA +Y   IGLG++  T FQ+NG++R++ LL + +E C   W
Sbjct: 255 FVETSTLKRQDLFEVCENIASQYGLSIGLGMSRSTTFQRNGVERLRYLLQQNEEPCLKSW 314

Query: 328 NMCLRLVLSRVNQTYADRVRGIPSDLLCNEIPNISMXXXXXXXXXXDQLYAHHVVHFKEA 387
           +MCL+  ++  N TY  RV G+P +LL + + +             ++L+A +VV  +  
Sbjct: 315 HMCLKFGVTNHNMTYNARVLGLPGNLLHSTVSDYGRQFELKREELIEKLFASNVVELRNE 374

Query: 388 G---GMIYLEDEESAFVMDDPDDDCTPVPEEPPVASDSIQNSATI-LTPITS 435
           G   GMIYLEDE SAF M  PD++   +  E    ++       + LTP+TS
Sbjct: 375 GRRRGMIYLEDESSAFKM--PDEEY--ISAENETENEGFDYGPMVGLTPLTS 422

>TDEL0F03890 Chr6 (724664..726094) [1431 bp, 476 aa] {ON} Anc_8.262
           YDR110W
          Length = 476

 Score =  316 bits (809), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 152/351 (43%), Positives = 224/351 (63%), Gaps = 5/351 (1%)

Query: 48  EWIDRGRGELRKIMKTVKGQLTQEIYDLIASDTLSTQKLLECCDKVTPNTVENKYVLLKR 107
           E ++RG  +L K  +++ GQ+   IY+LI +++L+ + L    DK   ++ E+KY+ L R
Sbjct: 59  ELLERGEQDLLKYQESINGQVLHPIYELIRTNSLTPETLASNSDKWDKDSAESKYMFLMR 118

Query: 108 RYVAKGGIVIDRKRKDAPVIEPDSLFDMIMSAHLINDHMPWRKVYQHMKGLYANVTRELT 167
           RY A+ GIV DR++ D  V EP  +FD+IM AHL+NDHM +R +Y  +  +Y+N+TR+  
Sbjct: 119 RYYAENGIVRDRRKGDKIVCEPLCIFDLIMCAHLMNDHMTYRPIYTCLNKIYSNITRDFV 178

Query: 168 NMVTGYCSHCNMDRSVRRFSRYKHYNVHEKLMPLERCHVEVFAPFDDEGVEKIQGKYSHF 227
            M   YCS CN D   R   +Y+H N+ + L+PLER H+E+F  FD+E    I  K+++ 
Sbjct: 179 QMAVRYCSSCNPDGHFRPLEKYRHKNIFKGLLPLERVHIEIFEVFDNES---ISNKFTNV 235

Query: 228 LYCRDYHSRFIWLLPLEGIAFRYLLPALAQLLCTMIRVPIFLETATLDRQDMFDICEVIA 287
           LYCRDYH+RF+WL PL+   F++L+ A+  LL  M  VPIF+E++TLD+QD+FDICE + 
Sbjct: 236 LYCRDYHTRFVWLAPLKNTKFKHLVSAVGTLLLGMTYVPIFMESSTLDKQDLFDICEQLC 295

Query: 288 RRYKFKIGLGLNSGTEFQKNGIKRVKQLLSEYKEECQDDWNMCLRLVLSRVNQTYADRVR 347
            +Y  K+GLG NS ++F  NGIKR+K+LL+  K +C  DWNMCLR     +N+ +     
Sbjct: 296 GKYNMKLGLGANSSSQFHINGIKRMKKLLNTRKVDCISDWNMCLRYGPYHLNRRHNTLAG 355

Query: 348 GIPSDLLCNEIPNISMXXXXXXXXXXDQLYAHHVVHFKEAGGMIYLEDEES 398
           GIP+DLL +                 D+L A +VVH  +  G++YLEDE S
Sbjct: 356 GIPNDLLYHSDHTNRKHFRPKQEMIIDELPAQNVVHVNK--GLLYLEDENS 404

>KLTH0G13684g Chr7 complement(1171645..1173171) [1527 bp, 508 aa]
           {ON} weakly similar to uniprot|O13329 Saccharomyces
           cerevisiae YDR110W FOB1 Nucleolar protein required for
           DNA replication fork blocking and recombinational
           hotspot activities binds to the replication fork barrier
           site in the rDNA region related to retroviral integrases
          Length = 508

 Score =  313 bits (802), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 168/436 (38%), Positives = 256/436 (58%), Gaps = 12/436 (2%)

Query: 29  FKVPQTDLNLYQLDGSLEHEWIDRGRGELRKIMKTVKGQLTQEIYDLIASDTLSTQKLLE 88
           F +P     + +    L  E ++RGR +  K  ++VKGQLTQ+ +DL+ S +L+   L+ 
Sbjct: 19  FDMPAVGEPIEKYHNGLNLELLERGRLDFIKYQESVKGQLTQDQFDLVRSCSLTEDNLMT 78

Query: 89  CCDKVTPNTVENKYVLLKRRY-VAKGGIVIDRKRKDAPVIEPDSLFDMIMSAHLINDHMP 147
             DK+    VE K++LLKRRY V   GIV D K  D  V EP+ +FD+IM  HL N H+ 
Sbjct: 79  TSDKLHAGNVETKFLLLKRRYYVDADGIVRDYKCSDTVVCEPELMFDLIMCGHLKNGHLH 138

Query: 148 WRKVYQHMKGLYANVTRELTNMVTGYCSHCNMDRSVRRFSRYKHYNVHEKLMPLERCHVE 207
           WR+++ +++  YAN TR    +   YCS CN +  +R + +++H N++  L+PLER HVE
Sbjct: 139 WRRLHSYLRHNYANTTRAFAQICVKYCSQCNPEEELRPYKKFRHTNIYSGLLPLERVHVE 198

Query: 208 VFAPFDDEGVEKIQGKYSHFLYCRDYHSRFIWLLPLEGIAFRYLLPALAQLLCTMIRVPI 267
           + +PF     E I+G YSH L+ RDY+SRF+W+ PL+G   R +   L   L  + R+PI
Sbjct: 199 IISPFS----EAIEGTYSHVLFFRDYYSRFVWMQPLKGDDVRDITKGLLATLLLLPRIPI 254

Query: 268 FLETATLDRQDMFDICEVIARRYKFKIGLGLNSGTEFQKNGIKRVKQLLSEYKEECQDDW 327
           F+ET+T+DRQD+F+ CE +A +Y   IGLG++  + FQKNG++R++ LL   +E+C   W
Sbjct: 255 FIETSTIDRQDLFEACEDVAGQYSLYIGLGMSQSSTFQKNGVERLRYLLQRNEEQCLRSW 314

Query: 328 NMCLRLVLSRVNQTYADRVRGIPSDLLCNEIPNISMXXXXXXXXXXDQLYAHHVVHFKEA 387
            MCL+   +  N  Y  R+ G+P +LL + + +             ++L+A +VV  K +
Sbjct: 315 YMCLKYGATNHNLNYNARILGVPGNLLHSTVCDYGRQFELKREDLIEKLFARNVVEIKVS 374

Query: 388 G---GMIYLEDEESAFVMDDPDDDCTPVPEEPPVASDSIQ-NSATIL-TPITSTQITENE 442
           G   G+IYLEDE SAF M  PD++      E  +  D +   SAT L TP+TS   T + 
Sbjct: 375 GRRRGIIYLEDETSAFKM--PDEEYISAENETDMNDDDLGFGSATRLTTPLTSPGRTPSR 432

Query: 443 VARQDPDQLEIRPPSQ 458
              + P +   R P++
Sbjct: 433 TPNRTPGRTPGRTPNE 448

>KAFR0B05540 Chr2 complement(1134547..1136106) [1560 bp, 519 aa]
           {ON} Anc_8.262 YDR110W
          Length = 519

 Score =  298 bits (763), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 150/368 (40%), Positives = 222/368 (60%), Gaps = 9/368 (2%)

Query: 42  DGSLEHEWIDRGRGELRKIMKTVKGQLTQEIYDLIASDTLSTQKLLECCDKVTPNTVENK 101
           D  +  E + RG  E+ K  +++ G LT+E YDLI +D+L+ + L     K T  T E +
Sbjct: 61  DSFMNLELLKRGEREVFKFQQSINGHLTEETYDLIRTDSLTPETLASTNPKWTKITAEPR 120

Query: 102 YVLLKRRYVA-KGGIVIDRKRKDAPVIEPDSLFDMIMSAHLINDHMPWRKVYQHMKGLYA 160
           Y+ LKRRY     G++ D  RKD  V EP  +FDMIM  HL+N+H   +K++  +   Y+
Sbjct: 121 YLFLKRRYYRDNNGLIHDHLRKDKIVCEPVYVFDMIMGCHLMNNHGFVKKIHHSLSTFYS 180

Query: 161 NVTRELTNMVTGYCSHCNMDRSVRRFSRYKHYNVHEKLMPLERCHVEVFAPFDDEGVEKI 220
           N+TR+L      +CS CN ++ + +  ++KH N++ +LMPLER H+E+F PF +E +EK 
Sbjct: 181 NITRDLCLKALKFCSVCNPEQKIGKLEKFKHRNIYNELMPLERVHIEIFEPFPNEKIEK- 239

Query: 221 QGKYSHFLYCRDYHSRFIWLLPLEGIAFRYLLPALAQLLCTMIRVPIFLETATLDRQDMF 280
             KYSH LYCRDYHSR+IW+LPL+   F++L+P +A L  + IR PIF+ETA+LD QDMF
Sbjct: 240 --KYSHILYCRDYHSRYIWMLPLKNTKFKHLVPTMASLFLSFIRQPIFIETASLDWQDMF 297

Query: 281 DICEVIARRYKFKIGLGLNSGTEFQKNGIKRVKQLLSEYKEECQDDWNMCLRLVLSRVNQ 340
           DICE IA  Y  +IGLG +    F   GI+++K  L  ++EEC   WN+CL+      N 
Sbjct: 298 DICEKIAFEYDLQIGLGTSKPNTFHAAGIRQMKAKLEAHREECLLSWNLCLKYGSYDHNI 357

Query: 341 TYADRVRGIPSDLLCNEIPNISMXXXXXXXXXXDQLYAHHVVHFKEAGGMIYLEDEESAF 400
            + DR  G+P DLL ++I   S+          +   +  V+  +   G+I+LE +E   
Sbjct: 358 RHNDRAGGVPGDLLSSQIQECSLKFKEKIIQILENAVSESVL--RVDNGLIFLEVDEPH- 414

Query: 401 VMDDPDDD 408
             D+P D+
Sbjct: 415 --DEPHDE 420

>ZYRO0C01650g Chr3 complement(117323..119083) [1761 bp, 586 aa] {ON}
           some similarities with uniprot|O13329 Saccharomyces
           cerevisiae YDR110W FOB1 Nucleolar protein required for
           DNA replication fork blocking and recombinational
           hotspot activities binds to the replication fork barrier
           site in the rDNA region related to retroviral integrases
          Length = 586

 Score =  281 bits (719), Expect = 5e-87,   Method: Compositional matrix adjust.
 Identities = 160/421 (38%), Positives = 237/421 (56%), Gaps = 23/421 (5%)

Query: 50  IDRGRGELRKIMKTVKGQLTQEIYDLIASDTLSTQKLLECCDKVTPNTVENKYVLLKRRY 109
           +++G  E  +   TV GQLTQ+IY+LI SDTLS   L E C K    + E +Y  L+ RY
Sbjct: 60  LEQGAEESLQFQGTVAGQLTQQIYELIRSDTLSIANL-ERCHKWKGESSEIEYYYLRSRY 118

Query: 110 VA--KGGIVIDRKRKDAPVIEPDSLFDMIMSAHLINDHMPWRKVYQHMKGLYANVTRELT 167
               + G+V DRKR D  V EP S+F ++M +HL N+H+    +++++   YAN+TR+  
Sbjct: 119 FVSEENGMVCDRKRDDRIVCEPASMFHLVMCSHLQNNHVTSYNIHRNLVKTYANITRDYI 178

Query: 168 NMVTGYCSHCNMDRSVRRFSRYKHYNVHEKLMPLERCHVEVFAPFDDEGVEKIQGKYSHF 227
                YCS CN D   + F + +H NV+ +L+PLER H+EVF PFD E   KIQG++SH 
Sbjct: 179 VTAISYCSKCNPDLKAKPFQKKRHKNVYWELLPLERVHIEVFEPFDGE---KIQGRFSHL 235

Query: 228 LYCRDYHSRFIWLLPLEGIAFRYLLPALAQLLCTMIRVPIFLETATLDRQDMFDICEVIA 287
           LY RDY SR++W+LPL+    ++++ A++  L  + R+PIFLE+ T+DR+ +FD+C  IA
Sbjct: 236 LYFRDYFSRYVWILPLQNDKRKHMIRAMSSFLLGLPRIPIFLESTTIDREHLFDLCGQIA 295

Query: 288 RRYKFKIGLGLNSGTEFQKNGIKRVKQLLSEYKEECQDDWNMCLRLVLSRVNQTYADRVR 347
             Y  K+GLG+ +   F  NGIK +K+LL  +KEEC  DWN+CL+     +NQ       
Sbjct: 296 EHYSLKLGLGVKNSQRFHNNGIKDMKELLGSHKEECLQDWNLCLKYGPFHINQNINVSSD 355

Query: 348 GIPSDLLCNEIPNISMXXXXXXXXXXDQLYAHHVVHFKEAGGMIYLED--EESAFVMDDP 405
           G P DLL   +P+ +               +  VVH  E  G+++LE+  EE   V    
Sbjct: 356 GRPGDLLFTSVPDCNRKFVKKRNDVILDTPSQQVVHLGE--GVLFLENNKEEHKTVEAVK 413

Query: 406 DDDCTPVPEEPPVASDSIQNSATILTPITSTQITENEVARQDPDQLEIRPPSQNNESLSD 465
           ++     P+E    +D+        T  T  +I E +V+   P + E  P  Q +E   D
Sbjct: 414 ENITHSDPDEERAENDN--------TNDTQVRIDEGDVS---PSKTE--PVEQRDEDGED 460

Query: 466 R 466
           R
Sbjct: 461 R 461

>YDR110W Chr4 (676102..677802) [1701 bp, 566 aa] {ON}  FOB1Nucleolar
           protein that binds the rDNA replication fork barrier
           (RFB) site; required for replication fork blocking,
           recombinational hotspot activity, condensin recruitment
           to RFB and rDNA repeat segregation; related to
           retroviral integrases
          Length = 566

 Score =  265 bits (678), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 132/370 (35%), Positives = 212/370 (57%), Gaps = 4/370 (1%)

Query: 41  LDGSLEHEWIDRGRGELRKIMKTVKGQLTQEIYDLIASDTLSTQKLLECCDKVTPNTVEN 100
           +D  L  E ++RG  E    ++++  QLTQ+IY+LI + +L+   L +  DK      EN
Sbjct: 59  VDSYLNLELLERGERETPIFLESLTRQLTQKIYELIKTKSLTADTLQQISDKYDGVVAEN 118

Query: 101 KYVLLKRRY-VAKGGIVIDRKRKDAPVIEPDSLFDMIMSAHLINDHMPWRKVYQHMKGLY 159
           K + L+R+Y V   G V D +  D    EP  ++DM+M+ HL+N H+  + ++  +   +
Sbjct: 119 KLLFLQRQYYVDDEGNVRDGRNNDKIYCEPKHVYDMVMATHLMNKHLRGKTLHSFLFSHF 178

Query: 160 ANVTRELTNMVTGYCSHCNMDRSVRRFSRYKHYNVHEKLMPLERCHVEVFAPFDDEGVEK 219
           AN++  + + V  +CS CN    ++    YK  ++++KL+P+ER H+EVF PF+ E +E 
Sbjct: 179 ANISHAIIDWVQQFCSKCNKKGKIKPLKEYKRPDMYDKLLPMERIHIEVFEPFNGEAIE- 237

Query: 220 IQGKYSHFLYCRDYHSRFIWLLPLEGIAFRYLLPALAQLLCTMIRVPIFLETATLDRQDM 279
             GKYS+ L CRDY S F+WLLPL+   F++L+P ++ L  T  RVPIF+ ++TLD+ D+
Sbjct: 238 --GKYSYVLLCRDYRSSFMWLLPLKSTKFKHLIPVVSSLFLTFARVPIFVTSSTLDKDDL 295

Query: 280 FDICEVIARRYKFKIGLGLNSGTEFQKNGIKRVKQLLSEYKEECQDDWNMCLRLVLSRVN 339
           +DICE IA +Y  +IGLGL S   F   GI  ++  L+ YK+EC  DW  CLR    R N
Sbjct: 296 YDICEEIASKYGLRIGLGLKSSARFHTGGILCIQYALNSYKKECLADWGKCLRYGPYRFN 355

Query: 340 QTYADRVRGIPSDLLCNEIPNISMXXXXXXXXXXDQLYAHHVVHFKEAGGMIYLEDEESA 399
           +    R +  P  +L +E+P  +           +  Y+ ++       G+IYLED  + 
Sbjct: 356 RRRNKRTKRKPVQVLLSEVPGHNAKFETKRERVIENTYSRNMFKMAGGKGLIYLEDVNTF 415

Query: 400 FVMDDPDDDC 409
            + ++ D+ C
Sbjct: 416 ALANEADNSC 425

>Smik_4.356 Chr4 (637418..639148) [1731 bp, 576 aa] {ON} YDR110W
           (REAL)
          Length = 576

 Score =  265 bits (677), Expect = 5e-81,   Method: Compositional matrix adjust.
 Identities = 137/370 (37%), Positives = 214/370 (57%), Gaps = 8/370 (2%)

Query: 41  LDGSLEHEWIDRGRGELRKIMKTVKGQLTQEIYDLIASDTLSTQKLLECCDKVTPNTVEN 100
           +D  L  E ++RG  E    ++++  QLTQ+IY+LI + +L+   L +  DK      EN
Sbjct: 61  VDSYLNLELLERGERETPIFLESLTRQLTQKIYELIKTKSLTADTLQQISDKYDGVVAEN 120

Query: 101 KYVLLKRRY-VAKGGIVIDRKRKDAPVIEPDSLFDMIMSAHLINDHMPWRKVYQHMKGLY 159
           K + L+R+Y V   G V D +  D    EP+ ++DM+M+ HLIN H+  + ++  +   +
Sbjct: 121 KLLFLQRQYYVDDEGNVRDGRNNDKIYCEPNHIYDMVMATHLINKHLRGKTLHSFLFSYF 180

Query: 160 ANVTRELTNMVTGYCSHCNMDRSVRRFSRYKHYNVHEKLMPLERCHVEVFAPFDDEGVEK 219
           AN++  + + V  +CS CN    ++    YK  ++++KL+P+ER H+EVF PF  E +E 
Sbjct: 181 ANISHAIIDWVQQFCSKCNKKGKIKPLKEYKRPDMYDKLLPMERIHIEVFEPFSGETIE- 239

Query: 220 IQGKYSHFLYCRDYHSRFIWLLPLEGIAFRYLLPALAQLLCTMIRVPIFLETATLDRQDM 279
             GKYS+ L CRDY S F+WLLPL+   F++L+P ++ L  +  RVPIF+ ++TLD+ D+
Sbjct: 240 --GKYSYVLLCRDYRSSFMWLLPLKSTKFKHLIPVISSLFLSFARVPIFVTSSTLDKDDL 297

Query: 280 FDICEVIARRYKFKIGLGLNSGTEFQKNGIKRVKQLLSEYKEECQDDWNMCLRLVLSRVN 339
           +DICE IA +Y  +IGLGL S   F   GI  +   L+ YKEEC  DW  CLR    R N
Sbjct: 298 YDICEEIASKYGLRIGLGLKSSARFHTGGILCIHYALNSYKEECLADWGKCLRYGPYRFN 357

Query: 340 QTYADRVRGIPSDLLCNEIPNISMXXXXXXXXXXDQLYAHHVVHFKEAG--GMIYLEDEE 397
           +    R +  P+ +L +EIP  +           +  Y+ ++  FK AG  G+IYLED  
Sbjct: 358 RRRNKRTKRKPAQVLLSEIPGHNAKFETKRERVIENTYSRNM--FKTAGGKGLIYLEDVN 415

Query: 398 SAFVMDDPDD 407
           +  + +  D+
Sbjct: 416 TFALANKADN 425

>Kpol_543.38 s543 (84712..86040) [1329 bp, 442 aa] {ON}
           (84712..86040) [1329 nt, 443 aa]
          Length = 442

 Score =  259 bits (661), Expect = 4e-80,   Method: Compositional matrix adjust.
 Identities = 129/372 (34%), Positives = 215/372 (57%), Gaps = 10/372 (2%)

Query: 29  FKVPQTDLNLYQ-LDGSLEHEWIDRGRGELRKIMKTVKGQLTQEIYDLIASDTLSTQKLL 87
           F  P+    LY+ +D S    +++ GRG  ++ + ++ G L+Q +Y+LI  D L    L 
Sbjct: 43  FDYPKVGATLYEYIDSSYSVPFLEFGRGAAKEYLDSIIGTLSQTVYELIRDDLLDVDTLS 102

Query: 88  ECC--DKVTPNTVENKYVLLKRRY-VAKGGIVIDRKRKDAPVIEPDSLFDMIMSAHLIND 144
           E     ++  N    K + LKRRY + K G VID  R++  V EPD  +D I+S H++N 
Sbjct: 103 EKTRWSRINANA---KCLYLKRRYKLTKKGTVIDLTRENKIVYEPDLRYDYIISTHILNR 159

Query: 145 HMPWRKVYQHMKGLYANVTRELTNMVTGYCSHCNMDRSVRRFSRYKHYNVHEKLMPLERC 204
           H+ ++ +++ +K +Y+N++R+   MV  +CSHCN D+ +    +  H N++EK +PLER 
Sbjct: 160 HLGYQGIHKRLKAIYSNLSRDYIKMVLDFCSHCNPDKVIPNLEKTVHMNIYEKYLPLERV 219

Query: 205 HVEVFAPFDDEGVEKIQGKYSHFLYCRDYHSRFIWLLPLEGIAFRYLLPALAQLLCTMIR 264
            +++F PF++E   KIQ +YSH +Y RDY SRF+W+ PL+   F+ L   +  LL  + R
Sbjct: 220 QLDIFEPFENE---KIQNRYSHIIYIRDYRSRFVWIYPLKNTKFKTLASEIGMLLLDLPR 276

Query: 265 VPIFLETATLDRQDMFDICEVIARRYKFKIGLGLNSGTEFQKNGIKRVKQLLSEYKEECQ 324
           +PI+++T T++R+DM  IC+ IA +Y+  +G+G    + F   G+ R+K LL+E K++C 
Sbjct: 277 IPIYIDTTTIERRDMLAICKRIAEKYEISLGIGTIEPSSFYSIGLSRLKCLLNENKDKCL 336

Query: 325 DDWNMCLRLVLSRVNQTYADRVRGIPSDLLCNEIPNISMXXXXXXXXXXDQLYAHHVVHF 384
            DWNMCL+L     N+      RG+PS+L  +E+   +           + L   +    
Sbjct: 337 KDWNMCLKLGSYYYNKKSITTARGVPSELFLDEMECSATTFESKRTEIINSLPIQNSYKT 396

Query: 385 KEAGGMIYLEDE 396
               G++Y +DE
Sbjct: 397 STNKGLVYAQDE 408

>NCAS0B03850 Chr2 complement(685424..687190) [1767 bp, 588 aa] {ON}
           Anc_8.262 YDR110W
          Length = 588

 Score =  261 bits (668), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 146/432 (33%), Positives = 232/432 (53%), Gaps = 17/432 (3%)

Query: 41  LDGSLEHEWIDRGRGELRKIMKTVKGQLTQEIYDLIASDTLSTQKLLECCDKVTPNTVEN 100
           +D  ++  ++ RG  E  +  KT+ GQL +  Y+LI +++L+ + L     K+      +
Sbjct: 95  VDEDMDLAFVQRGEREFFEFQKTINGQLNESTYELIKTNSLTQETLSATALKMDKFRAAS 154

Query: 101 KYVLLKRRY-VAKGGIVIDRKRKDAPVIEPDSLFDMIMSAHLINDHMPWRKVYQHMKGLY 159
           + V L RRY + + G V D+ R++  V EP  ++DMIM+ HLINDH   RK +Q +  +Y
Sbjct: 155 RLVFLNRRYGLDEQGNVRDKLRQNRMVCEPVFIYDMIMTWHLINDHGRPRKCHQLLGPMY 214

Query: 160 ANVTRELTNMVTGYCSHCNMDRSVRRFSRYKHYNVHEKLMPLERCHVEVFAPFDDEGVEK 219
           +N+TR     +  +CS CN  +    F +YKH N  + L+PLER  VEVF PF  E   K
Sbjct: 215 SNITRFFVERICQFCSVCNPSKETIPFKKYKHINWFKGLLPLERVQVEVFEPFPGE---K 271

Query: 220 IQGKYSHFLYCRDYHSRFIWLLPLEGIAFRYLLPALAQLLCTMIRVPIFLETATLDRQDM 279
           + GKY   LY RDY SRFIW++PL    F +L+  +++++ +MIR+PIF ET T++ QD 
Sbjct: 272 LGGKYPQILYFRDYRSRFIWMVPLRNSKFGHLVDLISKMIFSMIRIPIFFETTTIENQDF 331

Query: 280 FDICEVIARRYKFKIGLGLNSGTEFQKNGIKRVKQLLSEYKEECQDDWNMCLRLVLSRVN 339
           FDI E I  +Y+  IGLG   G +   NG+ ++++LL  +KEEC  DW MCL+      N
Sbjct: 332 FDIFEKIVEKYQINIGLGTKLGGKRLTNGLPQIRKLLGPHKEECLADWIMCLKYGPHTFN 391

Query: 340 QTYADRVRGIPSDLLCNEIPNISMXXXXXXXXXXDQLYAHHVVHFKEAGGMIYLEDEESA 399
               DR  G+P DLL  +IP++              L   ++V  K   G IYLED    
Sbjct: 392 NKMNDRACGVPGDLLTGDIPDLYTKSYDKIEQILQDLPTENIV--KIGRGCIYLEDRNP- 448

Query: 400 FVMDDPDDDCTPVPEEPPVASDSIQNS-------ATILTPITSTQITENEVARQDPDQLE 452
              +DP+ +     ++     D++++          +++P+     TE+E+   +    +
Sbjct: 449 ---EDPEAEYEANTDDESDTEDNVEHRQEDEEDIGAMMSPMIDNTRTEDELENGEKSHED 505

Query: 453 IRPPSQNNESLS 464
               + N E ++
Sbjct: 506 DNHSNDNEEGVT 517

>Suva_2.270 Chr2 (470408..472306) [1899 bp, 632 aa] {ON} YDR110W
           (REAL)
          Length = 632

 Score =  261 bits (668), Expect = 4e-79,   Method: Compositional matrix adjust.
 Identities = 129/356 (36%), Positives = 206/356 (57%), Gaps = 4/356 (1%)

Query: 41  LDGSLEHEWIDRGRGELRKIMKTVKGQLTQEIYDLIASDTLSTQKLLECCDKVTPNTVEN 100
           +D  L  E ++RG  E    ++++  QLTQ+IY+LI + +L+ + L +  DK      EN
Sbjct: 112 VDSYLNLELLERGERETPIFLESLTRQLTQKIYELIKTKSLTAETLQQISDKYDGVAAEN 171

Query: 101 KYVLLKRRY-VAKGGIVIDRKRKDAPVIEPDSLFDMIMSAHLINDHMPWRKVYQHMKGLY 159
           K + L+R+Y V   G V DR+  D    EP  ++DM+M+ HL+N H+  + ++  +   +
Sbjct: 172 KLLFLERQYYVDNEGNVRDRRNNDKIYCEPKHIYDMVMATHLMNKHLRGKTLHSFLFSHF 231

Query: 160 ANVTRELTNMVTGYCSHCNMDRSVRRFSRYKHYNVHEKLMPLERCHVEVFAPFDDEGVEK 219
           AN +  + + V  +CS CN    ++    YK  ++++KL+P+ER H+EVF P+   G + 
Sbjct: 232 ANTSHAIIDWVQQFCSKCNKKGKIKPLKEYKRPDMYDKLLPMERIHIEVFEPY---GGKA 288

Query: 220 IQGKYSHFLYCRDYHSRFIWLLPLEGIAFRYLLPALAQLLCTMIRVPIFLETATLDRQDM 279
           I+GKY + L CRDY S F+WLLPL+   F++L+P ++ L  +  R+PIF+ ++TLD+ D+
Sbjct: 289 IEGKYPYVLLCRDYRSSFMWLLPLKSTKFKHLIPVVSSLFLSFARIPIFVTSSTLDKDDL 348

Query: 280 FDICEVIARRYKFKIGLGLNSGTEFQKNGIKRVKQLLSEYKEECQDDWNMCLRLVLSRVN 339
           +DICE IA +Y  +IGLGL S   F   GI  ++  L+ YKEEC  DW  CLR    R N
Sbjct: 349 YDICEEIASKYGLRIGLGLKSSARFHTGGILCIQYALNSYKEECLADWGKCLRYGPYRFN 408

Query: 340 QTYADRVRGIPSDLLCNEIPNISMXXXXXXXXXXDQLYAHHVVHFKEAGGMIYLED 395
           +    R +  P+ +L +E+P  +           +  YA ++       G+IYLED
Sbjct: 409 RRRNKRTKRKPTQVLLSEVPGHNAKFETKRERVIENTYARNMFTMAGGKGLIYLED 464

>CAGL0B01771g Chr2 (163063..164673) [1611 bp, 536 aa] {ON} weakly
           similar to uniprot|O13329 Saccharomyces cerevisiae
           YDR110w FOB1 DNA replication fork blocking protein
          Length = 536

 Score =  258 bits (660), Expect = 6e-79,   Method: Compositional matrix adjust.
 Identities = 145/447 (32%), Positives = 243/447 (54%), Gaps = 40/447 (8%)

Query: 42  DGSLEHEWIDRGRGELRKIMKTVKGQLTQEIYDLIASDTLSTQKLLECCDKVTPNTVENK 101
           D +++ +++ RG  ++R+  + + G+LTQE Y L+ ++ L+ + +++  +   PN  E K
Sbjct: 77  DSTIDVDFLKRGEKDMRRFAEGLAGKLTQETYTLLMNNNLTMETVMKAMNIWPPNAAETK 136

Query: 102 YV-LLKRRYVAKGGIVIDRKRKDAPVIEPDSLFDMIMSAHLINDHMPWRKVYQHMKGLYA 160
           Y  L+KR Y  K G + D K  +  V+EPD LF++I++AHL N H+    ++Q ++ +YA
Sbjct: 137 YSNLIKRFYKDKEGNIRDAKVDNNIVLEPDKLFNLILTAHLKNGHLKTAVLFQCLREVYA 196

Query: 161 NVTRELTNMVTGYCSHCNMDRSVRRFSRYKHYNVHEKLMPLERCHVEVFAPFDDEGVE-- 218
           N TR+       YC+ CN DR ++   + +H N++E+L+PLER H+EVFAPF+ E  +  
Sbjct: 197 NCTRDFVQTALFYCNRCNPDRYIKPIEKVRHRNINEELLPLERVHIEVFAPFEKEEGDIK 256

Query: 219 ---------KIQGKYSHFLYCRDYHSRFIWLLPLEGIAFRYLLPALAQLLCTMI-RVPIF 268
                    KI+GKYSH  YCRD+ +R++W  PL+ + F+ L+  +A    T++   PIF
Sbjct: 257 QEDSQNPYIKIEGKYSHVFYCRDFRTRYVWCFPLKNMKFKTLVDNIATFFMTVLYDPPIF 316

Query: 269 LETATLDRQDMFDICEVIARRYKFKIGLGLNSGTEFQKNGIKRVKQLLSEYKEECQDDWN 328
           +E++T+DR D+ +I E++A +Y  K+GLG  + T+F   GIKR K  L   K EC DDW 
Sbjct: 317 VESSTIDRDDLKEIFELLASKYGLKLGLGFANFTKFHAQGIKRFKTHLHRAKSECADDWL 376

Query: 329 MCLRLVLSRVNQTYADRVRGIPSDLLCNEI-PNISMXXXXXXXXXXDQLYAHHVVHFKEA 387
           MCL+      N+   +R  G  S++L  E+                +Q ++ ++  + ++
Sbjct: 377 MCLKQGTYSANRV-IERQLGKASNILFTELMGQFERDMRKKKLKYIEQSFSENIKTYPKS 435

Query: 388 GGMIYLE---DEESAFVMDD--------------PDDDCTPVPEEPPVASDSIQNSATIL 430
           GG I++E   D E      D              P +D TP   EP   + +I N +T  
Sbjct: 436 GGCIFIEHVQDYEKTMESIDRTGTYKSGRKADQLPAED-TPTSHEPVANTTAINNRSTKA 494

Query: 431 TPIT-------STQITENEVARQDPDQ 450
             +        + +ITE  ++  D D+
Sbjct: 495 NKLNGPNLRKRTKEITEIPMSDSDDDE 521

>Skud_4.371 Chr4 (647726..649468) [1743 bp, 580 aa] {ON} YDR110W
           (REAL)
          Length = 580

 Score =  255 bits (651), Expect = 4e-77,   Method: Compositional matrix adjust.
 Identities = 128/356 (35%), Positives = 201/356 (56%), Gaps = 4/356 (1%)

Query: 41  LDGSLEHEWIDRGRGELRKIMKTVKGQLTQEIYDLIASDTLSTQKLLECCDKVTPNTVEN 100
           +D  L  E ++RG  E    ++++  QLTQ+IY+LI + +L+   L +  DK      EN
Sbjct: 62  VDSYLNLELLERGERETPIFLESLTRQLTQQIYELIKTKSLTADTLQQISDKYDGVVAEN 121

Query: 101 KYVLLKRRY-VAKGGIVIDRKRKDAPVIEPDSLFDMIMSAHLINDHMPWRKVYQHMKGLY 159
           K + L+R+Y V   G V D +  D    EP  ++DM+M+ HL+N H+  + ++  +   +
Sbjct: 122 KLLFLQRQYYVDNEGNVRDGRNNDKIYCEPKHIYDMVMATHLMNKHLRGKTLHSFLFSHF 181

Query: 160 ANVTRELTNMVTGYCSHCNMDRSVRRFSRYKHYNVHEKLMPLERCHVEVFAPFDDEGVEK 219
           AN +  + + V  +CS CN    ++    YK  ++++KL+P+ER H+EVF PF    +E 
Sbjct: 182 ANTSHAIIDWVQQFCSKCNKKGKIKPLKEYKRPDMYDKLLPMERIHIEVFEPFTGGAIE- 240

Query: 220 IQGKYSHFLYCRDYHSRFIWLLPLEGIAFRYLLPALAQLLCTMIRVPIFLETATLDRQDM 279
             GKY + L CRDY S F+WLLPL+   F++L+P ++ L  +  RVPIF+ ++TLD+ D+
Sbjct: 241 --GKYPYVLLCRDYRSSFMWLLPLKSTKFKHLIPVISSLFLSFARVPIFVTSSTLDKDDL 298

Query: 280 FDICEVIARRYKFKIGLGLNSGTEFQKNGIKRVKQLLSEYKEECQDDWNMCLRLVLSRVN 339
           +DICE IA +Y   IGLGL S   F   GI  ++  L+ YKEEC  DW  CLR    R N
Sbjct: 299 YDICEEIASKYGLCIGLGLKSSARFHTGGILCIQYALNSYKEECLADWGKCLRYGPYRFN 358

Query: 340 QTYADRVRGIPSDLLCNEIPNISMXXXXXXXXXXDQLYAHHVVHFKEAGGMIYLED 395
           +    R +  P+ +L +E+P  +           +  Y+ ++       G+IYLED
Sbjct: 359 RRRNKRTKRKPAQVLLSEVPGHNAKFETKRERVIENTYSRNMFKMAGGKGLIYLED 414

>Kpol_392.6 s392 complement(8453..9826) [1374 bp, 457 aa] {ON}
           complement(8453..9826) [1374 nt, 458 aa]
          Length = 457

 Score =  251 bits (640), Expect = 8e-77,   Method: Compositional matrix adjust.
 Identities = 137/397 (34%), Positives = 217/397 (54%), Gaps = 21/397 (5%)

Query: 42  DGSLEHEWIDRGRGELRKIMKTVKGQLTQEIYDLIASDTLSTQKLLECCDKVT-PNTVEN 100
           +  L  E  +RG  +L K   T+ G L+Q IYDLI +D L+ +K+    +KV   N    
Sbjct: 74  ESGLNKELFNRGHQDLAKFQSTINGYLSQRIYDLILTDKLTPKKVSR--EKVKWANKSNE 131

Query: 101 KYVLLKRRYVA--KGGIVIDRKRKDAPVIEPDSLFDMIMSAHLINDHMPWRKVYQHMKGL 158
           KY  LK RY    KG  V DR+  D  +  P+ + ++++  HLIN+H   + V++++   
Sbjct: 132 KYYFLKNRYYVSDKGTTVRDRRNDDKILCPPNKVLEVVLCTHLINEHAAHKSVHRNLHKR 191

Query: 159 YANVTRELTNMVTGYCSHCNMDRSVRRFSRYKHYNVHEKLMPLERCHVEVFAPFDDEGVE 218
           YAN++R +T +   YCS CN    V+   + K   V+E L+P ER H+E+F PF DE + 
Sbjct: 192 YANISRTITRISLLYCSFCNPSEHVKPLKKSKKNEVYEGLLPFERIHIEIFKPFGDEKL- 250

Query: 219 KIQGKYSHFLYCRDYHSRFIWLLPLEGIAFRYLLPALAQLLCTMIRVPIFLETATLDRQD 278
            I+G YSH LY RDY+SR++WL PL+  AF+ L   L     T+ + PI++E++T++R D
Sbjct: 251 -IEGTYSHILYIRDYYSRYVWLYPLKKTAFKELTQTLVTYFFTITKTPIYIESSTINRND 309

Query: 279 MFDICEVIARRYKFKIGLGLNSGTEFQKNGIKRVKQLLSEYKEECQDDWNMCLRLVLSRV 338
           +  + + IA +Y  +IG+G+ + + F  NG++ +KQLL  +++EC  DW MCL+   +  
Sbjct: 310 LIAMVQKIALKYDLRIGIGIGNSSYFHYNGLETMKQLLLLHEDECLGDWGMCLKYGKNLH 369

Query: 339 NQTYADRVRGIPSDLLCNE-IPNISMXXXXXXXXXXDQLYAHHVVHFKEAGGMIYLEDEE 397
           N     +V G+P +LL N  I   S+          D+ + H+++        IYLED  
Sbjct: 370 NNLKNRKVLGMPINLLLNSGISECSIKYKSKKNTVIDETFPHNMIVLDNGKSEIYLEDNL 429

Query: 398 SAFVMDDPDDDCTPVPEEP---PVASDSIQNSATILT 431
           ++          TPV +E    PV  +  +N    LT
Sbjct: 430 TS----------TPVIDEKNIEPVGYEYYENPINTLT 456

>NDAI0J01380 Chr10 complement(317185..319059) [1875 bp, 624 aa] {ON}
           Anc_8.262 YDR110W
          Length = 624

 Score =  248 bits (632), Expect = 7e-74,   Method: Compositional matrix adjust.
 Identities = 126/357 (35%), Positives = 205/357 (57%), Gaps = 9/357 (2%)

Query: 41  LDGSLEHEWIDRGRGELRKIMKTVKGQLTQEIYDLIASDTLSTQKLLECCDKVTPNTVEN 100
           +D  ++ + + RG        +++ GQL + +Y+LI + +L+ + L          T   
Sbjct: 104 VDPEVDVDLLKRGEVTFLNFQRSIHGQLDEVVYELIRTKSLTEETLAANFPHFHAPT--- 160

Query: 101 KYVLLKRRYVAKG-GIVIDRKRKDAPVIEPDSLFDMIMSAHLINDHMPWRKVYQHMKGLY 159
           +  L KRRYVA   G V D+ R +  V +P  L++M+M+ HL+NDH  +R+ +  +  +Y
Sbjct: 161 RCALFKRRYVADNEGRVRDQLRGNRIVCDPVLLYEMMMTCHLMNDHAQYRRCHVALSSIY 220

Query: 160 ANVTRELTNMVTGYCSHCNMDRSVRRFSRYKHYNVHEKLMPLERCHVEVFAPFDDEGVEK 219
           AN+TR+       +CS CN  + V    ++KH N ++ ++PLER H+E+F PF+ +   K
Sbjct: 221 ANITRDFLYKAVQFCSVCNPSKLVGPLLKFKHVNYYKGMLPLERVHIEIFEPFNGK---K 277

Query: 220 IQGKYSHFLYCRDYHSRFIWLLPLEGIAFRYLLPALAQLLCTMIRVPIFLETATLDRQDM 279
           I+GKYSH +YCRDY SR+I L PL+   F+ L+ A+A+LL  + R+PIF+ET +L+ QD 
Sbjct: 278 IEGKYSHVIYCRDYRSRYIMLEPLKNTKFKNLVSAIAKLLFNLPRIPIFIETVSLNTQDA 337

Query: 280 FDICEVIARRYKFKIGLGLNSGTEFQKNGIKRVKQLLSEYKEECQDDWNMCLRLVLSRVN 339
           FDI E I  +Y+  +GLG+ +   F   G+K++K LL  +++EC +DW MCL+      N
Sbjct: 338 FDIFEAIVEKYQINVGLGMKTAKRFHTRGVKQMKILLEGHRKECLNDWTMCLKYGPHNYN 397

Query: 340 QTYADRVRGIPSDLLCNEIPNISMXXXXXXXXXXDQLYAHHVVHFKEAGGMIYLEDE 396
             + DR  G+P DLL   + +++             L   ++V      G IYLE++
Sbjct: 398 TKHNDRACGVPVDLLTCNVKDVTHKSIEKYEQIIRTLPKDNIVQI--GNGSIYLEEK 452

>TPHA0J00740 Chr10 (175036..176262) [1227 bp, 408 aa] {ON} Anc_8.262
           YDR110W
          Length = 408

 Score =  187 bits (475), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 101/336 (30%), Positives = 184/336 (54%), Gaps = 13/336 (3%)

Query: 31  VPQTDLNLYQLD-GS-LEHEWIDRGRGELRKIMKTVKGQLTQEIYDLIASDTLSTQKLLE 88
           +P+ D+ LY+++ GS ++ E I+ GR +  ++       LTQ++Y LI     + +   E
Sbjct: 24  IPELDI-LYKIELGSDIDIERINHGRNDHLQLESVFSSFLTQKMYTLIREKNFNYETFEE 82

Query: 89  CCDKVTPN------TVENKYVLLKRRY-VAKGGIVIDRKRKDAPVIEPDSLFDMIMSAHL 141
                  +      T   K++L++ RY + + G + D++     ++ P+ ++D+IM  H 
Sbjct: 83  AMKSHYTDSGKYMGTANKKFMLMEDRYQLNELGQITDKRNDYKLIVPPNQIYDLIMHCHF 142

Query: 142 INDHMPWRKVYQHMKGLYANVTRELTNMVTGYCSHCNMDRSVRRFSRYKHYNVHEKLMPL 201
           +NDH+   K++  ++  Y+N++R L  +    CSHCN   + +     +H++  +K    
Sbjct: 143 LNDHLGSTKIHHSLREKYSNISRALVRLSLQNCSHCNPKSTYKHIEYTRHFSC-DKNFAF 201

Query: 202 ERCHVEVFAPFDDEGVEKIQGKYSHFLYCRDYHSRFIWLLPLEGIAFRYLLPALAQLLCT 261
           E+ HVE+F PF+D  V+    K+SH +Y RDY +R++WL PLE I+ + L   LA  L  
Sbjct: 202 EKIHVEIFQPFED--VDTFANKFSHVIYIRDYFTRYVWLYPLEKISVKELANTLATHLLL 259

Query: 262 MIRVPIFLETATLDRQDMFDICEVIARRYKFKIGLGLNSGTEFQKNGIKRVKQLLSEYKE 321
            +R+PI++E+ TLD  ++  I + I++     +G+G     EFQ +GI  +K+L  + +E
Sbjct: 260 SLRIPIYIESLTLDESNLLKILKRISKTTNLILGVGTTKLDEFQASGINHMKELFVQNRE 319

Query: 322 ECQDDWNMCLRLVLSRVNQTYADRVRGIPSDLLCNE 357
            C ++WN  +    +  N TY   + GIP +L+  E
Sbjct: 320 YCGNNWNKYVIRCQNHYNTTYNKWIYGIPLNLMAQE 355

>KNAG0H03240 Chr8 complement(603920..605479) [1560 bp, 519 aa] {ON}
           Anc_8.262 YDR110W
          Length = 519

 Score =  172 bits (436), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 99/314 (31%), Positives = 168/314 (53%), Gaps = 6/314 (1%)

Query: 42  DGSLEHEWIDRGRGELRKIMKTVKGQLTQEIYDLIASDTLSTQKLLECCDKVTPNTVENK 101
           D  L+ E+  RG  ++     T  G+++QE+Y L  +D ++ + +              K
Sbjct: 48  DEKLDIEFCKRGERDITAYAPTQPGRMSQELYALFKNDDVTKENIARLYPTDRSGDESRK 107

Query: 102 YVLLKRRYVAKG-GIVIDRKRKDAPVIEPDSLFDMIMSAHLINDHMPWRKVYQHMKGLYA 160
            + + RRY     G++ D    +  V +P   FD+IMS HL+N H+   +VY+ ++  YA
Sbjct: 108 MMYITRRYYKDANGMIRDATMNNRIVYDPIHTFDIIMSCHLMNKHLGSERVYRCLREFYA 167

Query: 161 NVTRELTNMVTGYCSHCNMDRSVRRFSRYKHYNVHEKLMPLERCHVEVFAPFDDEGVEKI 220
           N    L      YCS CN    +    + K Y + EK +PLER  +E+  PF +E   K+
Sbjct: 168 NGGPLLIKRTLEYCSVCNPSLKLTPKVQPKPY-LFEKALPLERITIEIIEPFPNE---KV 223

Query: 221 QGKYSHFLYCRDYHSRFIWLLPLEGIAFRYLLPALAQLLCTMIRVPIFLETATLDRQDMF 280
           +GKYS+ +  +D+  RF WL PL+   F+ ++P +A+++ +  RVPI++E+ TLD  D+F
Sbjct: 224 EGKYSNMVVMKDFIGRFEWLEPLKNTKFKNIVPVVAKMILSFPRVPIWVESNTLDWSDLF 283

Query: 281 DICEVIARRYKFKIGLGLNSGTEFQKNGIKRVKQLLSEYKEECQDDWNMCLRLVLSRVNQ 340
           DI E+I  +Y  KIGLG  + +   +    R+ + L+++ +EC  D+N CL+   ++ NQ
Sbjct: 284 DIFEMIVTKYGIKIGLGCTTRSSAAQ-ATARINRDLNDHHDECLFDFNNCLKYGPTKYNQ 342

Query: 341 TYADRVRGIPSDLL 354
                    P D++
Sbjct: 343 IKYLGFHKSPCDII 356

>TBLA0E04430 Chr5 (1136737..1138182) [1446 bp, 481 aa] {ON}
           Anc_8.262 YDR110W
          Length = 481

 Score =  170 bits (430), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 103/365 (28%), Positives = 184/365 (50%), Gaps = 18/365 (4%)

Query: 48  EWIDRGRGELRKIMKTVKGQLTQEIYDLIASDTLSTQKLLECCDKVTPNT-VENKYVLLK 106
           E +++G  ++++        LTQE  D++ + TLS + +++   K+T ++    KY    
Sbjct: 53  ELLEKGYKDMQRYHSIKAAVLTQEYCDMLNTGTLSPENIIKYDTKLTNHSKALEKYNFTS 112

Query: 107 RRY-VAKGGIVIDRKRKDAPVIEPDSLFDMIMSAHLINDHMPWRKVYQHMKGLYANVTRE 165
           RRY + +   +ID+++    + EP  ++D++++ HL   H  +  V + +K  ++NV R+
Sbjct: 113 RRYYLNEDNNIIDKRKPGRIICEPKYMYDIVIAYHL-KLHSSY-AVSERLKKFFSNVGRQ 170

Query: 166 LTNMVTGYCSHCNMDRSVR--------RFSRYKHYNVHEKLMPLERCHVEVFAPFDDEGV 217
             +    YCS C  D +           F   ++  +   L P+ER H+E+F PFDD   
Sbjct: 171 YIDYCAKYCSKCFPDETEHMKLFTDDITFKNIRNNIIDRPLFPMERIHIEIFNPFDDL-- 228

Query: 218 EKIQGKYSHFLYCRDYHSRFIWLLPLEGIAFRYLLPALAQLLCTM-IRVPIFLETATLDR 276
            KI+ KY   LY RDY +R+IW   L+ +  +++   L +   ++   VPIFL+++T+D 
Sbjct: 229 -KIENKYQRILYIRDYSTRYIWTFTLKKLKLKHITNILTEFFLSIATNVPIFLQSSTIDN 287

Query: 277 QDMFDICEVIARRYKFKIGLGLNSGTE-FQKNGIKRVKQLLSEYKEECQDDWNMCLRLVL 335
            D+FDICE I+R Y   +GLG N+  + F  +GI+  KQL++  K +C   W+  L    
Sbjct: 288 TDLFDICEKISREYHISLGLGTNNKHDHFHLSGIEMFKQLVNLNKSKCLKSWSNFLVFGS 347

Query: 336 SRVNQTYADRVRGIPSDLL-CNEIPNISMXXXXXXXXXXDQLYAHHVVHFKEAGGMIYLE 394
              N  +  R+   P D++ CN +                Q    + V       +I++E
Sbjct: 348 VLHNNKFNSRILSKPIDIINCNNLAQGKKKFRDRRLRIIKQTITDNYVKLGNVASIIFIE 407

Query: 395 DEESA 399
           DE ++
Sbjct: 408 DEATS 412

>TPHA0A01810 Chr1 complement(365982..367355) [1374 bp, 457 aa] {ON}
           Anc_8.262 YDR110W
          Length = 457

 Score =  159 bits (402), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 100/376 (26%), Positives = 184/376 (48%), Gaps = 17/376 (4%)

Query: 54  RGELRKIMKTVKGQLTQEIYDLIASDTLSTQKLLECCDKVTPNTVENKYVLLKRRYVAKG 113
           +GE+  +  +    L++E+YDL+ +D L+ + +    +    N +  + + LK RY    
Sbjct: 55  KGEI-AVANSKTNYLSKELYDLVKNDDLTRKNVAVALNLDEKNAI-TRLIPLKHRYYRDS 112

Query: 114 GIVI-DRKRKDAPVIEPDSLFDMIMSAHLINDHMPWRKVYQHMKGLYANVTRELTNMVTG 172
            +++ DR +++  VI+P   F M+M+ HL+NDH+    +Y+ +   +AN++         
Sbjct: 113 KLMVHDRSKQNKIVIDPAHRFRMVMTTHLLNDHLTRGAIYRTLSKCFANLSDPFIKTSIE 172

Query: 173 YCSHCNMDRSVRRFSRYKHYNVHEKLMPLERCHVEVFAPFDDEGVEKIQGKYSHFLYCRD 232
           YCS CN ++   R  +    +    ++  ER  ++V APF   G +KIQ +Y+H L   D
Sbjct: 173 YCSICNSNKKNIRRKKEPQLSNSPDILFYERLILDVVAPF---GAKKIQKRYTHILTITD 229

Query: 233 YHSRFIWLLPLEGIAFRYLLPALAQLLCTMIRVPIFLETATLDRQDMFDICEVIARRYKF 292
           +H++F+W  PL+ +  R ++  + + +  +   P+F+ + TL   D+F++C  +AR Y  
Sbjct: 230 FHTKFMWSFPLKNLKLRTIISKVTEFIVALPVKPVFISSFTLSLNDIFELCCYLAREYNI 289

Query: 293 KIGLGL-NSGTEFQKNGIKRVKQLLSEYKEECQDDWNMCLRLVLSRVNQTYADRVRGIPS 351
            IGLG  N    + KN    V ++L+ +K EC   W MCL+ +  R + +  D      +
Sbjct: 290 SIGLGTRNMQKAYSKNPY--VTRILNSHKTECLKSWFMCLKWLADRQSNSKFDIRPPNKN 347

Query: 352 DLLCNEIPNISMXXXXXXXXXXDQLYAHHVVHFKEAGGMIYLEDEESAFVMDDPDDDCTP 411
             L + + +              +L + + ++  E    IY EDE S         D   
Sbjct: 348 YGLFSGMTDFLKKYEERSKMIIGRLPSENFINIDEGSHFIYSEDEFSF--------DNLV 399

Query: 412 VPEEPPVASDSIQNSA 427
             E P   S+S+ NS+
Sbjct: 400 EKETPKKLSESVVNSS 415

>TBLA0F03070 Chr6 complement(745795..747132) [1338 bp, 445 aa] {ON}
           Anc_8.262 YDR110W
          Length = 445

 Score =  152 bits (385), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 106/389 (27%), Positives = 182/389 (46%), Gaps = 15/389 (3%)

Query: 26  DEGFKVPQTDLNLYQLDGSLEHEWIDRGRGELRKIMKTVKGQLTQEIYDLIASDTLSTQK 85
           D+ F  P  D +    D  ++ + + RG  E  +   T+K  +T ++Y  +  ++L    
Sbjct: 26  DDFFCPPIGDDDEIYYDSYIDSDMLKRGEKETMEFRNTLKKHITSDLYYAMRDESLLED- 84

Query: 86  LLECCDKVTPNTVE---NKYVLLKRRYVAKGGIVIDRKRKDAPVIEPDSLFDMIMSAHLI 142
                D   P +++   +K + L+ RY       +   + +  + EP  ++ + M AH +
Sbjct: 85  -----DAPIPASLKIKTSKKMYLQIRYSKNSDGDLIETKTNKLLCEPKYIYKLTMKAHFM 139

Query: 143 NDHMPWRKVYQHMKGLYANVTRELTNMVTGYCSHCNMDRSVRRF-SRYKHYNVHEKLMPL 201
           N+HM   K+Y+++   Y N+   L  +V  YCSHCN    +R   S Y   N +   +PL
Sbjct: 140 NNHMRSNKLYRNLSMKYCNIPNLLVVLVLQYCSHCNTTGKIRDIRSNYGQRNQYIDYLPL 199

Query: 202 ERCHVEVFAPFDDEGVEKIQGKYSHFLYCRDYHSRFIWLLPLEGIAFRYLLPALAQLLCT 261
           ER  +++  PF+D  + KI  KYSH L  RDYHSR+ W+ PL+    + +   L + L T
Sbjct: 200 ERLQIDITKPFNDSDI-KIANKYSHILLIRDYHSRYSWIFPLKSPNIKNISTELGKFLVT 258

Query: 262 MIRVPIFLETATLDRQDMFDICEVIARRYKFKIGLGLNSGTE--FQKNGIKRVKQLLS-- 317
           + R PIFL +  +    +  I   I   YK KI +G+       F + GI R+  LL+  
Sbjct: 259 LPRTPIFLHSIGIPESQLIKILTKILLEYKIKIRIGIGGIKGRMFLRKGISRLVYLLNLK 318

Query: 318 EYKEECQDDWNMCLRLVLSRVNQTYADRVRGIPSDLLCNEIPNISMXXXXXXXXXXDQLY 377
           E KE+C+ DW  C+R    + N+ +        + L+  +   ++             L 
Sbjct: 319 ENKEKCKSDWYQCIRNTTFKENRRFDRNTGSFANFLIGKQKAELNKVFENKRDALLSDLL 378

Query: 378 AHHVVHFKEAGGMIYLEDEESAFVMDDPD 406
             +V+   E G +IY ++  S   +D+ D
Sbjct: 379 EENVLKIGECGSIIYFDNNNSGKELDEKD 407

>NDAI0B06160 Chr2 (1494425..1498636) [4212 bp, 1403 aa] {ON} 
          Length = 1403

 Score = 40.4 bits (93), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 24/73 (32%), Positives = 37/73 (50%), Gaps = 7/73 (9%)

Query: 187 SRYKHYNVHEKLMPLERCHVEVFAPFDDEGVEKIQGKYSHFLYCRDYHSRFIWLLPLEGI 246
           SR K+   +E   P E  H ++F P    GV+    KY  F+   D ++RF W+ PL+  
Sbjct: 365 SRLKYQKSYE---PFEYIHTDLFGPV--SGVDITSPKY--FISFTDENTRFRWVFPLKKK 417

Query: 247 AFRYLLPALAQLL 259
              ++LP   QL+
Sbjct: 418 DADHILPIFQQLV 430

>NDAI0G00550 Chr7 complement(116985..118223) [1239 bp, 412 aa] {ON} 
          Length = 412

 Score = 38.5 bits (88), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 24/73 (32%), Positives = 37/73 (50%), Gaps = 7/73 (9%)

Query: 187 SRYKHYNVHEKLMPLERCHVEVFAPFDDEGVEKIQGKYSHFLYCRDYHSRFIWLLPLEGI 246
           SR K+   +E   P E  H ++F P    GV+    KY  F+   D ++RF W+ PL+  
Sbjct: 280 SRLKYQKYYE---PFEYIHTDLFGPV--SGVDITSPKY--FISFTDENTRFRWVFPLKKK 332

Query: 247 AFRYLLPALAQLL 259
              ++LP   QL+
Sbjct: 333 DADHILPIFQQLV 345

>NDAI0G00600 Chr7 complement(130877..132343) [1467 bp, 488 aa] {ON} 
          Length = 488

 Score = 37.0 bits (84), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 40/78 (51%), Gaps = 8/78 (10%)

Query: 185 RFSRYKHYNVHEKL---MPLERCHVEVFAPFDDEGVEKIQGKYSHFLYCRDYHSRFIWLL 241
           + +++KH  V  +L    P+   H ++F P    GV+    KY  F+   D ++RF W+ 
Sbjct: 168 KLTKHKHI-VGSRLNIKSPMSYIHTDLFGPV--SGVDITSPKY--FISFTDENTRFRWVF 222

Query: 242 PLEGIAFRYLLPALAQLL 259
           PL+     ++LP   QL+
Sbjct: 223 PLKKKDADHILPIFQQLV 240

>Kwal_YGOB_56.23979 s56 complement(800041..800457,800459..801775)
           [1734 bp, 577 aa] {ON} ANNOTATED BY YGOB -
          Length = 577

 Score = 34.3 bits (77), Expect = 0.81,   Method: Compositional matrix adjust.
 Identities = 28/111 (25%), Positives = 52/111 (46%), Gaps = 11/111 (9%)

Query: 135 MIMSAHLIN--DHMPWRKVYQHMKGLYANVTRELTNMVTGYCSHCNMDRSVRRFSRYKHY 192
           MI  A+++N  +H  WR+  Q + GL+  V   +T       S  N D S+ + S  + +
Sbjct: 1   MIFRANIVNPENHSIWRRAVQALGGLHEEVKITITQKELIAWSMNNTDTSMCQVSFKRSF 60

Query: 193 NVHEKLMPLERCHVEVFAPFDDEGVEKIQGKY--SHFLYCRDYHSRFIWLL 241
               +  P E         F +EG+++++ K   +H LY    +S+ + +L
Sbjct: 61  FDSYEFKPEETV-------FGEEGLQQVEDKALDTHKLYSFRINSKHLSVL 104

>SAKL0B11583g2 Chr2 (998260..999561,999563..1003528) [5268 bp, 1755
           aa] {ON} Retrotransposon Gag and Pol genes
          Length = 1755

 Score = 34.7 bits (78), Expect = 0.83,   Method: Compositional matrix adjust.
 Identities = 24/104 (23%), Positives = 45/104 (43%), Gaps = 11/104 (10%)

Query: 165 ELTNMVTGYCSHCNMDRSVR----RFSRYKHYNVHEKLMPLERCHVEVFAPFDDEGVEKI 220
           + +   T  C  C + +S +    + SR K+ N +E   P +  H ++F P  +      
Sbjct: 628 DWSKATTYQCPDCLIGKSTKHRHVKGSRVKYQNSYE---PFQYLHTDIFGPVHNLP---- 680

Query: 221 QGKYSHFLYCRDYHSRFIWLLPLEGIAFRYLLPALAQLLCTMIR 264
           +   S+F+   D  +RF W+ PL     + +L     +L  + R
Sbjct: 681 KSAPSYFITFTDEKTRFQWVYPLHDRREQSILEVFTTILAFIER 724

>SAKL0C11913g1 Chr3 complement(1069940..1073905,1073907..1075208)
           [5268 bp, 1755 aa] {ON} Retrotransposon Gag and Pol
           genes
          Length = 1755

 Score = 34.3 bits (77), Expect = 0.88,   Method: Compositional matrix adjust.
 Identities = 24/104 (23%), Positives = 45/104 (43%), Gaps = 11/104 (10%)

Query: 165 ELTNMVTGYCSHCNMDRSVR----RFSRYKHYNVHEKLMPLERCHVEVFAPFDDEGVEKI 220
           + +   T  C  C + +S +    + SR K+ N +E   P +  H ++F P  +      
Sbjct: 628 DWSKATTYQCPDCLIGKSTKHRHVKGSRVKYQNSYE---PFQYLHTDIFGPVHNLP---- 680

Query: 221 QGKYSHFLYCRDYHSRFIWLLPLEGIAFRYLLPALAQLLCTMIR 264
           +   S+F+   D  +RF W+ PL     + +L     +L  + R
Sbjct: 681 KSAPSYFITFTDEKTRFQWVYPLHDRREQSILEVFTTILAFIER 724

>Kwal_56.23979 s56 complement(800486..801775) [1290 bp, 430 aa]
           {OFF} YPL194W (DDC1) - DNA damage checkpoint gene
           [contig 168] PARTIAL
          Length = 430

 Score = 33.5 bits (75), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 28/111 (25%), Positives = 52/111 (46%), Gaps = 11/111 (9%)

Query: 135 MIMSAHLIN--DHMPWRKVYQHMKGLYANVTRELTNMVTGYCSHCNMDRSVRRFSRYKHY 192
           MI  A+++N  +H  WR+  Q + GL+  V   +T       S  N D S+ + S  + +
Sbjct: 1   MIFRANIVNPENHSIWRRAVQALGGLHEEVKITITQKELIAWSMNNTDTSMCQVSFKRSF 60

Query: 193 NVHEKLMPLERCHVEVFAPFDDEGVEKIQGKY--SHFLYCRDYHSRFIWLL 241
               +  P E         F +EG+++++ K   +H LY    +S+ + +L
Sbjct: 61  FDSYEFKPEETV-------FGEEGLQQVEDKALDTHKLYSFRINSKHLSVL 104

>NDAI0D03010 Chr4 complement(712188..714524) [2337 bp, 778 aa] {ON} 
          Length = 778

 Score = 33.1 bits (74), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 25/93 (26%), Positives = 39/93 (41%), Gaps = 12/93 (12%)

Query: 159 YANVTRELTNMVTGYCSHCNMDRSVRRFSRYKHYNVHEKLMPL-----ERCHVEVFAPFD 213
           Y N+++ L + V   C  C      +  S  K       ++PL     +R  V++ +  D
Sbjct: 196 YHNISKFLIHDVVAACPDC------KPLSSKKFNITRVNVLPLTRYSFQRLQVKILSAAD 249

Query: 214 DEGV-EKIQGKYSHFLYCRDYHSRFIWLLPLEG 245
              V  K     +  LY  DYHS  +WL  L+G
Sbjct: 250 YSCVCPKDNCTKNAILYIGDYHSGAVWLFALDG 282

>Skud_12.300 Chr12 complement(546310..547503) [1194 bp, 398 aa] {ON}
           YNL054W-B (REPEAT)
          Length = 398

 Score = 32.7 bits (73), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 20/81 (24%), Positives = 37/81 (45%), Gaps = 7/81 (8%)

Query: 165 ELTNMVTGYCSHCNMDRSVR-RFSRYKHYNVHEKLMPLERCHVEVFAPFDDEGVEKI-QG 222
           + +N +T  C  C + +S + R+ +       E   P +  H ++F P     V  + + 
Sbjct: 196 DWSNPITYQCLDCLLGKSTKHRYVKGSRLKYQESYQPFQYLHTDIFGP-----VHHLPKS 250

Query: 223 KYSHFLYCRDYHSRFIWLLPL 243
             S+F+   D  +RF W+ PL
Sbjct: 251 APSYFISFTDEKTRFKWVYPL 271

>Smik_49.2 Chr49 (115..1764) [1650 bp, 550 aa] {ON} YNL054W-B
           (REPEAT)
          Length = 550

 Score = 32.7 bits (73), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 24/98 (24%), Positives = 39/98 (39%), Gaps = 7/98 (7%)

Query: 165 ELTNMVTGYCSHCNMDRSVR-RFSRYKHYNVHEKLMPLERCHVEVFAPFDDEGVEKI-QG 222
           E +N  T  C  C + +S + R  +       E   P +  H ++F P     V  + + 
Sbjct: 200 EWSNASTYQCPDCLIGKSTKHRHVKGSRLKYQESYEPFQYLHTDIFGP-----VHHLPKS 254

Query: 223 KYSHFLYCRDYHSRFIWLLPLEGIAFRYLLPALAQLLC 260
             S+F+   D  +RF W+ PL       +L     LL 
Sbjct: 255 APSYFISFTDEKTRFQWVYPLHDRREESILNVFTSLLA 292

>Kwal_56.22825 s56 (292515..295409) [2895 bp, 964 aa] {ON} YDL035C
           (GPR1) - G-protein coupled receptor [contig 184] FULL
          Length = 964

 Score = 32.3 bits (72), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 32/57 (56%), Gaps = 8/57 (14%)

Query: 412 VPEEPPVA-------SDSIQNSATILTPITSTQITENEVARQ-DPDQLEIRPPSQNN 460
           VP  P +A       ++S +  +T L+P+ S    +NE+ RQ +PD ++ R  SQN+
Sbjct: 491 VPSLPHMAMGSKSSFANSGRQKSTTLSPVRSVVSDDNEIVRQRNPDAIKFRQHSQND 547

>CAGL0J08074g Chr10 (794667..795710) [1044 bp, 347 aa] {ON} similar
           to uniprot|P53844 Saccharomyces cerevisiae YNL264c PDR17
           involved in regulating phosphatidylserine metabolism
          Length = 347

 Score = 31.6 bits (70), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 34/64 (53%), Gaps = 9/64 (14%)

Query: 86  LLECCDKVTPNTVENKYVLLKRRYVAKGGIVIDRKRKDAPVIEPDSLFDMIMSAHLINDH 145
           ++EC   +TP  VE   VL+  ++  + GI+ D+    AP   P S+  M +  H++ +H
Sbjct: 180 MMECATTLTPQGVEKMCVLVDFKHYKEPGIITDK----AP---PISIAKMCL--HIMQNH 230

Query: 146 MPWR 149
            P R
Sbjct: 231 YPER 234

>Kwal_56.22670 s56 complement(228050..230080) [2031 bp, 676 aa] {ON}
           YGR109W-B - TyB Gag-Pol protein [contig 184] FULL
          Length = 676

 Score = 31.6 bits (70), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 35/143 (24%), Positives = 54/143 (37%), Gaps = 19/143 (13%)

Query: 223 KYSHFLYCRDYHSRFIWLLPLEGIAFRYLLPALAQLLCTMIRVPIFLETATLDRQDMFDI 282
           K SHF+ C     +    + +  + FRY+                F +T T DR   F  
Sbjct: 340 KRSHFVAC---EKKVTGEMAMIDLLFRYVFAYHG-----------FPKTITSDRDGRFVS 385

Query: 283 CEVIARRYKFKIGLGLNSGTEFQKNG-----IKRVKQLLSEYKEECQDDWNMCLRLVLSR 337
                   K  I L ++S    Q NG     I+ + QLL  Y +E + +W++ L  V   
Sbjct: 386 VAYQELANKLGIKLKMSSSNHPQTNGQAERCIQVLNQLLRIYTKEYRQEWDIMLPQVEFA 445

Query: 338 VNQTYADRVRGIPSDLLCNEIPN 360
            N T+   +   P +      PN
Sbjct: 446 YNSTFNIAIGMAPFEADIGFCPN 468

>Kwal_26.8300 s26 (729038..731746) [2709 bp, 902 aa] {ON} YGR109W-B
           - TyB Gag-Pol protein [contig 280] FULL
          Length = 902

 Score = 31.2 bits (69), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 35/143 (24%), Positives = 54/143 (37%), Gaps = 19/143 (13%)

Query: 223 KYSHFLYCRDYHSRFIWLLPLEGIAFRYLLPALAQLLCTMIRVPIFLETATLDRQDMFDI 282
           K SHF+ C     +    + +  + FRY+                F +T T DR   F  
Sbjct: 566 KRSHFVAC---EKKVTGEMAMIDLLFRYVFAYHG-----------FPKTITSDRDGRFVS 611

Query: 283 CEVIARRYKFKIGLGLNSGTEFQKNG-----IKRVKQLLSEYKEECQDDWNMCLRLVLSR 337
                   K  I L ++S    Q NG     I+ + QLL  Y +E + +W++ L  V   
Sbjct: 612 VAYQELANKLGIKLKMSSSNHPQTNGQAERCIQVLNQLLRIYTKEYRQEWDIMLPQVEFA 671

Query: 338 VNQTYADRVRGIPSDLLCNEIPN 360
            N T+   +   P +      PN
Sbjct: 672 YNSTFNIAIGMAPFEADIGFCPN 694

>Kwal_23.5250 s23 complement(1075954..1078662) [2709 bp, 902 aa]
           {ON} YGR109W-B - TyB Gag-Pol protein [contig 8] FULL
          Length = 902

 Score = 31.2 bits (69), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 35/143 (24%), Positives = 54/143 (37%), Gaps = 19/143 (13%)

Query: 223 KYSHFLYCRDYHSRFIWLLPLEGIAFRYLLPALAQLLCTMIRVPIFLETATLDRQDMFDI 282
           K SHF+ C     +    + +  + FRY+                F +T T DR   F  
Sbjct: 566 KRSHFVAC---EKKVTGEMAMIDLLFRYVFAYHG-----------FPKTITSDRDGRFVS 611

Query: 283 CEVIARRYKFKIGLGLNSGTEFQKNG-----IKRVKQLLSEYKEECQDDWNMCLRLVLSR 337
                   K  I L ++S    Q NG     I+ + QLL  Y +E + +W++ L  V   
Sbjct: 612 VAYQELANKLGIKLKMSSSNHPQTNGQAERCIQVLNQLLRIYTKEYRQEWDIMLPQVEFA 671

Query: 338 VNQTYADRVRGIPSDLLCNEIPN 360
            N T+   +   P +      PN
Sbjct: 672 YNSTFNIAIGMAPFEADIGFCPN 694

>KNAG0E03530 Chr5 (705077..708016) [2940 bp, 979 aa] {ON} Anc_7.153
           YIR002C
          Length = 979

 Score = 31.2 bits (69), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 33/66 (50%), Gaps = 11/66 (16%)

Query: 58  RKIMKTVKGQLTQEIYDLIASDTLSTQKL-LECCDKVTPNTVENKYVLLKRRYVAKGGIV 116
           R+ +K +K + T+ I DLIA D++S   + L   D             LK+R V K    
Sbjct: 760 REPVKEIKTEGTRRIVDLIAEDSISDNDVDLHAIDDAN----------LKKRNVCKPSTT 809

Query: 117 IDRKRK 122
           +D+KRK
Sbjct: 810 VDKKRK 815

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.136    0.404 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 57,139,762
Number of extensions: 2502885
Number of successful extensions: 7717
Number of sequences better than 10.0: 53
Number of HSP's gapped: 7879
Number of HSP's successfully gapped: 53
Length of query: 534
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 420
Effective length of database: 40,409,475
Effective search space: 16971979500
Effective search space used: 16971979500
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 68 (30.8 bits)